Protein Family IF00042
Metagenome
Isolate
264
Members
209
Samples
119
Scaffolds
400.87
Avg Length
Representative Sequence
- ID
- 2044078006|SPBB_contig11524|SPBB_334520
- Length
- 449 aa
- Sequence
- MRIIGAVALAHLINDLIQAVLPSIYPMLKQSYGLTFTQVGLITLAFQLTASLLQPWVGYYTDRHPKPYLLPMGMICTLIGILMMSQVGSFPLILLASALIGIGSSTFHPEASRVARLASGGRFGLAQSTFQVGGNAGTAFGPLLAAAIIIPYGQGNVAWFGLFAVFALVVLYAISRWYANHLRLFKLKQGQAATHGLSKARVLSALVVLGLLVFSKYFYMSSFTSYFTFYLIEKFDLSVASSQLHLFLFLGAVAAGTFFGGPIGDRIGRKAVIWFSILGVAPFTLILPHVDLFWTSVLSVVIGFILASAFSAIVVYAQELVPGNVGMIAGVFFGLMFGFGGIGAALLGYVADAHGIEYVYRLCAYLPLFGILAIFLPRSKKPDRPRACPRSVSCVADRSRVTQLPPLSSNRPASAGRKRCRALYEKGFRFFLFLNDIHLHYNRAFLSAP
Sample Types
Isolate
54.9%
Metagenome
45.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Apidae
22.1%
Unclassified
16.9%
Curculionidae
7.2%
Drosophilidae
6.7%
Anthocoridae
6.7%
Culicidae
6.7%
Elmidae
6.2%
Tenebrionidae
4.1%
Kalotermitidae
3.6%
Armadillidiidae
3.1%
Termitidae
3.1%
Calliphoridae
2.1%
Cerambycidae
2.1%
Termopsidae
1.5%
Tephritidae
1.5%
Pentatomidae
1.0%
Rhinotermitidae
1.0%
Passalidae
1.0%
Rhopalidae
0.5%
Plutellidae
0.5%
Carabidae
0.5%
Formicidae
0.5%
Ceratophyllidae
0.5%
Siricidae
0.5%
Pteromalidae
0.5%
Taxonomy
Archaea
0
Bacteria
249
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 2 | 2840748007 | Snodgrassella alvi A-1-12 | Isolate | Apidae |
| 3 | 2846363972 | Snodgrassella alvi N-W7 | Isolate | Apidae |
| 4 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 5 | 2849406737 | Snodgrassella alvi PEB0178 | Isolate | Apidae |
| 6 | 2849415715 | Snodgrassella alvi A2 | Isolate | Apidae |
| 7 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 8 | 2864840607 | Acinetobacter johnsonii S00071 | Isolate | Elmidae |
| 9 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 10 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 11 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 12 | 2820110010 | Unclassified Proteobacteria Emb289P4bin35 | Isolate | Unclassified |
| 13 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 14 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 15 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 16 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 17 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 18 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 19 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 25 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 26 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 27 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 28 | 8101263066 | Snodgrassella sp. M0351 | Isolate | Apidae |
| 29 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 30 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 31 | 2834412944 | Snodgrassella alvi A-5-24 | Isolate | Apidae |
| 32 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 33 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 34 | 2857825141 | Snodgrassella alvi wkB332 | Isolate | Apidae |
| 35 | 2857830159 | Snodgrassella alvi A-9-24 | Isolate | Apidae |
| 36 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 37 | 2864804954 | Acinetobacter johnsonii S00050 | Isolate | Elmidae |
| 38 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 39 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 40 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 41 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 42 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 43 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 44 | 3300000479 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-P14 | Metagenome | Apidae |
| 45 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 46 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 47 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 48 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 49 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 53 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 54 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 55 | 8101258116 | Snodgrassella sp. M0112 | Isolate | Apidae |
| 56 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 57 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 58 | 2849411303 | Snodgrassella alvi A3 | Isolate | Apidae |
| 59 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 60 | 2857835046 | Snodgrassella alvi wkB9 | Isolate | Apidae |
| 61 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 62 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 63 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 64 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 65 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 66 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 67 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 68 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 69 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 70 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 71 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 72 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 73 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 74 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 75 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 76 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 77 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 78 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 79 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 80 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 81 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 82 | 8101274435 | Snodgrassella sp. W8134 | Isolate | Apidae |
| 83 | 8101276651 | Snodgrassella sp. W8135 | Isolate | Apidae |
| 84 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 85 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 86 | 2864863795 | Acinetobacter johnsonii S00116 | Isolate | Elmidae |
| 87 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 88 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 89 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 90 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 91 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 92 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 93 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 94 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 95 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 96 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 97 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 98 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 99 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 100 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 101 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 102 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 103 | 8101255641 | Snodgrassella sp. M0110 | Isolate | Apidae |
| 104 | 8101260589 | Snodgrassella sp. M0118 | Isolate | Apidae |
| 105 | 8101267702 | Snodgrassella sp. W6238H14 | Isolate | Apidae |
| 106 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 107 | 8119099601 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 108 | 2828301124 | Sphingomonas leidyi DSM 4733 | Isolate | Unclassified |
| 109 | 2854100132 | Snodgrassella alvi A-2-12 | Isolate | Apidae |
| 110 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 111 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 112 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 113 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 114 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 115 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 116 | 2585428136 | Snodgrassella alvi wkB2 | Isolate | Apidae |
| 117 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 118 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 119 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 120 | 3300000475 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-J21 | Metagenome | Apidae |
| 121 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 122 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 123 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 124 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 125 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 126 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 127 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 128 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 129 | 8101270055 | Snodgrassella sp. W8124 | Isolate | Apidae |
| 130 | 8101278866 | Snodgrassella sp. W6238H11 | Isolate | Apidae |
| 131 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 132 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 133 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 134 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 135 | 2849402121 | Snodgrassella alvi A-10-12 | Isolate | Apidae |
| 136 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 137 | 2854091108 | Snodgrassella alvi wkB339 | Isolate | Apidae |
| 138 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 139 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 140 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 141 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 142 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 143 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 144 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 145 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 146 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 147 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 148 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 149 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 150 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 151 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 152 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 153 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 154 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 155 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 156 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 157 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 158 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 159 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 160 | 8101272231 | Snodgrassella sp. W8132 | Isolate | Apidae |
| 161 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 162 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 163 | 2846368606 | Snodgrassella alvi A-11-12 | Isolate | Apidae |
| 164 | 2849404451 | Snodgrassella alvi E1 | Isolate | Apidae |
| 165 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 166 | 2854088767 | Snodgrassella alvi MS1-3 | Isolate | Apidae |
| 167 | 2857840086 | Snodgrassella alvi Aw-20 | Isolate | Apidae |
| 168 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 169 | 2684622927 | Snodgrassella alvi Sa_196 | Isolate | Unclassified |
| 170 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 171 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 172 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 173 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 174 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 175 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 176 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 177 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 178 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 179 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 180 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 181 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 182 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 183 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 184 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 185 | 2846361553 | Snodgrassella alvi PEB0171 | Isolate | Apidae |
| 186 | 2852205774 | Snodgrassella alvi ESL0196 | Isolate | Apidae |
| 187 | 2854086477 | Snodgrassella alvi N-S3 | Isolate | Apidae |
| 188 | 2854097802 | Snodgrassella alvi Aw-18 | Isolate | Apidae |
| 189 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 190 | 2864843793 | Acinetobacter johnsonii S00075 | Isolate | Elmidae |
| 191 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 192 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 193 | 2958255616 | Serratia marcescens TM | Isolate | |
| 194 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 195 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 196 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 197 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 198 | 2811994808 | Snodgrassella alvi Sa_196 v2 | Isolate | Unclassified |
| 199 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 200 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 201 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 202 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 203 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 204 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 205 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 206 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 207 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 208 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 209 | 8101265296 | Snodgrassella sp. W8158 | Isolate | Apidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160468_100256 | 3300012819 | Bacteria | 28144 |
| 2 | Ga0160434_100510 | 3300012850 | Bacteria | 10217 |
| 3 | Ga0160430_106571 | 3300012852 | Bacteria | 2460 |
| 4 | Ga0160436_1000547 | 3300012861 | Bacteria | 13800 |
| 5 | Ga0466724_03330 | 3300042649 | Bacteria | 44563 |
| 6 | Ga0466724_05777 | 3300042649 | Unclassified | 50607 |
| 7 | Ga0466724_68222 | 3300042649 | Unclassified | 21408 |
| 8 | Ga0466701_036438 | 3300042598 | Bacteria | 169982 |
| 9 | Ga0466707_014260 | 3300042601 | Bacteria | 17940 |
| 10 | Ga0466713_014081 | 3300042602 | Bacteria | 234884 |
| 11 | Ga0466719_561542 | 3300042606 | Bacteria | 2448 |
| 12 | IMNBL1DRAFT_c0001827 | 3300000062 | Bacteria | 15502 |
| 13 | SCG598P14_112701 | 3300000479 | Bacteria | 35504 |
| 14 | Ga0466705_448479 | 3300042612 | Bacteria | 2185 |
| 15 | Ga0160453_100016 | 3300012814 | Bacteria | 266659 |
| 16 | Ga0160467_102188 | 3300012829 | Bacteria | 4812 |
| 17 | Ga0160446_101339 | 3300012835 | Bacteria | 5470 |
| 18 | Ga0160460_101203 | 3300012845 | Bacteria | 9714 |
| 19 | Ga0160435_1000298 | 3300012857 | Bacteria | 21126 |
| 20 | Ga0466735_143378 | 3300042624 | Bacteria | 3964 |
| 21 | Ga0466735_170596 | 3300042624 | Bacteria | 3429 |
| 22 | Ga0466730_019112 | 3300042625 | Unclassified | 4349 |
| 23 | Ga0466730_053692 | 3300042625 | Bacteria | 19216 |
| 24 | Ga0466724_23693 | 3300042649 | Bacteria | 54133 |
| 25 | Ga0466724_54961 | 3300042649 | Bacteria | 72912 |
| 26 | Ga0466724_64498 | 3300042649 | Bacteria | 13151 |
| 27 | Ga0466727_118354 | 3300042655 | Bacteria | 4444 |
| 28 | Ga0123357_10024752 | 3300009784 | Bacteria | 8090 |
| 29 | Ga0466701_019405 | 3300042598 | Bacteria | 47076 |
| 30 | Ga0466707_064926 | 3300042601 | Bacteria | 3850 |
| 31 | HBC_ctgsDRAFT_1013222 | 3300000333 | Unclassified | 1986 |
| 32 | Meta3P_1000236 | 3300002464 | Bacteria | 24894 |
| 33 | Ga0104040_1039457 | 3300007149 | Bacteria | 5340 |
| 34 | Ga0104147_1027984 | 3300007224 | Bacteria | 12805 |
| 35 | Ga0160432_100496 | 3300012818 | Bacteria | 24900 |
| 36 | Ga0160435_1000142 | 3300012857 | Bacteria | 40334 |
| 37 | Ga0466696_215115 | 3300042596 | Bacteria | 1580 |
| 38 | Ga0466730_029041 | 3300042625 | Bacteria | 10891 |
| 39 | Ga0466724_51867 | 3300042649 | Unclassified | 19042 |
| 40 | Ga0123357_10008532 | 3300009784 | Bacteria | 12816 |
| 41 | Ga0123354_10004897 | 3300010882 | Bacteria | 19199 |
| 42 | Ga0466701_031174 | 3300042598 | Bacteria | 92921 |
| 43 | Ga0466707_022169 | 3300042601 | Bacteria | 38620 |
| 44 | Ga0466707_233833 | 3300042601 | Bacteria | 1571 |
| 45 | SPBB_contig11524 | 2044078006 | Bacteria | 77152 |
| 46 | SWWA_contig31857__length_4576___numreads_238 | 2100351016 | Unclassified | 4576 |
| 47 | 2227247477 | 2225789004 | Unclassified | 7161 |
| 48 | HBC_ctgsDRAFT_1008214 | 3300000333 | Bacteria | 2471 |
| 49 | Meta3P_1000705 | 3300002464 | Unclassified | 11343 |
| 50 | Ga0063521_1000082 | 3300003973 | Bacteria | 78761 |
| 51 | Ga0074278_109326 | 3300005721 | Bacteria | 18720 |
| 52 | Ga0104042_1035014 | 3300007130 | Bacteria | 3467 |
| 53 | Ga0104050_1001141 | 3300007153 | Bacteria | 13085 |
| 54 | Ga0160431_100262 | 3300012828 | Bacteria | 33659 |
| 55 | Ga0160433_100155 | 3300012846 | Bacteria | 58519 |
| 56 | Ga0466691_079274 | 3300042593 | Bacteria | 5036 |
| 57 | Ga0466730_001041 | 3300042625 | Bacteria | 1802 |
| 58 | Ga0466730_007214 | 3300042625 | Bacteria | 2834 |
| 59 | Ga0466730_013284 | 3300042625 | Bacteria | 61349 |
| 60 | Ga0466730_087551 | 3300042625 | Bacteria | 89610 |
| 61 | Ga0466724_60162 | 3300042649 | Bacteria | 60503 |
| 62 | Ga0123357_10030840 | 3300009784 | Bacteria | 7273 |
| 63 | Ga0466707_269881 | 3300042601 | Bacteria | 1558 |
| 64 | 2227080769 | 2225789004 | Bacteria | 257506 |
| 65 | 2227530177 | 2225789004 | Bacteria | 16424 |
| 66 | SCG598J21_12951 | 3300000475 | Bacteria | 44371 |
| 67 | CVPL010L_1001188 | 3300002932 | Unclassified | 5759 |
| 68 | Ga0466711_044119 | 3300042615 | Bacteria | 2950 |
| 69 | Ga0160458_100074 | 3300012832 | Bacteria | 123747 |
| 70 | Ga0160472_100574 | 3300012839 | Unclassified | 21341 |
| 71 | Ga0160430_100002 | 3300012852 | Bacteria | 510179 |
| 72 | Ga0160436_1006530 | 3300012861 | Unclassified | 2695 |
| 73 | Ga0247289_0300 | 3300035363 | Unclassified | 8775 |
| 74 | Ga0466730_009057 | 3300042625 | Bacteria | 8760 |
| 75 | Ga0466704_075067 | 3300042643 | Bacteria | 20540 |
| 76 | Ga0466724_06065 | 3300042649 | Bacteria | 94573 |
| 77 | Ga0160454_100224 | 3300012798 | Bacteria | 57381 |
| 78 | SPBB_contig00360 | 2044078006 | Bacteria | 40893 |
| 79 | FGTW_contig30555 | 2065487013 | Bacteria | 12633 |
| 80 | 2227614355 | 2225789004 | Bacteria | 2237 |
| 81 | IMNBL1DRAFT_c0002597 | 3300000062 | Bacteria | 12416 |
| 82 | JGI24702J35022_10017697 | 3300002462 | Bacteria | 3891 |
| 83 | Ga0104049_1131284 | 3300007103 | Bacteria | 2870 |
| 84 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 85 | Ga0466726_429877 | 3300042619 | Bacteria | 26082 |
| 86 | Ga0160445_100004 | 3300012847 | Bacteria | 501773 |
| 87 | Ga0265387_1000108 | 3300024582 | Bacteria | 19205 |
| 88 | Ga0123357_10134869 | 3300009784 | Bacteria | 3057 |
| 89 | Ga0466713_148277 | 3300042602 | Bacteria | 181035 |
| 90 | Ga0105005_1032384 | 3300007505 | Bacteria | 8519 |
| 91 | Ga0466705_358543 | 3300042612 | Bacteria | 7634 |
| 92 | Ga0160472_101074 | 3300012839 | Bacteria | 9449 |
| 93 | Ga0160443_100167 | 3300012848 | Bacteria | 91984 |
| 94 | Ga0160447_100415 | 3300012849 | Bacteria | 21005 |
| 95 | Ga0160436_1000567 | 3300012861 | Bacteria | 13466 |
| 96 | Ga0466692_003819 | 3300042591 | Bacteria | 6401 |
| 97 | Ga0466696_059542 | 3300042596 | Bacteria | 6598 |
| 98 | Ga0466704_230523 | 3300042643 | Bacteria | 1484 |
| 99 | Ga0466724_47936 | 3300042649 | Bacteria | 19059 |
| 100 | Ga0466724_60368 | 3300042649 | Bacteria | 50984 |
| 101 | Ga0466708_094676 | 3300042652 | Bacteria | 157715 |
| 102 | Ga0466701_055000 | 3300042598 | Bacteria | 242806 |
| 103 | Ga0466713_050958 | 3300042602 | Bacteria | 35586 |
| 104 | DPO_contig06369 | 2032320009 | Unclassified | 6563 |
| 105 | Ga0104041_1030476 | 3300007106 | Bacteria | 5327 |
| 106 | Ga0466705_061189 | 3300042612 | Bacteria | 19164 |
| 107 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 108 | Ga0562377_0002 | 3300056842 | Bacteria | 4351833 |
| 109 | Ga0562376_0001 | 3300056857 | Bacteria | 4828905 |
| 110 | Ga0160469_100258 | 3300012824 | Unclassified | 39532 |
| 111 | Ga0160443_102165 | 3300012848 | Bacteria | 4745 |
| 112 | Ga0160443_104787 | 3300012848 | Bacteria | 1963 |
| 113 | Ga0466696_285572 | 3300042596 | Bacteria | 5366 |
| 114 | Ga0160465_100240 | 3300012803 | Bacteria | 40681 |
| 115 | Ga0160465_100382 | 3300012803 | Unclassified | 24074 |
| 116 | Ga0160466_100384 | 3300012809 | Bacteria | 25001 |
| 117 | Ga0466722_140100 | 3300042609 | Bacteria | 12281 |
| 118 | DPO_contig06785 | 2032320009 | Bacteria | 13966 |
| 119 | IMNBL1DRAFT_c0011878 | 3300000062 | Bacteria | 4028 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07690 | MFS_1 | Major Facilitator Superfamily | 211 | 384 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.