NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029799

3300029799: Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119



Overview

Basic Information
IMG/M Taxon OID3300029799 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0130338 | Gp0238878 | Ga0311022
Sample NameMetagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Toronto
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size4319522422
Sequencing Scaffolds1067
Novel Protein Genes1175
Associated Families234

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available240
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays101
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum178
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.3
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-7857
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei29
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum12
All Organisms → cellular organisms → Eukaryota → Opisthokonta23
All Organisms → cellular organisms → Archaea → Euryarchaeota2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae58
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea19
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes10
All Organisms → cellular organisms → Bacteria19
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Candidatus Methanofastidiosa → unclassified Candidatus Methanofastidiosa → Candidatus Methanofastidiosa archaeon2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus17
All Organisms → cellular organisms → Eukaryota14
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae26
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis40
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Tetraoninae → Lagopus → Lagopus muta1
All Organisms → cellular organisms → Archaea → TACK group4
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA1042
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu23
All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Lambdaproteobacteria1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2
All Organisms → cellular organisms → Bacteria → Atribacterota → unclassified Atribacterota → Candidatus Atribacteria bacterium ADurb.Bin2762
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis3
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp.2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Phasianus → Phasianus colchicus3
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae13
All Organisms → cellular organisms → Archaea7
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata21
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae → Syntrophomonas → Syntrophomonas wolfei1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. PtaB.Bin0011
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora5
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium5
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium3
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Brassiceae → Brassica → Brassica cretica2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria8
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin0389
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii2
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin2161
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f55
All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica bacterium OLB161
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 15
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Herelleviridae → Salchichonvirus → Salchichonvirus LP651
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria5
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae3
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC1
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo1
All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Psychroserpens → unclassified Psychroserpens → Psychroserpens sp. MSW61
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Stipodae → Brachypodieae → Brachypodium → Brachypodium distachyon1
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin0283
All Organisms → Viruses → Predicted Viral3
All Organisms → cellular organisms → Bacteria → Caldiserica/Cryosericota group → Caldiserica → Caldisericia → Caldisericales → unclassified Caldisericales → Caldisericales bacterium1
All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Kosmotogales → Kosmotogaceae → Mesotoga1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii2
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → unclassified Ignavibacteriales → Ignavibacteriales bacterium1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Caprinae → Ovis → Ovis aries2
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales2
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin2171
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Brassiceae → Brassica → Brassica napus1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Coturnix → Coturnix japonica1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Bambusicola → Bambusicola thoracicus3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium 34_1091
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes2
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin4781
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae1
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes3
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella1
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp. FS411
All Organisms → cellular organisms → Bacteria → Atribacterota1
All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → Candidatus Velamenicoccus → Candidatus Velamenicoccus archaeovorus1
All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetagenomes From Anaerobic Digester Of Solid Waste
TypeEngineered
TaxonomyEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate → Metagenomes From Anaerobic Digester Of Solid Waste

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationToronto, Ontario, canada
CoordinatesLat. (o)43.5479Long. (o)-79.6609Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000388Metagenome / Metatranscriptome1201Y
F000459Metagenome / Metatranscriptome1109Y
F001445Metagenome692Y
F001813Metagenome630Y
F002002Metagenome / Metatranscriptome605Y
F002471Metagenome / Metatranscriptome556Y
F002994Metagenome / Metatranscriptome514Y
F003406Metagenome / Metatranscriptome488Y
F003622Metagenome / Metatranscriptome476Y
F003963Metagenome459Y
F004001Metagenome457Y
F004454Metagenome / Metatranscriptome437Y
F004815Metagenome422Y
F005658Metagenome393Y
F005744Metagenome / Metatranscriptome391Y
F006329Metagenome / Metatranscriptome376Y
F006925Metagenome362Y
F007409Metagenome / Metatranscriptome351Y
F007510Metagenome / Metatranscriptome349Y
F007558Metagenome / Metatranscriptome349Y
F009131Metagenome / Metatranscriptome322Y
F009686Metagenome / Metatranscriptome314Y
F010678Metagenome / Metatranscriptome300Y
F010686Metagenome / Metatranscriptome300Y
F011632Metagenome288Y
F012765Metagenome / Metatranscriptome277Y
F013401Metagenome / Metatranscriptome271Y
F014346Metagenome / Metatranscriptome263Y
F014592Metagenome / Metatranscriptome261Y
F015419Metagenome / Metatranscriptome255Y
F015450Metagenome / Metatranscriptome254N
F015605Metagenome / Metatranscriptome253N
F018007Metagenome / Metatranscriptome237Y
F018395Metagenome / Metatranscriptome235Y
F018877Metagenome / Metatranscriptome232Y
F019989Metagenome / Metatranscriptome226Y
F020289Metagenome224Y
F020363Metagenome / Metatranscriptome224Y
F020376Metagenome224Y
F020492Metagenome223Y
F020828Metagenome / Metatranscriptome221Y
F020862Metagenome / Metatranscriptome221Y
F021262Metagenome / Metatranscriptome219N
F021489Metagenome / Metatranscriptome218N
F021528Metagenome / Metatranscriptome218N
F021795Metagenome / Metatranscriptome217Y
F022683Metagenome / Metatranscriptome213N
F023356Metagenome / Metatranscriptome210Y
F024321Metagenome / Metatranscriptome206N
F025938Metagenome / Metatranscriptome199Y
F026180Metagenome / Metatranscriptome198Y
F026449Metagenome / Metatranscriptome198Y
F027342Metagenome195Y
F027437Metagenome / Metatranscriptome194Y
F028541Metagenome / Metatranscriptome191Y
F028669Metagenome190Y
F028765Metagenome / Metatranscriptome190Y
F029075Metagenome / Metatranscriptome189Y
F029140Metagenome / Metatranscriptome189Y
F029455Metagenome / Metatranscriptome188Y
F029801Metagenome / Metatranscriptome187Y
F030405Metagenome / Metatranscriptome185Y
F030486Metagenome / Metatranscriptome185Y
F030981Metagenome183Y
F031785Metagenome / Metatranscriptome181N
F032187Metagenome / Metatranscriptome180Y
F032289Metagenome / Metatranscriptome180N
F032472Metagenome / Metatranscriptome180Y
F032486Metagenome / Metatranscriptome180Y
F033383Metagenome / Metatranscriptome177Y
F033754Metagenome176Y
F033819Metagenome / Metatranscriptome176Y
F033854Metagenome176Y
F034384Metagenome175Y
F034976Metagenome173Y
F035108Metagenome173Y
F035426Metagenome / Metatranscriptome172N
F035626Metagenome / Metatranscriptome171Y
F035785Metagenome / Metatranscriptome171Y
F036104Metagenome / Metatranscriptome170Y
F036355Metagenome / Metatranscriptome170Y
F036769Metagenome / Metatranscriptome169Y
F037171Metagenome / Metatranscriptome168N
F037787Metagenome167Y
F038003Metagenome / Metatranscriptome167Y
F038012Metagenome166Y
F038084Metagenome / Metatranscriptome166Y
F038489Metagenome165Y
F039656Metagenome / Metatranscriptome163Y
F039694Metagenome / Metatranscriptome163Y
F039980Metagenome / Metatranscriptome162Y
F039981Metagenome / Metatranscriptome162Y
F041288Metagenome / Metatranscriptome160Y
F041289Metagenome / Metatranscriptome160Y
F041512Metagenome / Metatranscriptome160N
F041847Metagenome / Metatranscriptome159Y
F042357Metagenome / Metatranscriptome158Y
F042955Metagenome / Metatranscriptome157Y
F043420Metagenome / Metatranscriptome156Y
F043478Metagenome / Metatranscriptome156N
F043815Metagenome / Metatranscriptome155Y
F045118Metagenome / Metatranscriptome153N
F045728Metagenome / Metatranscriptome152Y
F046965Metagenome / Metatranscriptome150Y
F047387Metagenome / Metatranscriptome150Y
F047561Metagenome149Y
F047964Metagenome / Metatranscriptome149N
F048337Metagenome / Metatranscriptome148N
F048829Metagenome / Metatranscriptome147Y
F051165Metagenome / Metatranscriptome144Y
F051243Metagenome144Y
F052017Metagenome / Metatranscriptome143N
F052316Metagenome142Y
F053724Metagenome140Y
F053764Metagenome / Metatranscriptome140Y
F053881Metagenome / Metatranscriptome140N
F054063Metagenome / Metatranscriptome140N
F054980Metagenome / Metatranscriptome139Y
F055476Metagenome / Metatranscriptome138N
F055526Metagenome138Y
F055595Metagenome / Metatranscriptome138Y
F055836Metagenome / Metatranscriptome138Y
F056463Metagenome / Metatranscriptome137Y
F056709Metagenome / Metatranscriptome137Y
F057477Metagenome / Metatranscriptome136Y
F057793Metagenome135Y
F058179Metagenome / Metatranscriptome135Y
F058971Metagenome / Metatranscriptome134N
F059631Metagenome133Y
F059998Metagenome / Metatranscriptome133Y
F060102Metagenome / Metatranscriptome133Y
F060564Metagenome132Y
F061390Metagenome / Metatranscriptome132Y
F061597Metagenome / Metatranscriptome131Y
F061655Metagenome / Metatranscriptome131Y
F062643Metagenome / Metatranscriptome130Y
F062644Metagenome / Metatranscriptome130Y
F063479Metagenome / Metatranscriptome129Y
F064744Metagenome / Metatranscriptome128Y
F064746Metagenome / Metatranscriptome128N
F065281Metagenome127Y
F065522Metagenome127N
F066219Metagenome / Metatranscriptome127Y
F066752Metagenome / Metatranscriptome126N
F067310Metagenome / Metatranscriptome125Y
F067453Metagenome125Y
F067893Metagenome / Metatranscriptome125Y
F068298Metagenome124Y
F068986Metagenome124Y
F068993Metagenome124Y
F069747Metagenome123Y
F069750Metagenome / Metatranscriptome123N
F069772Metagenome / Metatranscriptome123Y
F069913Metagenome / Metatranscriptome123Y
F070092Metagenome123N
F070267Metagenome / Metatranscriptome123N
F070633Metagenome / Metatranscriptome123N
F071725Metagenome122N
F071823Metagenome121Y
F072104Metagenome / Metatranscriptome121N
F072819Metagenome121N
F072820Metagenome / Metatranscriptome121Y
F072892Metagenome121N
F073159Metagenome / Metatranscriptome120Y
F073228Metagenome / Metatranscriptome120N
F073390Metagenome / Metatranscriptome120Y
F074913Metagenome / Metatranscriptome119Y
F075047Metagenome / Metatranscriptome119Y
F075851Metagenome / Metatranscriptome118Y
F076128Metagenome / Metatranscriptome118N
F076577Metagenome118N
F076748Metagenome117Y
F076912Metagenome117Y
F079404Metagenome115Y
F079485Metagenome115Y
F079778Metagenome / Metatranscriptome115Y
F081962Metagenome113Y
F082256Metagenome113Y
F083289Metagenome113Y
F084191Metagenome / Metatranscriptome112N
F085858Metagenome / Metatranscriptome111Y
F086390Metagenome110Y
F086646Metagenome / Metatranscriptome110Y
F088079Metagenome / Metatranscriptome109N
F088355Metagenome / Metatranscriptome109Y
F088360Metagenome109Y
F089079Metagenome109Y
F089495Metagenome / Metatranscriptome109N
F089982Metagenome / Metatranscriptome108Y
F090057Metagenome / Metatranscriptome108Y
F091320Metagenome107Y
F091813Metagenome107Y
F091989Metagenome / Metatranscriptome107Y
F092835Metagenome / Metatranscriptome107Y
F093003Metagenome106Y
F093490Metagenome / Metatranscriptome106N
F093582Metagenome106Y
F093911Metagenome / Metatranscriptome106N
F094706Metagenome105Y
F095123Metagenome / Metatranscriptome105N
F096294Metagenome105Y
F096316Metagenome104Y
F096317Metagenome104Y
F096529Metagenome104Y
F096761Metagenome / Metatranscriptome104Y
F096850Metagenome / Metatranscriptome104N
F097614Metagenome104Y
F098130Metagenome / Metatranscriptome104Y
F098758Metagenome / Metatranscriptome103N
F099086Metagenome / Metatranscriptome103N
F099238Metagenome / Metatranscriptome103Y
F099327Metagenome103Y
F099347Metagenome / Metatranscriptome103N
F099497Metagenome103N
F100338Metagenome / Metatranscriptome102Y
F100368Metagenome / Metatranscriptome102Y
F101218Metagenome / Metatranscriptome102Y
F101439Metagenome102Y
F102132Metagenome102Y
F102171Metagenome / Metatranscriptome102N
F102634Metagenome / Metatranscriptome101Y
F102692Metagenome / Metatranscriptome101Y
F103019Metagenome / Metatranscriptome101Y
F103105Metagenome / Metatranscriptome101Y
F103196Metagenome / Metatranscriptome101N
F103319Metagenome / Metatranscriptome101N
F103328Metagenome / Metatranscriptome101N
F103516Metagenome / Metatranscriptome101N
F104139Metagenome100Y
F104681Metagenome / Metatranscriptome100Y
F105113Metagenome / Metatranscriptome100N
F105149Metagenome / Metatranscriptome100Y
F105265Metagenome / Metatranscriptome100N
F105435Metagenome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0311022_10001555Not Available1358Open in IMG/M
Ga0311022_10005186All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays691Open in IMG/M
Ga0311022_10006920All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays583Open in IMG/M
Ga0311022_10036372All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum873Open in IMG/M
Ga0311022_10036711All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.941Open in IMG/M
Ga0311022_10050678All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78626Open in IMG/M
Ga0311022_10056169All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei582Open in IMG/M
Ga0311022_10062823All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum715Open in IMG/M
Ga0311022_10066529All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum510Open in IMG/M
Ga0311022_10068350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays545Open in IMG/M
Ga0311022_10069981Not Available534Open in IMG/M
Ga0311022_10070648Not Available527Open in IMG/M
Ga0311022_10080294All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum865Open in IMG/M
Ga0311022_10080600Not Available3694Open in IMG/M
Ga0311022_10087436Not Available916Open in IMG/M
Ga0311022_10089082All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei1214Open in IMG/M
Ga0311022_10089420All Organisms → cellular organisms → Eukaryota → Opisthokonta681Open in IMG/M
Ga0311022_10099124All Organisms → cellular organisms → Archaea → Euryarchaeota1064Open in IMG/M
Ga0311022_10100234All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1022Open in IMG/M
Ga0311022_10104934Not Available630Open in IMG/M
Ga0311022_10106112Not Available805Open in IMG/M
Ga0311022_10106537All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78512Open in IMG/M
Ga0311022_10107432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium3619Open in IMG/M
Ga0311022_10113247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea888Open in IMG/M
Ga0311022_10113397All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum610Open in IMG/M
Ga0311022_10139705All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes15581Open in IMG/M
Ga0311022_10158045All Organisms → cellular organisms → Bacteria794Open in IMG/M
Ga0311022_10165989All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Candidatus Methanofastidiosa → unclassified Candidatus Methanofastidiosa → Candidatus Methanofastidiosa archaeon602Open in IMG/M
Ga0311022_10177881All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1466Open in IMG/M
Ga0311022_10183969All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus511Open in IMG/M
Ga0311022_10195096All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei663Open in IMG/M
Ga0311022_10197775All Organisms → cellular organisms → Bacteria1136Open in IMG/M
Ga0311022_10206104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays613Open in IMG/M
Ga0311022_10207838All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays693Open in IMG/M
Ga0311022_10208833All Organisms → cellular organisms → Eukaryota644Open in IMG/M
Ga0311022_10209884Not Available798Open in IMG/M
Ga0311022_10216678All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays662Open in IMG/M
Ga0311022_10217044All Organisms → cellular organisms → Bacteria2234Open in IMG/M
Ga0311022_10220644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea914Open in IMG/M
Ga0311022_10225178Not Available710Open in IMG/M
Ga0311022_10226818All Organisms → cellular organisms → Eukaryota → Opisthokonta628Open in IMG/M
Ga0311022_10228809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1698Open in IMG/M
Ga0311022_10232280All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae815Open in IMG/M
Ga0311022_10251047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum742Open in IMG/M
Ga0311022_10254833All Organisms → cellular organisms → Eukaryota668Open in IMG/M
Ga0311022_10258446Not Available892Open in IMG/M
Ga0311022_10265318All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays739Open in IMG/M
Ga0311022_10266920All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays526Open in IMG/M
Ga0311022_10267115All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays739Open in IMG/M
Ga0311022_10268446All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum684Open in IMG/M
Ga0311022_10274391All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays554Open in IMG/M
Ga0311022_10276934All Organisms → cellular organisms → Eukaryota597Open in IMG/M
Ga0311022_10278237All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta707Open in IMG/M
Ga0311022_10285468Not Available696Open in IMG/M
Ga0311022_10290111All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes6902Open in IMG/M
Ga0311022_10291079All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae687Open in IMG/M
Ga0311022_10312477All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis790Open in IMG/M
Ga0311022_10320911Not Available510Open in IMG/M
Ga0311022_10322136Not Available886Open in IMG/M
Ga0311022_10332192All Organisms → cellular organisms → Eukaryota1699Open in IMG/M
Ga0311022_10340940Not Available895Open in IMG/M
Ga0311022_10351305All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum507Open in IMG/M
Ga0311022_10354055All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Tetraoninae → Lagopus → Lagopus muta1263Open in IMG/M
Ga0311022_10362821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays3433Open in IMG/M
Ga0311022_10368922All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus517Open in IMG/M
Ga0311022_10369057Not Available677Open in IMG/M
Ga0311022_10372723Not Available669Open in IMG/M
Ga0311022_10383360All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum553Open in IMG/M
Ga0311022_10398536All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1219Open in IMG/M
Ga0311022_10404096All Organisms → cellular organisms → Archaea → TACK group890Open in IMG/M
Ga0311022_10405063All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA1045293Open in IMG/M
Ga0311022_10407684All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays541Open in IMG/M
Ga0311022_10416911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays560Open in IMG/M
Ga0311022_10418544All Organisms → cellular organisms → Bacteria3058Open in IMG/M
Ga0311022_10437599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum777Open in IMG/M
Ga0311022_10453053Not Available1031Open in IMG/M
Ga0311022_10453274All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae580Open in IMG/M
Ga0311022_10454768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu602Open in IMG/M
Ga0311022_10460664All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum930Open in IMG/M
Ga0311022_10495071All Organisms → cellular organisms → Bacteria → Proteobacteria → Candidatus Lambdaproteobacteria1395Open in IMG/M
Ga0311022_10496900Not Available900Open in IMG/M
Ga0311022_10501600Not Available911Open in IMG/M
Ga0311022_10503702Not Available768Open in IMG/M
Ga0311022_10504406All Organisms → cellular organisms → Eukaryota → Opisthokonta1670Open in IMG/M
Ga0311022_10507187All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1192Open in IMG/M
Ga0311022_10508714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum685Open in IMG/M
Ga0311022_10515472All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum520Open in IMG/M
Ga0311022_10517359Not Available912Open in IMG/M
Ga0311022_10517504All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum717Open in IMG/M
Ga0311022_10518733All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2670Open in IMG/M
Ga0311022_10520869Not Available1350Open in IMG/M
Ga0311022_10522423Not Available517Open in IMG/M
Ga0311022_10535781Not Available650Open in IMG/M
Ga0311022_10538704Not Available516Open in IMG/M
Ga0311022_10539281All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays590Open in IMG/M
Ga0311022_10552340All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays550Open in IMG/M
Ga0311022_10565004All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea561Open in IMG/M
Ga0311022_10566492All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis805Open in IMG/M
Ga0311022_10580066Not Available563Open in IMG/M
Ga0311022_10582465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays847Open in IMG/M
Ga0311022_10583528All Organisms → cellular organisms → Bacteria → Atribacterota → unclassified Atribacterota → Candidatus Atribacteria bacterium ADurb.Bin2762643Open in IMG/M
Ga0311022_10592178All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei515Open in IMG/M
Ga0311022_10599936All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis644Open in IMG/M
Ga0311022_10613745All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae816Open in IMG/M
Ga0311022_10628354All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum523Open in IMG/M
Ga0311022_10629955Not Available1731Open in IMG/M
Ga0311022_10643492All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.1132Open in IMG/M
Ga0311022_10649358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays546Open in IMG/M
Ga0311022_10657805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1422Open in IMG/M
Ga0311022_10658140All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum610Open in IMG/M
Ga0311022_10664848All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis735Open in IMG/M
Ga0311022_10668089Not Available1011Open in IMG/M
Ga0311022_10668477All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum589Open in IMG/M
Ga0311022_10678902Not Available2005Open in IMG/M
Ga0311022_10680387All Organisms → cellular organisms → Eukaryota562Open in IMG/M
Ga0311022_10683838Not Available506Open in IMG/M
Ga0311022_10684898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp.970Open in IMG/M
Ga0311022_10686504All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78691Open in IMG/M
Ga0311022_10689127All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis671Open in IMG/M
Ga0311022_10692144All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei710Open in IMG/M
Ga0311022_10703743All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Phasianus → Phasianus colchicus652Open in IMG/M
Ga0311022_10703804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1250Open in IMG/M
Ga0311022_10705509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum553Open in IMG/M
Ga0311022_10718730All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae722Open in IMG/M
Ga0311022_10734352All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays552Open in IMG/M
Ga0311022_10750949All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum556Open in IMG/M
Ga0311022_10756234All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1182Open in IMG/M
Ga0311022_10759894All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum508Open in IMG/M
Ga0311022_10765665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum748Open in IMG/M
Ga0311022_10775208All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum578Open in IMG/M
Ga0311022_10776502All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays535Open in IMG/M
Ga0311022_10782463All Organisms → cellular organisms → Eukaryota → Opisthokonta543Open in IMG/M
Ga0311022_10792465All Organisms → cellular organisms → Archaea3521Open in IMG/M
Ga0311022_10796351All Organisms → cellular organisms → Bacteria696Open in IMG/M
Ga0311022_10799862All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu1011Open in IMG/M
Ga0311022_10801409All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea705Open in IMG/M
Ga0311022_10802336All Organisms → cellular organisms → Bacteria664Open in IMG/M
Ga0311022_10805426All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays859Open in IMG/M
Ga0311022_10810065All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum929Open in IMG/M
Ga0311022_10813382Not Available673Open in IMG/M
Ga0311022_10814483All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum542Open in IMG/M
Ga0311022_10829083Not Available618Open in IMG/M
Ga0311022_10830291All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata522Open in IMG/M
Ga0311022_10833681All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata511Open in IMG/M
Ga0311022_10838051All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays592Open in IMG/M
Ga0311022_10841081Not Available770Open in IMG/M
Ga0311022_10861029All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays553Open in IMG/M
Ga0311022_10871025Not Available649Open in IMG/M
Ga0311022_10873598Not Available1253Open in IMG/M
Ga0311022_10873955Not Available579Open in IMG/M
Ga0311022_10880032All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis637Open in IMG/M
Ga0311022_10892610All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3381Open in IMG/M
Ga0311022_10896193All Organisms → cellular organisms → Archaea → TACK group5108Open in IMG/M
Ga0311022_10897487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae759Open in IMG/M
Ga0311022_10897896Not Available970Open in IMG/M
Ga0311022_10908138All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis601Open in IMG/M
Ga0311022_10909895All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei657Open in IMG/M
Ga0311022_10921231All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea724Open in IMG/M
Ga0311022_10926080All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae615Open in IMG/M
Ga0311022_10935282Not Available520Open in IMG/M
Ga0311022_10936743Not Available582Open in IMG/M
Ga0311022_10951402All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum538Open in IMG/M
Ga0311022_10972277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Syntrophomonadaceae → Syntrophomonas → Syntrophomonas wolfei951Open in IMG/M
Ga0311022_10975455All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis543Open in IMG/M
Ga0311022_10980919All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum556Open in IMG/M
Ga0311022_10992971All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare580Open in IMG/M
Ga0311022_11000587All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae631Open in IMG/M
Ga0311022_11000660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum799Open in IMG/M
Ga0311022_11007089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays933Open in IMG/M
Ga0311022_11017848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum976Open in IMG/M
Ga0311022_11019333All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays616Open in IMG/M
Ga0311022_11022732All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis686Open in IMG/M
Ga0311022_11024190All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae514Open in IMG/M
Ga0311022_11027085All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1102Open in IMG/M
Ga0311022_11031763All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. PtaB.Bin0011262Open in IMG/M
Ga0311022_11044057All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum635Open in IMG/M
Ga0311022_11063651Not Available658Open in IMG/M
Ga0311022_11064112All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae9411Open in IMG/M
Ga0311022_11090443All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis577Open in IMG/M
Ga0311022_11091094Not Available578Open in IMG/M
Ga0311022_11093285All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1166Open in IMG/M
Ga0311022_11099651All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays891Open in IMG/M
Ga0311022_11100145All Organisms → cellular organisms → Eukaryota → Opisthokonta531Open in IMG/M
Ga0311022_11107504All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1125Open in IMG/M
Ga0311022_11111355All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Phasianus → Phasianus colchicus646Open in IMG/M
Ga0311022_11115622All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae698Open in IMG/M
Ga0311022_11116012Not Available524Open in IMG/M
Ga0311022_11117563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum595Open in IMG/M
Ga0311022_11122939All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli710Open in IMG/M
Ga0311022_11123948All Organisms → cellular organisms → Eukaryota1552Open in IMG/M
Ga0311022_11129342All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum929Open in IMG/M
Ga0311022_11129396All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis665Open in IMG/M
Ga0311022_11139197All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum879Open in IMG/M
Ga0311022_11146617Not Available745Open in IMG/M
Ga0311022_11148487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu593Open in IMG/M
Ga0311022_11157215All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora521Open in IMG/M
Ga0311022_11170121All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78588Open in IMG/M
Ga0311022_11180011All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum523Open in IMG/M
Ga0311022_11185521All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays709Open in IMG/M
Ga0311022_11197704All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum584Open in IMG/M
Ga0311022_11206010All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu690Open in IMG/M
Ga0311022_11215612All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum710Open in IMG/M
Ga0311022_11226300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum573Open in IMG/M
Ga0311022_11228443Not Available556Open in IMG/M
Ga0311022_11231728All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum564Open in IMG/M
Ga0311022_11238991All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1818Open in IMG/M
Ga0311022_11257144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays530Open in IMG/M
Ga0311022_11258902Not Available967Open in IMG/M
Ga0311022_11269059All Organisms → cellular organisms → Eukaryota → Opisthokonta666Open in IMG/M
Ga0311022_11273959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1153Open in IMG/M
Ga0311022_11287144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea564Open in IMG/M
Ga0311022_11296264All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis1494Open in IMG/M
Ga0311022_11299454All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112973Open in IMG/M
Ga0311022_11310284All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays538Open in IMG/M
Ga0311022_11316016Not Available706Open in IMG/M
Ga0311022_11320085Not Available618Open in IMG/M
Ga0311022_11320111All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum652Open in IMG/M
Ga0311022_11321106All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae663Open in IMG/M
Ga0311022_11325870All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78509Open in IMG/M
Ga0311022_11333624Not Available606Open in IMG/M
Ga0311022_11339513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays881Open in IMG/M
Ga0311022_11339775All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu1840Open in IMG/M
Ga0311022_11339870All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae726Open in IMG/M
Ga0311022_11360295Not Available886Open in IMG/M
Ga0311022_11384007All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum637Open in IMG/M
Ga0311022_11385153All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis625Open in IMG/M
Ga0311022_11388880Not Available1828Open in IMG/M
Ga0311022_11392233All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78519Open in IMG/M
Ga0311022_11394372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1584Open in IMG/M
Ga0311022_11394572Not Available1101Open in IMG/M
Ga0311022_11409542All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78553Open in IMG/M
Ga0311022_11411533All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei597Open in IMG/M
Ga0311022_11416112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Brassiceae → Brassica → Brassica cretica892Open in IMG/M
Ga0311022_11416566All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum676Open in IMG/M
Ga0311022_11418386All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1616Open in IMG/M
Ga0311022_11420205All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays945Open in IMG/M
Ga0311022_11432152All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae723Open in IMG/M
Ga0311022_11435560All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea604Open in IMG/M
Ga0311022_11436208All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu538Open in IMG/M
Ga0311022_11440711All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum676Open in IMG/M
Ga0311022_11443072Not Available690Open in IMG/M
Ga0311022_11447181All Organisms → cellular organisms → Eukaryota → Opisthokonta556Open in IMG/M
Ga0311022_11449661Not Available1120Open in IMG/M
Ga0311022_11453046All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei536Open in IMG/M
Ga0311022_11454300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae986Open in IMG/M
Ga0311022_11456493Not Available516Open in IMG/M
Ga0311022_11464100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1777Open in IMG/M
Ga0311022_11464755All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae825Open in IMG/M
Ga0311022_11475069All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei520Open in IMG/M
Ga0311022_11480046Not Available614Open in IMG/M
Ga0311022_11486799All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum710Open in IMG/M
Ga0311022_11488626All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78513Open in IMG/M
Ga0311022_11489305Not Available679Open in IMG/M
Ga0311022_11494141Not Available679Open in IMG/M
Ga0311022_11500615All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata687Open in IMG/M
Ga0311022_11503654All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae909Open in IMG/M
Ga0311022_11504557Not Available736Open in IMG/M
Ga0311022_11508055Not Available707Open in IMG/M
Ga0311022_11519907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1172Open in IMG/M
Ga0311022_11538244Not Available640Open in IMG/M
Ga0311022_11540592All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays559Open in IMG/M
Ga0311022_11544710Not Available2355Open in IMG/M
Ga0311022_11549912All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis759Open in IMG/M
Ga0311022_11552585All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu547Open in IMG/M
Ga0311022_11560937Not Available514Open in IMG/M
Ga0311022_11565292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin0381081Open in IMG/M
Ga0311022_11568424All Organisms → cellular organisms → Bacteria3362Open in IMG/M
Ga0311022_11569135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1605Open in IMG/M
Ga0311022_11573718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays646Open in IMG/M
Ga0311022_11605746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum564Open in IMG/M
Ga0311022_11611810Not Available1006Open in IMG/M
Ga0311022_11614467All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78862Open in IMG/M
Ga0311022_11615450Not Available636Open in IMG/M
Ga0311022_11618459Not Available1186Open in IMG/M
Ga0311022_11619152All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum526Open in IMG/M
Ga0311022_11621477All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78601Open in IMG/M
Ga0311022_11634282All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2668Open in IMG/M
Ga0311022_11634712Not Available1727Open in IMG/M
Ga0311022_11642785All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei739Open in IMG/M
Ga0311022_11667986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays715Open in IMG/M
Ga0311022_11670477All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum635Open in IMG/M
Ga0311022_11676838All Organisms → cellular organisms → Eukaryota → Opisthokonta1693Open in IMG/M
Ga0311022_11681660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum1637Open in IMG/M
Ga0311022_11684501All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1058Open in IMG/M
Ga0311022_11689088All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea589Open in IMG/M
Ga0311022_11690789All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78504Open in IMG/M
Ga0311022_11697914All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria776Open in IMG/M
Ga0311022_11703944All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum551Open in IMG/M
Ga0311022_11707954All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays754Open in IMG/M
Ga0311022_11708598All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum659Open in IMG/M
Ga0311022_11724425Not Available516Open in IMG/M
Ga0311022_11726267All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays597Open in IMG/M
Ga0311022_11736373All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae609Open in IMG/M
Ga0311022_11740769All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris530Open in IMG/M
Ga0311022_11741484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae720Open in IMG/M
Ga0311022_11745275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1568Open in IMG/M
Ga0311022_11752828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae574Open in IMG/M
Ga0311022_11757221All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus633Open in IMG/M
Ga0311022_11762804All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii680Open in IMG/M
Ga0311022_11763809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1013Open in IMG/M
Ga0311022_11764001All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin2161314Open in IMG/M
Ga0311022_11773716All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays503Open in IMG/M
Ga0311022_11776990All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays545Open in IMG/M
Ga0311022_11797554All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae711Open in IMG/M
Ga0311022_11807327Not Available599Open in IMG/M
Ga0311022_11807910All Organisms → cellular organisms → Bacteria637Open in IMG/M
Ga0311022_11809567Not Available551Open in IMG/M
Ga0311022_11809790All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5745Open in IMG/M
Ga0311022_11811039All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → unclassified Candidatus Omnitrophica → Omnitrophica bacterium OLB16762Open in IMG/M
Ga0311022_11814956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu695Open in IMG/M
Ga0311022_11818031Not Available573Open in IMG/M
Ga0311022_11818607Not Available1039Open in IMG/M
Ga0311022_11822148All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1102Open in IMG/M
Ga0311022_11833619All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum548Open in IMG/M
Ga0311022_11859440Not Available659Open in IMG/M
Ga0311022_11862994All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Lillamyvirus542Open in IMG/M
Ga0311022_11865705All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays815Open in IMG/M
Ga0311022_11867122All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae500Open in IMG/M
Ga0311022_11867865All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae587Open in IMG/M
Ga0311022_11870004All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 1612Open in IMG/M
Ga0311022_11870593All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum961Open in IMG/M
Ga0311022_11882599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea730Open in IMG/M
Ga0311022_11889413All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum739Open in IMG/M
Ga0311022_11896336All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays877Open in IMG/M
Ga0311022_11899752All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1391Open in IMG/M
Ga0311022_11907988All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae524Open in IMG/M
Ga0311022_11912306All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae660Open in IMG/M
Ga0311022_11916515Not Available557Open in IMG/M
Ga0311022_11918305All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae883Open in IMG/M
Ga0311022_11919827Not Available1579Open in IMG/M
Ga0311022_11924733Not Available559Open in IMG/M
Ga0311022_11927102Not Available577Open in IMG/M
Ga0311022_11927341All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1046Open in IMG/M
Ga0311022_11929431All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum686Open in IMG/M
Ga0311022_11936845All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum522Open in IMG/M
Ga0311022_11942494All Organisms → cellular organisms → Bacteria3435Open in IMG/M
Ga0311022_11949669All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae603Open in IMG/M
Ga0311022_11952005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum507Open in IMG/M
Ga0311022_11952072Not Available525Open in IMG/M
Ga0311022_11959654All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus678Open in IMG/M
Ga0311022_11962036Not Available828Open in IMG/M
Ga0311022_11968671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum705Open in IMG/M
Ga0311022_11970368All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum530Open in IMG/M
Ga0311022_11984187All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Herelleviridae → Salchichonvirus → Salchichonvirus LP65930Open in IMG/M
Ga0311022_11992255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum787Open in IMG/M
Ga0311022_11993010All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum774Open in IMG/M
Ga0311022_11994364Not Available607Open in IMG/M
Ga0311022_11995373All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae500Open in IMG/M
Ga0311022_12002816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1180Open in IMG/M
Ga0311022_12005864All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Bovinae → Bos2872Open in IMG/M
Ga0311022_12013519All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1018Open in IMG/M
Ga0311022_12016008All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum533Open in IMG/M
Ga0311022_12016718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1082Open in IMG/M
Ga0311022_12029946All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1112Open in IMG/M
Ga0311022_12060658Not Available598Open in IMG/M
Ga0311022_12070095All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1627Open in IMG/M
Ga0311022_12074839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays566Open in IMG/M
Ga0311022_12079030Not Available1645Open in IMG/M
Ga0311022_12082201All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae640Open in IMG/M
Ga0311022_12099414All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter933Open in IMG/M
Ga0311022_12108601All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp.541Open in IMG/M
Ga0311022_12117134All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78644Open in IMG/M
Ga0311022_12121909Not Available728Open in IMG/M
Ga0311022_12130923All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Candidatus Methanofastidiosa → unclassified Candidatus Methanofastidiosa → Candidatus Methanofastidiosa archaeon835Open in IMG/M
Ga0311022_12137457Not Available534Open in IMG/M
Ga0311022_12138869All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis549Open in IMG/M
Ga0311022_12139981All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays504Open in IMG/M
Ga0311022_12143897Not Available599Open in IMG/M
Ga0311022_12144701Not Available2687Open in IMG/M
Ga0311022_12146257All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1630Open in IMG/M
Ga0311022_12149017All Organisms → cellular organisms → Archaea561Open in IMG/M
Ga0311022_12149812All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium924Open in IMG/M
Ga0311022_12151186All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora879Open in IMG/M
Ga0311022_12156904Not Available613Open in IMG/M
Ga0311022_12160513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu502Open in IMG/M
Ga0311022_12160644All Organisms → cellular organisms → Bacteria → Proteobacteria630Open in IMG/M
Ga0311022_12174261All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae542Open in IMG/M
Ga0311022_12183690All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei703Open in IMG/M
Ga0311022_12188798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1053Open in IMG/M
Ga0311022_12190303All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays956Open in IMG/M
Ga0311022_12196812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum958Open in IMG/M
Ga0311022_12199175Not Available603Open in IMG/M
Ga0311022_12208284Not Available574Open in IMG/M
Ga0311022_12210768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays810Open in IMG/M
Ga0311022_12211071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae659Open in IMG/M
Ga0311022_12212629Not Available2403Open in IMG/M
Ga0311022_12213442Not Available590Open in IMG/M
Ga0311022_12228041All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1202Open in IMG/M
Ga0311022_12233894All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78813Open in IMG/M
Ga0311022_12236106All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium810Open in IMG/M
Ga0311022_12238491Not Available527Open in IMG/M
Ga0311022_12246643All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta836Open in IMG/M
Ga0311022_12250434All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae586Open in IMG/M
Ga0311022_12262331All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays775Open in IMG/M
Ga0311022_12265175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays973Open in IMG/M
Ga0311022_12271921All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum759Open in IMG/M
Ga0311022_12275959All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC3248Open in IMG/M
Ga0311022_12276469All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum508Open in IMG/M
Ga0311022_12276604All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei646Open in IMG/M
Ga0311022_12278492All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum593Open in IMG/M
Ga0311022_12278842Not Available587Open in IMG/M
Ga0311022_12283652All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium691Open in IMG/M
Ga0311022_12290074All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula6488Open in IMG/M
Ga0311022_12305162All Organisms → cellular organisms → Archaea1034Open in IMG/M
Ga0311022_12305578Not Available801Open in IMG/M
Ga0311022_12306977All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae636Open in IMG/M
Ga0311022_12309519All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae635Open in IMG/M
Ga0311022_12333194All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum635Open in IMG/M
Ga0311022_12344056All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum795Open in IMG/M
Ga0311022_12359560Not Available691Open in IMG/M
Ga0311022_12368774Not Available1092Open in IMG/M
Ga0311022_12376297All Organisms → cellular organisms → Eukaryota → Opisthokonta632Open in IMG/M
Ga0311022_12385263All Organisms → cellular organisms → Archaea555Open in IMG/M
Ga0311022_12387475All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78514Open in IMG/M
Ga0311022_12390640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays588Open in IMG/M
Ga0311022_12392225Not Available627Open in IMG/M
Ga0311022_12399087All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3181Open in IMG/M
Ga0311022_12404890All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix2063Open in IMG/M
Ga0311022_12418900All Organisms → cellular organisms → Eukaryota → Opisthokonta592Open in IMG/M
Ga0311022_12423456All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78693Open in IMG/M
Ga0311022_12426897All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Meleagridinae → Meleagris → Meleagris gallopavo1656Open in IMG/M
Ga0311022_12429936All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea1189Open in IMG/M
Ga0311022_12434665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1013Open in IMG/M
Ga0311022_12443891All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis797Open in IMG/M
Ga0311022_12444634Not Available559Open in IMG/M
Ga0311022_12477693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu501Open in IMG/M
Ga0311022_12488619All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria975Open in IMG/M
Ga0311022_12492884All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora749Open in IMG/M
Ga0311022_12494252All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1295Open in IMG/M
Ga0311022_12495721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1224Open in IMG/M
Ga0311022_12501761All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei512Open in IMG/M
Ga0311022_12507141Not Available610Open in IMG/M
Ga0311022_12511688All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae624Open in IMG/M
Ga0311022_12515662Not Available715Open in IMG/M
Ga0311022_12516672All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium693Open in IMG/M
Ga0311022_12529256Not Available518Open in IMG/M
Ga0311022_12534589All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum655Open in IMG/M
Ga0311022_12542522Not Available1515Open in IMG/M
Ga0311022_12550306All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum828Open in IMG/M
Ga0311022_12553207Not Available809Open in IMG/M
Ga0311022_12565397All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae501Open in IMG/M
Ga0311022_12571026All Organisms → cellular organisms → Eukaryota650Open in IMG/M
Ga0311022_12591337All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis585Open in IMG/M
Ga0311022_12617997All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum802Open in IMG/M
Ga0311022_12619320All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays561Open in IMG/M
Ga0311022_12623897Not Available530Open in IMG/M
Ga0311022_12634600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1437Open in IMG/M
Ga0311022_12640317All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae574Open in IMG/M
Ga0311022_12652181All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae651Open in IMG/M
Ga0311022_12653533All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038931Open in IMG/M
Ga0311022_12658478All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum548Open in IMG/M
Ga0311022_12662047All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum527Open in IMG/M
Ga0311022_12663134All Organisms → cellular organisms → Eukaryota519Open in IMG/M
Ga0311022_12665047Not Available1093Open in IMG/M
Ga0311022_12668807Not Available622Open in IMG/M
Ga0311022_12670442All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis521Open in IMG/M
Ga0311022_12672587Not Available845Open in IMG/M
Ga0311022_12674406All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5802Open in IMG/M
Ga0311022_12675582All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum778Open in IMG/M
Ga0311022_12675811Not Available517Open in IMG/M
Ga0311022_12678836All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum534Open in IMG/M
Ga0311022_12690801Not Available664Open in IMG/M
Ga0311022_12695417All Organisms → cellular organisms → Bacteria1488Open in IMG/M
Ga0311022_12695636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1097Open in IMG/M
Ga0311022_12698944All Organisms → cellular organisms → Archaea1905Open in IMG/M
Ga0311022_12704425All Organisms → cellular organisms → Eukaryota → Opisthokonta850Open in IMG/M
Ga0311022_12711529All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1849Open in IMG/M
Ga0311022_12718930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae501Open in IMG/M
Ga0311022_12720499All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae765Open in IMG/M
Ga0311022_12731956All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum566Open in IMG/M
Ga0311022_12734693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum546Open in IMG/M
Ga0311022_12735315Not Available574Open in IMG/M
Ga0311022_12748125All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Psychroserpens → unclassified Psychroserpens → Psychroserpens sp. MSW61205Open in IMG/M
Ga0311022_12761879Not Available720Open in IMG/M
Ga0311022_12768349Not Available764Open in IMG/M
Ga0311022_12772695Not Available740Open in IMG/M
Ga0311022_12778128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum1106Open in IMG/M
Ga0311022_12785879All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter calcoaceticus/baumannii complex → Acinetobacter baumannii744Open in IMG/M
Ga0311022_12789083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata511Open in IMG/M
Ga0311022_12790753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays715Open in IMG/M
Ga0311022_12799681Not Available2283Open in IMG/M
Ga0311022_12802714All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei894Open in IMG/M
Ga0311022_12805209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum634Open in IMG/M
Ga0311022_12812197All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays560Open in IMG/M
Ga0311022_12820401Not Available526Open in IMG/M
Ga0311022_12823787All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei596Open in IMG/M
Ga0311022_12824801Not Available898Open in IMG/M
Ga0311022_12826439All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78655Open in IMG/M
Ga0311022_12827801All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.2580Open in IMG/M
Ga0311022_12830581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum963Open in IMG/M
Ga0311022_12831580Not Available574Open in IMG/M
Ga0311022_12832207All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei713Open in IMG/M
Ga0311022_12836160All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus852Open in IMG/M
Ga0311022_12842407All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum645Open in IMG/M
Ga0311022_12846287Not Available668Open in IMG/M
Ga0311022_12851426All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla697Open in IMG/M
Ga0311022_12854149All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae542Open in IMG/M
Ga0311022_12859433All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum524Open in IMG/M
Ga0311022_12860274Not Available571Open in IMG/M
Ga0311022_12876710All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1128Open in IMG/M
Ga0311022_12890368All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum836Open in IMG/M
Ga0311022_12891453All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum808Open in IMG/M
Ga0311022_12918227All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei539Open in IMG/M
Ga0311022_12922957Not Available1371Open in IMG/M
Ga0311022_12925296All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Brassiceae → Brassica → Brassica cretica835Open in IMG/M
Ga0311022_12941428All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei553Open in IMG/M
Ga0311022_12941803All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1010Open in IMG/M
Ga0311022_12944808All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5550Open in IMG/M
Ga0311022_12959085All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Stipodae → Brachypodieae → Brachypodium → Brachypodium distachyon652Open in IMG/M
Ga0311022_12995119All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae927Open in IMG/M
Ga0311022_12997660All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1208Open in IMG/M
Ga0311022_13003192All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78570Open in IMG/M
Ga0311022_13007484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1252Open in IMG/M
Ga0311022_13009906Not Available530Open in IMG/M
Ga0311022_13013357All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae625Open in IMG/M
Ga0311022_13019624All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin0281570Open in IMG/M
Ga0311022_13029163All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1065Open in IMG/M
Ga0311022_13045919Not Available634Open in IMG/M
Ga0311022_13071522All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae533Open in IMG/M
Ga0311022_13084027All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays698Open in IMG/M
Ga0311022_13093148All Organisms → Viruses → Predicted Viral3908Open in IMG/M
Ga0311022_13095860All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis653Open in IMG/M
Ga0311022_13096558All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin0381236Open in IMG/M
Ga0311022_13097539All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78556Open in IMG/M
Ga0311022_13103442All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum682Open in IMG/M
Ga0311022_13126342All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Phasianus → Phasianus colchicus1086Open in IMG/M
Ga0311022_13127599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum888Open in IMG/M
Ga0311022_13135216All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78539Open in IMG/M
Ga0311022_13139287Not Available753Open in IMG/M
Ga0311022_13144063Not Available529Open in IMG/M
Ga0311022_13144791Not Available1201Open in IMG/M
Ga0311022_13147117All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum887Open in IMG/M
Ga0311022_13148967All Organisms → cellular organisms → Bacteria → Proteobacteria727Open in IMG/M
Ga0311022_13154908All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus612Open in IMG/M
Ga0311022_13157013All Organisms → cellular organisms → Eukaryota915Open in IMG/M
Ga0311022_13163534All Organisms → cellular organisms → Bacteria → Caldiserica/Cryosericota group → Caldiserica → Caldisericia → Caldisericales → unclassified Caldisericales → Caldisericales bacterium1039Open in IMG/M
Ga0311022_13166576All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea577Open in IMG/M
Ga0311022_13167513All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum504Open in IMG/M
Ga0311022_13172482All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Kosmotogales → Kosmotogaceae → Mesotoga1799Open in IMG/M
Ga0311022_13178949Not Available591Open in IMG/M
Ga0311022_13182755All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78535Open in IMG/M
Ga0311022_13185825Not Available2779Open in IMG/M
Ga0311022_13189661Not Available1686Open in IMG/M
Ga0311022_13193212All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78509Open in IMG/M
Ga0311022_13199130All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum802Open in IMG/M
Ga0311022_13200218All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae556Open in IMG/M
Ga0311022_13202098All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum516Open in IMG/M
Ga0311022_13204509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea517Open in IMG/M
Ga0311022_13205072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum579Open in IMG/M
Ga0311022_13217515All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis510Open in IMG/M
Ga0311022_13220104All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78603Open in IMG/M
Ga0311022_13221509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays519Open in IMG/M
Ga0311022_13231428Not Available1575Open in IMG/M
Ga0311022_13241013All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78575Open in IMG/M
Ga0311022_13253713All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays952Open in IMG/M
Ga0311022_13261229All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays613Open in IMG/M
Ga0311022_13273420Not Available808Open in IMG/M
Ga0311022_13279759Not Available591Open in IMG/M
Ga0311022_13280626Not Available509Open in IMG/M
Ga0311022_13284144All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis618Open in IMG/M
Ga0311022_13290374All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1195Open in IMG/M
Ga0311022_13290552All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii817Open in IMG/M
Ga0311022_13297582All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora749Open in IMG/M
Ga0311022_13297631All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038501Open in IMG/M
Ga0311022_13300445All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum556Open in IMG/M
Ga0311022_13300637All Organisms → cellular organisms → Eukaryota → Opisthokonta541Open in IMG/M
Ga0311022_13307076Not Available578Open in IMG/M
Ga0311022_13318057Not Available678Open in IMG/M
Ga0311022_13318402Not Available525Open in IMG/M
Ga0311022_13324118All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae748Open in IMG/M
Ga0311022_13324517Not Available572Open in IMG/M
Ga0311022_13334632All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays688Open in IMG/M
Ga0311022_13336142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu712Open in IMG/M
Ga0311022_13336203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum812Open in IMG/M
Ga0311022_13337365All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae582Open in IMG/M
Ga0311022_13351245Not Available1396Open in IMG/M
Ga0311022_13352733All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2937Open in IMG/M
Ga0311022_13370322Not Available954Open in IMG/M
Ga0311022_13371549Not Available740Open in IMG/M
Ga0311022_13374643All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78723Open in IMG/M
Ga0311022_13376450Not Available644Open in IMG/M
Ga0311022_13378840Not Available679Open in IMG/M
Ga0311022_13383534All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis747Open in IMG/M
Ga0311022_13387430All Organisms → cellular organisms → Archaea14066Open in IMG/M
Ga0311022_13389821Not Available642Open in IMG/M
Ga0311022_13396461All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea587Open in IMG/M
Ga0311022_13401876All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes699Open in IMG/M
Ga0311022_13410262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales → unclassified Ignavibacteriales → Ignavibacteriales bacterium920Open in IMG/M
Ga0311022_13444543Not Available644Open in IMG/M
Ga0311022_13447636All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Caprinae → Ovis → Ovis aries2474Open in IMG/M
Ga0311022_13452823Not Available869Open in IMG/M
Ga0311022_13470404Not Available741Open in IMG/M
Ga0311022_13470707All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1691Open in IMG/M
Ga0311022_13480206Not Available636Open in IMG/M
Ga0311022_13482272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays839Open in IMG/M
Ga0311022_13486480All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum650Open in IMG/M
Ga0311022_13490709All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78622Open in IMG/M
Ga0311022_13503649All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum577Open in IMG/M
Ga0311022_13508900All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales5489Open in IMG/M
Ga0311022_13516217Not Available986Open in IMG/M
Ga0311022_13520983All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum656Open in IMG/M
Ga0311022_13522010All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum611Open in IMG/M
Ga0311022_13532910All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays501Open in IMG/M
Ga0311022_13534680All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu861Open in IMG/M
Ga0311022_13535482Not Available994Open in IMG/M
Ga0311022_13541400All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78668Open in IMG/M
Ga0311022_13544110Not Available502Open in IMG/M
Ga0311022_13569289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum633Open in IMG/M
Ga0311022_13571273All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis563Open in IMG/M
Ga0311022_13574031All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria671Open in IMG/M
Ga0311022_13576306All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis642Open in IMG/M
Ga0311022_13579822All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei511Open in IMG/M
Ga0311022_13580342Not Available955Open in IMG/M
Ga0311022_13585448All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae892Open in IMG/M
Ga0311022_13591364All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata646Open in IMG/M
Ga0311022_13593040All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum701Open in IMG/M
Ga0311022_13600242Not Available986Open in IMG/M
Ga0311022_13603147All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum864Open in IMG/M
Ga0311022_13605919All Organisms → cellular organisms → Bacteria → Atribacterota → unclassified Atribacterota → Candidatus Atribacteria bacterium ADurb.Bin276645Open in IMG/M
Ga0311022_13629695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin217533Open in IMG/M
Ga0311022_13632071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum539Open in IMG/M
Ga0311022_13634641All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Brassicales → Brassicaceae → Brassiceae → Brassica → Brassica napus916Open in IMG/M
Ga0311022_13640737All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei566Open in IMG/M
Ga0311022_13643072All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5634Open in IMG/M
Ga0311022_13645250All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1389Open in IMG/M
Ga0311022_13646870All Organisms → cellular organisms → Bacteria8795Open in IMG/M
Ga0311022_13647148All Organisms → cellular organisms → Eukaryota → Opisthokonta575Open in IMG/M
Ga0311022_13647679All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae506Open in IMG/M
Ga0311022_13648991Not Available768Open in IMG/M
Ga0311022_13650196Not Available587Open in IMG/M
Ga0311022_13650779All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae523Open in IMG/M
Ga0311022_13650800All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria883Open in IMG/M
Ga0311022_13652186All Organisms → cellular organisms → Eukaryota → Opisthokonta892Open in IMG/M
Ga0311022_13653017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum606Open in IMG/M
Ga0311022_13661273All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum669Open in IMG/M
Ga0311022_13662168All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata517Open in IMG/M
Ga0311022_13664856Not Available601Open in IMG/M
Ga0311022_13669232All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum781Open in IMG/M
Ga0311022_13671748All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu536Open in IMG/M
Ga0311022_13677287Not Available763Open in IMG/M
Ga0311022_13678244All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays787Open in IMG/M
Ga0311022_13679230All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea512Open in IMG/M
Ga0311022_13684863All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum573Open in IMG/M
Ga0311022_13686792All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae537Open in IMG/M
Ga0311022_13688131All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum535Open in IMG/M
Ga0311022_13689128All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum605Open in IMG/M
Ga0311022_13690024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1313Open in IMG/M
Ga0311022_13692275All Organisms → cellular organisms → Eukaryota840Open in IMG/M
Ga0311022_13692842All Organisms → cellular organisms → Bacteria → Proteobacteria1001Open in IMG/M
Ga0311022_13698229All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Coturnix → Coturnix japonica1178Open in IMG/M
Ga0311022_13700909All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus620Open in IMG/M
Ga0311022_13703855All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1712Open in IMG/M
Ga0311022_13706348All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays848Open in IMG/M
Ga0311022_13706804All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae596Open in IMG/M
Ga0311022_13714864All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata653Open in IMG/M
Ga0311022_13715054All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu676Open in IMG/M
Ga0311022_13730442Not Available1282Open in IMG/M
Ga0311022_13736798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata541Open in IMG/M
Ga0311022_13750165Not Available705Open in IMG/M
Ga0311022_13771153All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum743Open in IMG/M
Ga0311022_13773588All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata606Open in IMG/M
Ga0311022_13776331Not Available582Open in IMG/M
Ga0311022_13780404All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes701Open in IMG/M
Ga0311022_13784253Not Available611Open in IMG/M
Ga0311022_13787556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium882Open in IMG/M
Ga0311022_13792652All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum543Open in IMG/M
Ga0311022_13795631All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae561Open in IMG/M
Ga0311022_13804104All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae718Open in IMG/M
Ga0311022_13824754All Organisms → cellular organisms → Eukaryota → Opisthokonta622Open in IMG/M
Ga0311022_13834718All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays837Open in IMG/M
Ga0311022_13846270All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae901Open in IMG/M
Ga0311022_13854954All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae717Open in IMG/M
Ga0311022_13856347All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum515Open in IMG/M
Ga0311022_13860763Not Available609Open in IMG/M
Ga0311022_13860807All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis543Open in IMG/M
Ga0311022_13863797All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Bambusicola → Bambusicola thoracicus767Open in IMG/M
Ga0311022_13880215Not Available533Open in IMG/M
Ga0311022_13892022All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu504Open in IMG/M
Ga0311022_13896373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium822Open in IMG/M
Ga0311022_13900746All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria588Open in IMG/M
Ga0311022_13901018All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 11246Open in IMG/M
Ga0311022_13912810All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae731Open in IMG/M
Ga0311022_13922254All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae561Open in IMG/M
Ga0311022_13922568All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae939Open in IMG/M
Ga0311022_13924849All Organisms → cellular organisms → Eukaryota → Opisthokonta538Open in IMG/M
Ga0311022_13928843All Organisms → cellular organisms → Eukaryota1174Open in IMG/M
Ga0311022_13930305All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78619Open in IMG/M
Ga0311022_13932155All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium 34_109837Open in IMG/M
Ga0311022_13932843All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis572Open in IMG/M
Ga0311022_13964470Not Available944Open in IMG/M
Ga0311022_13975719Not Available585Open in IMG/M
Ga0311022_13983327Not Available1486Open in IMG/M
Ga0311022_13999792Not Available696Open in IMG/M
Ga0311022_14001878All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum648Open in IMG/M
Ga0311022_14001907Not Available519Open in IMG/M
Ga0311022_14013661All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1131Open in IMG/M
Ga0311022_14016023Not Available1097Open in IMG/M
Ga0311022_14017175All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae790Open in IMG/M
Ga0311022_14027711All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes671Open in IMG/M
Ga0311022_14028938All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78621Open in IMG/M
Ga0311022_14042430All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae647Open in IMG/M
Ga0311022_14047035All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin478850Open in IMG/M
Ga0311022_14048991All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria790Open in IMG/M
Ga0311022_14059385All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus639Open in IMG/M
Ga0311022_14060071Not Available512Open in IMG/M
Ga0311022_14068682All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium568Open in IMG/M
Ga0311022_14072765All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78506Open in IMG/M
Ga0311022_14077443Not Available574Open in IMG/M
Ga0311022_14078627All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78664Open in IMG/M
Ga0311022_14085818All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum784Open in IMG/M
Ga0311022_14092967Not Available521Open in IMG/M
Ga0311022_14092979All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin0381798Open in IMG/M
Ga0311022_14103706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1215Open in IMG/M
Ga0311022_14103989All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038533Open in IMG/M
Ga0311022_14107965All Organisms → cellular organisms → Bacteria → Proteobacteria4944Open in IMG/M
Ga0311022_14108218All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78565Open in IMG/M
Ga0311022_14109699All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum569Open in IMG/M
Ga0311022_14111753Not Available638Open in IMG/M
Ga0311022_14118294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus → Streptococcus pneumoniae589Open in IMG/M
Ga0311022_14133922All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae657Open in IMG/M
Ga0311022_14136717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu598Open in IMG/M
Ga0311022_14143375All Organisms → cellular organisms → Bacteria14543Open in IMG/M
Ga0311022_14143585All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78519Open in IMG/M
Ga0311022_14156701All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis571Open in IMG/M
Ga0311022_14161802Not Available564Open in IMG/M
Ga0311022_14164859All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes5228Open in IMG/M
Ga0311022_14169589All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78628Open in IMG/M
Ga0311022_14174610All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis567Open in IMG/M
Ga0311022_14175518All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum510Open in IMG/M
Ga0311022_14192517All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78604Open in IMG/M
Ga0311022_14194438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium1210Open in IMG/M
Ga0311022_14196084All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78589Open in IMG/M
Ga0311022_14198605All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78556Open in IMG/M
Ga0311022_14203661Not Available585Open in IMG/M
Ga0311022_14225087All Organisms → cellular organisms → Bacteria527Open in IMG/M
Ga0311022_14227185All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae975Open in IMG/M
Ga0311022_14227804All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1541Open in IMG/M
Ga0311022_14228731Not Available563Open in IMG/M
Ga0311022_14228807Not Available633Open in IMG/M
Ga0311022_14229391All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae504Open in IMG/M
Ga0311022_14235693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum655Open in IMG/M
Ga0311022_14236154All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata678Open in IMG/M
Ga0311022_14243372All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1142Open in IMG/M
Ga0311022_14265908All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu987Open in IMG/M
Ga0311022_14269987All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays818Open in IMG/M
Ga0311022_14271229All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78637Open in IMG/M
Ga0311022_14274586All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla520Open in IMG/M
Ga0311022_14294689All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella724Open in IMG/M
Ga0311022_14299673All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum627Open in IMG/M
Ga0311022_14300692All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum717Open in IMG/M
Ga0311022_14305975Not Available820Open in IMG/M
Ga0311022_14308326All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae726Open in IMG/M
Ga0311022_14309815Not Available981Open in IMG/M
Ga0311022_14335646All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae516Open in IMG/M
Ga0311022_14356184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae727Open in IMG/M
Ga0311022_14362723All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum568Open in IMG/M
Ga0311022_14362903All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis551Open in IMG/M
Ga0311022_14375300All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae638Open in IMG/M
Ga0311022_14376211All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu567Open in IMG/M
Ga0311022_14386867All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata1733Open in IMG/M
Ga0311022_14412240All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum588Open in IMG/M
Ga0311022_14416169All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae676Open in IMG/M
Ga0311022_14416717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum555Open in IMG/M
Ga0311022_14432396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum704Open in IMG/M
Ga0311022_14438290All Organisms → cellular organisms → Eukaryota595Open in IMG/M
Ga0311022_14439220All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78539Open in IMG/M
Ga0311022_14462051Not Available587Open in IMG/M
Ga0311022_14462803All Organisms → cellular organisms → Bacteria → Proteobacteria1115Open in IMG/M
Ga0311022_14472113All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1230Open in IMG/M
Ga0311022_14477739All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum654Open in IMG/M
Ga0311022_14480746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum674Open in IMG/M
Ga0311022_14481383All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium1003Open in IMG/M
Ga0311022_14486142All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae971Open in IMG/M
Ga0311022_14491535All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum549Open in IMG/M
Ga0311022_14492293All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78504Open in IMG/M
Ga0311022_14496567All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → unclassified Salmonella → Salmonella sp. hn-f5590Open in IMG/M
Ga0311022_14498025Not Available522Open in IMG/M
Ga0311022_14506787Not Available582Open in IMG/M
Ga0311022_14507316Not Available704Open in IMG/M
Ga0311022_14510224All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5114Open in IMG/M
Ga0311022_14518152Not Available602Open in IMG/M
Ga0311022_14524561All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1105Open in IMG/M
Ga0311022_14526209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum831Open in IMG/M
Ga0311022_14527943Not Available1107Open in IMG/M
Ga0311022_14528990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1740Open in IMG/M
Ga0311022_14529855All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii682Open in IMG/M
Ga0311022_14532603All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78515Open in IMG/M
Ga0311022_14541053Not Available582Open in IMG/M
Ga0311022_14546869Not Available512Open in IMG/M
Ga0311022_14554591All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays600Open in IMG/M
Ga0311022_14554644Not Available794Open in IMG/M
Ga0311022_14562721Not Available545Open in IMG/M
Ga0311022_14563705All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum621Open in IMG/M
Ga0311022_14564937All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum807Open in IMG/M
Ga0311022_14565531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum616Open in IMG/M
Ga0311022_14580704Not Available849Open in IMG/M
Ga0311022_14586108All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis516Open in IMG/M
Ga0311022_14600161All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1741Open in IMG/M
Ga0311022_14602926All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays940Open in IMG/M
Ga0311022_14606075All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 1618Open in IMG/M
Ga0311022_14606591All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78687Open in IMG/M
Ga0311022_14622474All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis740Open in IMG/M
Ga0311022_14654377Not Available745Open in IMG/M
Ga0311022_14656384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae539Open in IMG/M
Ga0311022_14656974Not Available621Open in IMG/M
Ga0311022_14657462Not Available665Open in IMG/M
Ga0311022_14665380All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon769Open in IMG/M
Ga0311022_14668858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum553Open in IMG/M
Ga0311022_14668976Not Available527Open in IMG/M
Ga0311022_14670255All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum617Open in IMG/M
Ga0311022_14677133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum618Open in IMG/M
Ga0311022_14681666Not Available529Open in IMG/M
Ga0311022_14683595All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae761Open in IMG/M
Ga0311022_14697135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum713Open in IMG/M
Ga0311022_14707395All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Bambusicola → Bambusicola thoracicus868Open in IMG/M
Ga0311022_14721034All Organisms → cellular organisms → Bacteria1996Open in IMG/M
Ga0311022_14723198All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus501Open in IMG/M
Ga0311022_14728853All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales882Open in IMG/M
Ga0311022_14731413Not Available1218Open in IMG/M
Ga0311022_14740492Not Available848Open in IMG/M
Ga0311022_14746357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum518Open in IMG/M
Ga0311022_14762714Not Available1317Open in IMG/M
Ga0311022_14771662All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78653Open in IMG/M
Ga0311022_14789959All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 11001Open in IMG/M
Ga0311022_14792465All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum507Open in IMG/M
Ga0311022_14794263Not Available586Open in IMG/M
Ga0311022_14799756Not Available585Open in IMG/M
Ga0311022_14799816All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta628Open in IMG/M
Ga0311022_14809368All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei807Open in IMG/M
Ga0311022_14815651All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis651Open in IMG/M
Ga0311022_14816610All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78599Open in IMG/M
Ga0311022_14821264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum702Open in IMG/M
Ga0311022_14828826All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum787Open in IMG/M
Ga0311022_14850008All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum570Open in IMG/M
Ga0311022_14852915All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78590Open in IMG/M
Ga0311022_14854902All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1236Open in IMG/M
Ga0311022_14862858All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays738Open in IMG/M
Ga0311022_14879139All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum635Open in IMG/M
Ga0311022_14886627All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata939Open in IMG/M
Ga0311022_14898689All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes2332Open in IMG/M
Ga0311022_14919112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays646Open in IMG/M
Ga0311022_14923723All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays781Open in IMG/M
Ga0311022_14925252All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae632Open in IMG/M
Ga0311022_14930901All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum828Open in IMG/M
Ga0311022_14941878All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78522Open in IMG/M
Ga0311022_14946312All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium626Open in IMG/M
Ga0311022_14950354All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae761Open in IMG/M
Ga0311022_14954902All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata500Open in IMG/M
Ga0311022_14956742All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays884Open in IMG/M
Ga0311022_14973377All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum503Open in IMG/M
Ga0311022_14982813All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin028609Open in IMG/M
Ga0311022_14984124All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78890Open in IMG/M
Ga0311022_14988104All Organisms → cellular organisms → Bacteria622Open in IMG/M
Ga0311022_14990411Not Available639Open in IMG/M
Ga0311022_14999019Not Available524Open in IMG/M
Ga0311022_15001433All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays556Open in IMG/M
Ga0311022_15007820All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin028658Open in IMG/M
Ga0311022_15022440All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum539Open in IMG/M
Ga0311022_15027977All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78693Open in IMG/M
Ga0311022_15040032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae576Open in IMG/M
Ga0311022_15044630All Organisms → cellular organisms → Eukaryota → Opisthokonta530Open in IMG/M
Ga0311022_15046682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp. FS41695Open in IMG/M
Ga0311022_15057144All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum531Open in IMG/M
Ga0311022_15058643Not Available683Open in IMG/M
Ga0311022_15058923All Organisms → cellular organisms → Bacteria1022Open in IMG/M
Ga0311022_15059177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum530Open in IMG/M
Ga0311022_15060581All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora548Open in IMG/M
Ga0311022_15061438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu720Open in IMG/M
Ga0311022_15062205Not Available676Open in IMG/M
Ga0311022_15106300All Organisms → cellular organisms → Eukaryota → Opisthokonta1238Open in IMG/M
Ga0311022_15112125Not Available1074Open in IMG/M
Ga0311022_15115379All Organisms → cellular organisms → Archaea788Open in IMG/M
Ga0311022_15125243All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays557Open in IMG/M
Ga0311022_15127215All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Laurasiatheria → Artiodactyla → Ruminantia → Pecora → Bovidae → Caprinae → Ovis → Ovis aries507Open in IMG/M
Ga0311022_15134422Not Available501Open in IMG/M
Ga0311022_15154680All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum1371Open in IMG/M
Ga0311022_15160873Not Available723Open in IMG/M
Ga0311022_15162295Not Available540Open in IMG/M
Ga0311022_15166581All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum672Open in IMG/M
Ga0311022_15171938Not Available1775Open in IMG/M
Ga0311022_15176375All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum723Open in IMG/M
Ga0311022_15183548All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays534Open in IMG/M
Ga0311022_15185534All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata629Open in IMG/M
Ga0311022_15196025All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea636Open in IMG/M
Ga0311022_15206324All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis692Open in IMG/M
Ga0311022_15221462All Organisms → cellular organisms → Bacteria → Atribacterota811Open in IMG/M
Ga0311022_15224849All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum683Open in IMG/M
Ga0311022_15228222All Organisms → cellular organisms → Bacteria5205Open in IMG/M
Ga0311022_15236429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea748Open in IMG/M
Ga0311022_15236939All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1260Open in IMG/M
Ga0311022_15239557All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae830Open in IMG/M
Ga0311022_15242127All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78683Open in IMG/M
Ga0311022_15245008All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum862Open in IMG/M
Ga0311022_15259528All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038593Open in IMG/M
Ga0311022_15271842All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum655Open in IMG/M
Ga0311022_15273075All Organisms → cellular organisms → Eukaryota → Opisthokonta617Open in IMG/M
Ga0311022_15287658All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae502Open in IMG/M
Ga0311022_15291694All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales5788Open in IMG/M
Ga0311022_15301223All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78507Open in IMG/M
Ga0311022_15315213Not Available1125Open in IMG/M
Ga0311022_15316945All Organisms → cellular organisms → Eukaryota583Open in IMG/M
Ga0311022_15324171All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus672Open in IMG/M
Ga0311022_15324947All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis701Open in IMG/M
Ga0311022_15329932All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis500Open in IMG/M
Ga0311022_15331824All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays582Open in IMG/M
Ga0311022_15338260All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis511Open in IMG/M
Ga0311022_15338769All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78591Open in IMG/M
Ga0311022_15339923All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays537Open in IMG/M
Ga0311022_15346808Not Available642Open in IMG/M
Ga0311022_15356247Not Available1441Open in IMG/M
Ga0311022_15359129All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae615Open in IMG/M
Ga0311022_15364066All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea1700Open in IMG/M
Ga0311022_15377205All Organisms → Viruses → Predicted Viral1767Open in IMG/M
Ga0311022_15378453All Organisms → cellular organisms → Archaea → TACK group596Open in IMG/M
Ga0311022_15386367Not Available603Open in IMG/M
Ga0311022_15387672All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei717Open in IMG/M
Ga0311022_15401539All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78512Open in IMG/M
Ga0311022_15402435Not Available526Open in IMG/M
Ga0311022_15405875All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae514Open in IMG/M
Ga0311022_15408447All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78691Open in IMG/M
Ga0311022_15413256Not Available581Open in IMG/M
Ga0311022_15416098Not Available519Open in IMG/M
Ga0311022_15422090All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78516Open in IMG/M
Ga0311022_15444507All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays624Open in IMG/M
Ga0311022_15444905Not Available856Open in IMG/M
Ga0311022_15452518All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon968Open in IMG/M
Ga0311022_15461219All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104701Open in IMG/M
Ga0311022_15480760All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum602Open in IMG/M
Ga0311022_15483503All Organisms → cellular organisms → Bacteria → PVC group → Candidatus Omnitrophica → Candidatus Velamenicoccus → Candidatus Velamenicoccus archaeovorus1753Open in IMG/M
Ga0311022_15486521Not Available511Open in IMG/M
Ga0311022_15496929All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae711Open in IMG/M
Ga0311022_15497026All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78813Open in IMG/M
Ga0311022_15500201All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1083Open in IMG/M
Ga0311022_15501608All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae558Open in IMG/M
Ga0311022_15501876All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis754Open in IMG/M
Ga0311022_15503447All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei672Open in IMG/M
Ga0311022_15509042All Organisms → cellular organisms → Eukaryota → Opisthokonta544Open in IMG/M
Ga0311022_15509542Not Available732Open in IMG/M
Ga0311022_15514412All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu586Open in IMG/M
Ga0311022_15515976All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae744Open in IMG/M
Ga0311022_15518617All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78523Open in IMG/M
Ga0311022_15518661All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum609Open in IMG/M
Ga0311022_15528842All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78535Open in IMG/M
Ga0311022_15530657All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea1148Open in IMG/M
Ga0311022_15536573All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum790Open in IMG/M
Ga0311022_15541299All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays678Open in IMG/M
Ga0311022_15545075All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum742Open in IMG/M
Ga0311022_15559220All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata675Open in IMG/M
Ga0311022_15561660All Organisms → cellular organisms → Archaea → Euryarchaeota706Open in IMG/M
Ga0311022_15568024All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum619Open in IMG/M
Ga0311022_15574925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays817Open in IMG/M
Ga0311022_15579466All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum598Open in IMG/M
Ga0311022_15581074All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae632Open in IMG/M
Ga0311022_15589236All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae777Open in IMG/M
Ga0311022_15596703All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays670Open in IMG/M
Ga0311022_15597723All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis952Open in IMG/M
Ga0311022_15597789All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Thorarchaeota → Candidatus Thorarchaeota archaeon726Open in IMG/M
Ga0311022_15604638All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1580Open in IMG/M
Ga0311022_15618197All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae1141Open in IMG/M
Ga0311022_15619986All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays722Open in IMG/M
Ga0311022_15637806All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Perdicinae → Bambusicola → Bambusicola thoracicus2240Open in IMG/M
Ga0311022_15638145Not Available552Open in IMG/M
Ga0311022_15638649Not Available1338Open in IMG/M
Ga0311022_15658242Not Available555Open in IMG/M
Ga0311022_15660923All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum595Open in IMG/M
Ga0311022_15674746All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays703Open in IMG/M
Ga0311022_15686646All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae948Open in IMG/M
Ga0311022_15687857All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae563Open in IMG/M
Ga0311022_15713750Not Available532Open in IMG/M
Ga0311022_15716851All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays569Open in IMG/M
Ga0311022_15720505All Organisms → cellular organisms → Eukaryota625Open in IMG/M
Ga0311022_15721111All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays557Open in IMG/M
Ga0311022_15721527All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae547Open in IMG/M
Ga0311022_15721685All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae558Open in IMG/M
Ga0311022_15725613All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038704Open in IMG/M
Ga0311022_15728633All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu824Open in IMG/M
Ga0311022_15734139All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu708Open in IMG/M
Ga0311022_15734344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis534Open in IMG/M
Ga0311022_15790828All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes8020Open in IMG/M
Ga0311022_15809133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1114Open in IMG/M
Ga0311022_15809233Not Available1224Open in IMG/M
Ga0311022_15825072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum742Open in IMG/M
Ga0311022_15825800All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae640Open in IMG/M
Ga0311022_15831973All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum675Open in IMG/M
Ga0311022_15835800All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays701Open in IMG/M
Ga0311022_15850790All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum554Open in IMG/M
Ga0311022_15852152All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1189Open in IMG/M
Ga0311022_15860819All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Numididae → Numida → Numida meleagris716Open in IMG/M
Ga0311022_15863917All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays507Open in IMG/M
Ga0311022_15867138All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata501Open in IMG/M
Ga0311022_15867747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays558Open in IMG/M
Ga0311022_15872706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum660Open in IMG/M
Ga0311022_15874073All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum556Open in IMG/M
Ga0311022_15879136All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum1295Open in IMG/M
Ga0311022_15883657All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae502Open in IMG/M
Ga0311022_15900039All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei516Open in IMG/M
Ga0311022_15915063All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum762Open in IMG/M
Ga0311022_15920299All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum583Open in IMG/M
Ga0311022_15920757All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78726Open in IMG/M
Ga0311022_15921623Not Available673Open in IMG/M
Ga0311022_15922378All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae554Open in IMG/M
Ga0311022_15925727All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes877Open in IMG/M
Ga0311022_15939760All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae773Open in IMG/M
Ga0311022_15946819All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum710Open in IMG/M
Ga0311022_15947171All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus1179Open in IMG/M
Ga0311022_15947780Not Available797Open in IMG/M
Ga0311022_15949428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum603Open in IMG/M
Ga0311022_15957362All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum586Open in IMG/M
Ga0311022_15973047All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei554Open in IMG/M
Ga0311022_15978340All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays663Open in IMG/M
Ga0311022_15978751All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum671Open in IMG/M
Ga0311022_15984808All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae599Open in IMG/M
Ga0311022_15987123All Organisms → cellular organisms → Eukaryota → Opisthokonta578Open in IMG/M
Ga0311022_15987280Not Available609Open in IMG/M
Ga0311022_15996246All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei994Open in IMG/M
Ga0311022_16023488Not Available709Open in IMG/M
Ga0311022_16023806Not Available639Open in IMG/M
Ga0311022_16026516Not Available667Open in IMG/M
Ga0311022_16030541All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis728Open in IMG/M
Ga0311022_16048530All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae → Gallus → Gallus gallus859Open in IMG/M
Ga0311022_16067294All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis517Open in IMG/M
Ga0311022_16071946All Organisms → Viruses → Predicted Viral1740Open in IMG/M
Ga0311022_16075800All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae627Open in IMG/M
Ga0311022_16086428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae538Open in IMG/M
Ga0311022_16086809All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038623Open in IMG/M
Ga0311022_16087303All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei622Open in IMG/M
Ga0311022_16089243All Organisms → cellular organisms → Eukaryota → Opisthokonta702Open in IMG/M
Ga0311022_16099736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays941Open in IMG/M
Ga0311022_16117878All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays573Open in IMG/M
Ga0311022_16127268Not Available870Open in IMG/M
Ga0311022_16131090All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae1341Open in IMG/M
Ga0311022_16131580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum823Open in IMG/M
Ga0311022_16140103All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1118Open in IMG/M
Ga0311022_16141722All Organisms → cellular organisms → Archaea → TACK group3758Open in IMG/M
Ga0311022_16143651Not Available540Open in IMG/M
Ga0311022_16170555Not Available866Open in IMG/M
Ga0311022_16172524Not Available678Open in IMG/M
Ga0311022_16198294Not Available544Open in IMG/M
Ga0311022_16213188Not Available504Open in IMG/M
Ga0311022_16215215Not Available500Open in IMG/M
Ga0311022_16216581Not Available690Open in IMG/M
Ga0311022_16220207All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum588Open in IMG/M
Ga0311022_16224852Not Available504Open in IMG/M
Ga0311022_16236579All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1463Open in IMG/M
Ga0311022_16242106All Organisms → cellular organisms → Eukaryota → Opisthokonta521Open in IMG/M
Ga0311022_16246197All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei762Open in IMG/M
Ga0311022_16249048All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis603Open in IMG/M
Ga0311022_16258009All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum urartu536Open in IMG/M
Ga0311022_16264015All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum534Open in IMG/M
Ga0311022_16275414All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum827Open in IMG/M
Ga0311022_16275581All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei534Open in IMG/M
Ga0311022_16292179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae531Open in IMG/M
Ga0311022_16307728Not Available523Open in IMG/M
Ga0311022_16308857All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae548Open in IMG/M
Ga0311022_16310190All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays692Open in IMG/M
Ga0311022_16310604All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae534Open in IMG/M
Ga0311022_16310890All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum987Open in IMG/M
Ga0311022_16313360All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Morganellaceae → Proteus → Proteus mirabilis636Open in IMG/M
Ga0311022_16315727Not Available537Open in IMG/M
Ga0311022_16318737All Organisms → cellular organisms → Bacteria3041Open in IMG/M
Ga0311022_16328614All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae998Open in IMG/M
Ga0311022_16329505Not Available724Open in IMG/M
Ga0311022_16345461Not Available1185Open in IMG/M
Ga0311022_16365273All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes1046Open in IMG/M
Ga0311022_16370866All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea600Open in IMG/M
Ga0311022_16382202All Organisms → cellular organisms → Bacteria1941Open in IMG/M
Ga0311022_16383662All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia triticina → Puccinia triticina 1-1 BBBD Race 1520Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0311022_10001555Ga0311022_100015554F072892MDINSLKNISIQLFGIYSRFKSIVSDLEVNNTLDNREWARELLNHLSSELYYEANCLTDVVCPPHEEAGDEKLFKIDGIIDAKRNPMSEDEFCELFLKWAEENKLQFGGGIGAYREEEEDVLAGK
Ga0311022_10005186Ga0311022_100051861F033754VENHGNSLPPRSGRQPDVRTPSWTESPTDQEVAEAGALLAEVGLLKERGLTAEAVVADFIFKNIQPLKDRAYPTYLYWGLADSTRVTNRRIPVVDLVSRLEMILRGKVSNIGAPVAYSAWNLPPSKAFTSFVSNPPAGDRGLGLRVRPSPEEVSALVACSEKFPTTRGRFILRCL
Ga0311022_10006920Ga0311022_100069201F091813APAGALAVVPLPEVDTTLDAQIPVSTRPRRPCRANQPDPSADEQKKKRRRLRRVSSFDQDAGTSVPATEEMPATGLIDADPNGCTQSAADPNVGAPPVADPNGGAACVVNVDDEEEENEAPLTRKNSRQFIASGESSGVPSPALSALFGLQELSLANFDQTLEDMVPEDLLSEPVDDGAMEACVDVPDAGLRS
Ga0311022_10036372Ga0311022_100363722F035108MSVGALTGRPAEEMPISMGDQLSELVQLLERVRQAMSGVVQALWPSLSLPEGLGELAEKLQGARQRFRLWKISACRQGAREAWAMVKTRYKKADPNHMAEVGPVGPDGKEIPVSLVYGQVELA
Ga0311022_10036711Ga0311022_100367113F091989FGEIDEQRARLKLLQESTRALCWIDATGGAVPFDEAEFNQVQREIAHLQAKIDHNDDILDALDDKVAELGLAEFSLAKIKSQKEKRRGQIAQIRSEESDALRHKWEAVVSLGGNRATYDKLPEVQEARAKAAAQIEPLEGEILALNGQIRSLEAILSKFKR
Ga0311022_10050678Ga0311022_100506781F032472FTSIERARTWVKTSCPLSPVTIRLDAQFRTPYPRSAGFDTDIGAFIESSSVSSLFGPMASPIINSDVIQGETFLPGQIFVFDGFALRANSLGHLEHIESYAPGQQVRFGSLNYVTDIRGDLIFDGFETMAATPCPYGEHDLNLSPVHTQEIAPVTTLALDPEQIATSEDGKLNPAKEAADSAALKPHTDLTSCDICVTGTPDSSPAIS
Ga0311022_10056169Ga0311022_100561692F076748MSFIELSGDSTPLYVSKSSFLQSDSSWFDWKDEQAVLFPNWETGIT
Ga0311022_10056595Ga0311022_100565951F018395MSSGMKLDRADTAYAEKAHELSLKNRNWLRHGIGTTADKIDEMLLDGATIEQMAKGAKTTKATVSVHLTHLRKVHKLAFV
Ga0311022_10062823Ga0311022_100628231F035108MPASAGDLLQDLSQLHEQARQVMQGIARSLWPSSSLPMGMGGLVDMLQGARQRFRLWKISACRQGAREAWAMVKTRYTKLDPNHMAEVGPAGPDGQEIPVSLMYDQIALDAKYSQQDCRLDNLLDGIEEEYSHSQ
Ga0311022_10066529Ga0311022_100665291F035108MSAGMLTGHPAEEMPVSTGDQLPELLQLIKRVRQAMSGIIQALWPAFSLPEGLGELAEKLHGVRQRFHLWKISACRQGAREAWAMVKTRYKKANPTQMAEVAPMGPNGKEIPVSLVYGQVELAAKFSQRDCKLDTC
Ga0311022_10068350Ga0311022_100683501F033754AEAGVLLTEVGLLKERGLTAEAVVADFVFKNIQPLKDRAYPAYLYPGLADSTRVTNKRIPSVDLVSRLEMILRGKVSNVGAPVAYSAWNLPPPKAFTLFVSNPPVTDSNLGLRVRPSAEEISTLVALLGAIPDDERQVYFEVPLNPSDADINDMLDLLAEDSSDAAPDGTLAVVPLLEVD
Ga0311022_10069981Ga0311022_100699812F096317MHVYVNKEASLLAAAARTPEVSGLTWNLEQAEEELSLMKRQLEENKGK
Ga0311022_10070648Ga0311022_100706481F096317VSVNKQAVLLAVAARTTEVAGLERDLKQAEEELSLTKRQLEENKGE
Ga0311022_10080294Ga0311022_100802942F081962VLTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLADVLRRLAVLPQRFQELRRASARAGAIAALSRAKAFLPELDPAEIALGYPSLKEDGTPFDQKDFADCVKSVRPVATLIGNDTDLTKYQPGYDSENQRIPTPRYEAISLIPLTRKHTFAPEVDPAGLIDEEAQFEALSGIDWKSSTFQVIGTAGGAERDEPEASTQQAS
Ga0311022_10080600Ga0311022_100806003F005744MDDETFEIIKAGAPDAPPEQALYRIQQTYPDGSGGRLNIDWEGLLWLHELIHDRIALEGYVCETCDTKGCHRPATWEIECRGVGVSGRPIYSCDEHCPDPAILSPQDEMRRLVENRNEE
Ga0311022_10087436Ga0311022_100874362F004001VESPSLGVLKNSGDVALGEMDSGYGGDGLTVGLDDLSGLFQP
Ga0311022_10089082Ga0311022_100890821F076748MRFIQLPGDSPPLYVSKSSFSQSDSSWFDWNDEEAVLF
Ga0311022_10089082Ga0311022_100890822F076748MPTPMRFIQLPGDSPQDYVSKSSFSQSDSSWFDLNDEEDLLFPNWETGIT
Ga0311022_10089420Ga0311022_100894201F005658MAWVEKYLKDQLVSTSCNVQGRQPADQAAQSHIQPGLECLQ
Ga0311022_10099124Ga0311022_100991241F098758MDYKKVYYTFIIVSIGVFFLFSGCNNSKEQPPPIVSVDSCENIQCSDVCHGEDLWSQKCSDGDCIDFVRIEPCSEKCGCVVDLCANVKCEDKCRGEDLWGYKCLNGICSADSLKEACSVECGCAPKFFYKLVPEARYRLPQVGIIANVYSIRSDQTIRAVVTCRSSFCSDPPTVYYTKFEDPYDRSEDETVVYYGSAWKNFEEMEGNDLKVNESGTYMIGVSTQYYIEVGFLGDK
Ga0311022_10100234Ga0311022_101002341F081962LTVYACAHIGSRSINLKQNTLIKLKAVYTLVEQLYSGTQRALAIVALSTPHPRLWQDILKSLAFLPQRIQDLRRSSSRAGAVAALSRAKAWLPELDPADLALGYPSLKEDGNAFDDHDFHACVKAIRPVATLIGNDTNLNKYASAYDSNNRKIPNAPYDQISLIPPIRKHTFAPEVDPVGLIDAEAEFEALSGIDWASSTFQDKTADGEVEKDNPEPSSPPKE
Ga0311022_10104934Ga0311022_101049341F018877GGKFFTDIWDNGGREMAGEIIRKSEKGIHDAREVAEAAEKSAEPEGQLGIN
Ga0311022_10106112Ga0311022_101061122F074913MCSWRRVAVARVFALVGRCRVMMLFFYSRVGKHRDTIRGSPAGAGAGRGASNKTASLVTQLSRHGAAIAYTDLL
Ga0311022_10106537Ga0311022_101065371F035626MAPSITYNDAAVKEIFLPGQIFVFGGFALRANSIGHLEHIDSYAPGHQVRFGNLNYIADIRGDSIFDGFGPAPGARNSHDEHGLNLLSDKARDLNPEQVALPKDGG
Ga0311022_10107432Ga0311022_101074321F032289IGLVNGIGLFDQVYFATQNDSTTAYTVGDISDLHDVESGGEVSQMSYFDLAVTFGMAGINLLFKIIEAIVFIFPTLVNLFHIPLPLAAVMQSMIYLQVAWGYAQWKSNRSGRSTD
Ga0311022_10113247Ga0311022_101132471F028765TRNATTYASSSDDESSDDEVDYASLFKGLDRTKIDKINELIDALNDKNRLLEKQEDLLYEEHDKFVEAQKSLALEVKRNEMLSCELSTCHETISSLKSVNNDLNAKLEVANRSNSCVEHVVICNRCKDFNVDACSEHLVSIAKLNDEVASLNAQLKTSKSEFDKLKFARDAYTIGRHPSIKDGLGFKREVKNLTSHKTPIPTKEKGKAPMATSAKKNHAFLYHDRRYSRNAFKGHDVFGSHAYDSYAMTASSSHVMPGRNVLRRNVVHQMPRRNDAHSAPRKVVNESSTIYCALN
Ga0311022_10113397Ga0311022_101133972F020492NMGMQVALLTSAALTAEVGALKQSLERSENELGLAKKQLEDKEGK
Ga0311022_10139705Ga0311022_101397052F030486MAGNVRRYVALAQSRGGACFCTRGVMQDYAVITLFSRWQKP
Ga0311022_10158045Ga0311022_101580451F015605DYEVSPESSLRVQPASYEVATGEKVEYPLFRNEAGTFYGSKAYLNTENWNLTLKPLPAGNRGVGAFLQFSVPKNYYGSNYFSVGEAGTRAALKKVEGELVQNGVFTNLEEAELSRVDTFKNIEPEEPFSSYFSLFSLLKARRAQQRGYGTTFLVANSSQEFCVYDKLQEMREHGLETSELPETMRFEHRALTKRKVSSLYGFTRVGELFHGGYEVVREKQLESWKSSLFSFSAEEVVVLGSKQLEQEMRFFQEKFGANWFQYFL
Ga0311022_10158060Ga0311022_101580601F000459ENVKRGRGRPNLTWEESVKRDLKDWSITTQLAIDRGAWKLVIHVPEP
Ga0311022_10165989Ga0311022_101659892F070633RDTGLRDRAKNRLVLDVSHSQGDEGFVYSVRQHLTLGPKKCTGGFNLVVVPLSDGILTSIDRDNFNVAVDTEGRLILTRLDKKIQLVFDYDKGFMTGVLGGVLYDTFEIPKHEGTDYHG
Ga0311022_10177881Ga0311022_101778811F081962VVTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARSGAIAALSRAKAFLPELDPADIALGYPSLKEDGSTFDQKDFAACVKAVRPVATIIGNDTDLTKYQPGYNAENQRIPTPRYEALSLIPPARQHTYAPEIDPAGLIDEEAQFEALSGINWKSSTFEALGSAGAEDEPGTSTQQAS
Ga0311022_10183969Ga0311022_101839691F004815LEAFKARLDVALGSLGWWLTLHTAGGWNEMSIVVLFNTGHSRIL
Ga0311022_10188445Ga0311022_101884451F061655MIDTLKLMLNEYEISDDSEIRVQPASYELGTGSKVEYPLFQTPSHGAQYGSKAYLNTDNWNLTLKPLPAGNRATGAFLQLSVPKNYYGSNFYSVGEQGTQAVLNKVEGELKEKGVHTSLIEAEMSRVDTFKNIEPEEPFSSYYSLFSLLKAR
Ga0311022_10195096Ga0311022_101950961F076748MRFIQLPGDSPPLYVSKSSFSQSDSSWFDWNNEEAVLFQIWETGIT
Ga0311022_10197775Ga0311022_101977751F060102MSKKEPKKTQVPPQALQPEKENFITMFSRLDSKSKHRILAYLVCLFGIFIILFAYRAS
Ga0311022_10206104Ga0311022_102061041F015450LRKLLTSLQEKCLEFSNKCIQRLRKIFHSVGASSERFTPSAEDLPKTFEHIEGEIDELDEVIAGHGDFCAWVASRGTAAAFLKAGCDHGKIVNRPNFTLSPSILDDIPDLARSISNRFVKMIWTKGGREKAGDEARSHLEPVRNHTLCLLFLVSLILTYNNLIHVG
Ga0311022_10207838Ga0311022_102078382F020862TPLAEDLPGAFEHIEGEINDLDEVIAGHSDFCALVASRGTAVAFLKSGCEHDKIVNRPNFSLSPADLDNVPNLARSIANRFIKLVWTKGGRSKAGDEARSHLKLVTKSYLMLTFSFEF
Ga0311022_10208833Ga0311022_102088331F039981KYPKGALVFNGTDEDDFLYCLPDNKELSVCREMARSMGFPQLKVGLCAMTKDDLADSLVYNSLKVRKL
Ga0311022_10209884Ga0311022_102098841F099327MATEGFIQGTTGEEISLLVDGVKIMALQNLSWKASQSKSPIRGAGYRKPHAMGRAFKEYELDFEVKELNKAIIEEAINSRRSREVQIKTFKIGDQEFSDLLDLRNCTILIVYPPKNNATRIIRFLGFEFTDVEGSFSIDDESVG
Ga0311022_10216678Ga0311022_102166781F033754DNIKGWRLEWFIVQNHGKSLPPRSGRHPDVRTPSWIESPTALEVTEAKVLLAKVCLLKERGLTAEAVVADFVFKNIQPLKDRAYPAYLYNGVTDSTRVTNRRIPAKDLVSRLDMILRGKVSNVGAPVAYSAWNLPPPKSFFNFVSNPSAGDSGLVLRVRPSPKDIEALVASLCDLPNDERQVHFEMPASPDDVEIDVVLDMLAGESSDSAPAEIMAVTVI
Ga0311022_10217044Ga0311022_102170443F006329MTLELYVVDVIDDHKMKMNAMRLKMDAMRLKLKKIRKYAIDNEAWYHYAVGSIVTLVAIFIIFVVMRVSFL
Ga0311022_10220644Ga0311022_102206441F002471DFDKLKFARDAYTIGRHPSIKDGLGFKREAKNLTSHKAPIPAKEKGKAPMASSAKKNHAFMYHDRRHARNANRSYDAFDSHVYDSYAMFASSSSYMHGRNVARRNAINHMPRRNGVNVPRKINEPSTIYHACNASFAICRKNKKVIARKLGARCKGDKTCIWVPKNICANLVGPNMSWVPKTQA
Ga0311022_10225178Ga0311022_102251781F073228AVTIGDIVDINNNKYGKFLHRIVMVYPHNLEVDRTELARLIKINNNTLTFERKTGEKFTLDERDIEHMDLFRSPNYKGGE
Ga0311022_10226818Ga0311022_102268181F011632LEWAAQRGGGVTEPGGAQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLF
Ga0311022_10228809Ga0311022_102288091F020828EAGHPVPLSDQLKQLVELHKAAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACSWVEVIKHSACIEGARRALARAKVHWGKMDAQKLVTDPPPEGKEHRTPEMYYKSVLKGARTIVGECSKEEVFE
Ga0311022_10232280Ga0311022_102322802F067310EKLAAIKVANTRKLNFQSFLETFIDAATRIADGIDLDKLIEPASPPAEE
Ga0311022_10251047Ga0311022_102510473F096317SLTISLNVNKQAVLLAATARTAEIAGLMQDLERAQGELGLIRRQLKERKGK
Ga0311022_10254833Ga0311022_102548331F003406MRPIWQRFGLRRPKVEMDETAEECQRAFGAVCSFIGTRDLMQEHIAFRVWPLADNWEMPKETVKEPDEGGLVRLKYTFKYGDKFVVRDDDWLKSIETVSDELLGVYSKAEDTALSAAFGG
Ga0311022_10258446Ga0311022_102584462F006329MIFELHVADVVDDHKIKMDAMRLKIRKIRKYAIHTEAWYHYVVGSIVTLVAIMI
Ga0311022_10265318Ga0311022_102653181F033754SWTESPTDQEVAEAGALLAEVGLLKERGLTAEAVVADFVFKNIQPLKDRAYPAYLYRGLADSTRVTNRRIPSVDLVNRLEMILRGKVSNVGAPVAYSAWNLPPPKAFTLFVSNPPVADGGLGLRVRPSAEEVNTLVASLGEIPYDERQVHFEVPLDPSDAEISAMLDLLAEDSSDAAPAGTSVVAPLPEADTTLDIQKPASTRPRRPCRANQPDPSAVEQKKKRRRLRRVSSLDRDVGTSVPAAEE
Ga0311022_10266920Ga0311022_102669201F055526ANVDDEEEEDEVPLTRKNSRQFVASGESSGVPSPALSALIGLQELSLANFDQTLEDMVPEDLLSEPVDDGAMEACADVPDAGLKSSRASSTLERDLEGQDADLDCPGPMEVAEGLSTLEVVTAESLGPKNGADTCPAPEDVARNDLARAKSVSHCPAPEGVAGDDPARVGSADGY
Ga0311022_10267115Ga0311022_102671151F033754TESPTDQEVAEAGVLLTEVGLLKERGLTAEAVVTDFVFKNIQPLKDRAYPAYLYRGLADPTRVTNRRIPSVDLVSRLEMILRGKVSNVGAPVAYSAWNLPSPKDFTLFVSNPPVTDSNLGLRVRPSAEDVRSLVASLGEIPDDERQIYFEVPLNPSDADINDMLDLLAEDSSDTVPDGTLAVVPLPEVDATLDVSKPANTRPRRPSRTSQPEPSADEQKKKRRRLRGVSSVDEDARTLAPAAEEM
Ga0311022_10268446Ga0311022_102684461F020828SDQLKQLVELHKAVELAMKGLIVRMWPGEPLPGSYFGLVKRLVNACPRFEVIKWSVCIEGARRAFARAKVHWAKLDAEKLVKEGPPEGKEHRHPEKYYDRVLKGARLVAEECAKDVIF
Ga0311022_10274391Ga0311022_102743912F020862EKFEPSVEDLPRTFEHIEGEVDALDEVIVGHGDFCALLASRGTAVAFMKTGCTHGKIVNRPNFSLSPADLIDIPSLARSIGNRFITQIWTKGGRSLAGDEARSHLKPVINS
Ga0311022_10276934Ga0311022_102769341F003406IQEHIAFRVWPLVEKWEMPKETISKPDEGGLVRLKYTFRYGDKFVEPDDDWLKCIEATSDELLGPYSKAEDTALSAAFGGRKKKRLNRVFDAIGFVYPDYRYPTRGQKRKDTASVKEVASAAPSEPAPKRKKMKVLTHRPRYIEPATVPEFAGETSSATEAKEPTLLSNIEGPAKMPAMEKIGEPRVEETKTLEILSPS
Ga0311022_10278237Ga0311022_102782371F042357VLGPANQRKNQPNLMEMKPQRKSLGRNPLSDAPYRNPGMVLNEQGPGRHPLSDASSLDLEPVINEQGSGRRILSGALHRRPGVVENEQGSLHLPRRVRRVRKLGEPTRVRVGSWNVGSLTGKLREIVDVAV
Ga0311022_10285468Ga0311022_102854682F075851MARVRSTARVEREGDEAEGAETVPISEAMKRSGLMTSEDIPTTEAEQADIEEAGTDDDYNIAVPSKPSHLEFGKSTISKADFPKMVKSGYFSEDEKKMIRFGGEEITPKPQKDEIVIFKSFLKAGLRFPLV
Ga0311022_10290111Ga0311022_102901111F045728MSLASVPRESSGQNERPLMAAQAAPAPAGDSLLVSRF
Ga0311022_10291079Ga0311022_102910791F004815RLDVALGSLVGWLATLHIAGGWNWIITVVLFNPGHSMVL
Ga0311022_10312477Ga0311022_103124771F105149MLRKMFQGGSSRKQGPRLAMRDADDEPPRDAPVRPCEWPSENFMDQAGIKEEFNAYLRNADLVSFEEEKCSQYHNLTSTFVRRFEFSTSRNSPTVLFDLYENSYTMDLEDFTTACKLPQWGSIRDPRKSEFRDFLASITVGKSRDITQATIGSIHFPAIYTLFCSLQGRCINGKDEACHMCVRDLS
Ga0311022_10320911Ga0311022_103209111F011632VWAAQRGGGVTDPGSVQRTFAWCVEGHSLARHSLARTSGDGQMVGLDDPFGLF
Ga0311022_10322136Ga0311022_103221361F006329MELELHVADVVDDHKIKMEKMRLKIRKIRKYDIDSEAWYHYAVGSIVTLVAILIAFVVAFKFFS
Ga0311022_10332192Ga0311022_103321922F018877MAQEIIQKSEKGIHEARKVAEAAEKNAEPEGQIGTSE
Ga0311022_10340940Ga0311022_103409401F001813GGVQGTFRHCVEGHGLVRTIGDSWIVGVDDLVGHSQPW
Ga0311022_10351305Ga0311022_103513051F027342INVSYLLLTRIRSSPGAFTDLPRSVSDAAAIFRVEEGSSTEKVFWSQYAEDGHPVPLSGQLKQLVELHKAAEQAMKGLLVWLWPGEALPGSYFRLVRRLVEACPRLKVIKRSVCIEGARRAFARAKVHWGKLDAEKLVKDRPPPGKEHRKPENYYKDVLKGARLVADEC
Ga0311022_10354055Ga0311022_103540553F011632AAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDEPVALFQP
Ga0311022_10355686Ga0311022_103556861F032472HLKQIESYAPDHQDRFGSLNYTANIHGDLIFNGFEPRPGAPHCHDGHDLALSPDIAQSAAQVCAPTLSSEPTVPIGDGRLDAAPEAAISTAIEPNTSLVLCKARDSKVPDSVPDSEYSAPLPIEPDWAPIMEFTATDVFQHSPFGDILNSLKSLSLSGEPWPNYGQHGWDTDDKEI
Ga0311022_10362821Ga0311022_103628212F015450MQQDLEDKKHEAIIENLESKIKEQSAIIEKKDFELQSTEGLLAETEAKILELNSKLINQSKQFDQEKLELNSKLKAEVQTSSELKKALTSLQDKCLNFGNNCIGRLKKIFYSVGASSGKFNPSAENLPQAFDHIEAEIEELDEVIAGHGDFCAWVASQGTAAAFLKAGCEHGKVVNRPNFTLSPSILDDMPDLARSISNRFIKMIWTKGGREKAGDEARSHLEPVRDNTSYLPFSLHLIFTHDSLIYVG
Ga0311022_10364835Ga0311022_103648351F066219KGGFLLEANMKKVFLVLLILCIGCLIHANIVEFFESIPPVVRYTVGAAITVYALSWAYSWVFDPIVIVAENGYGAFNFGPFIVIEPCIWYSNDIEWRNTVLNHEYTHYVQHAVYGLILSISYPILALYSNIKSGNQWDENYWEIQASLATDEPPSWKPAFVWKW
Ga0311022_10368922Ga0311022_103689221F028669MYARCEIKKQRFKCWSDQFITNVNKGDGERGGRTLLRIGVMGKGRRAIE
Ga0311022_10369057Ga0311022_103690571F076912KKGDKNYIEDTETTPKSCLDVVFELLATTAGTSSSNSLPESVRLLESQLQVQRHRSYVMRQEAEGLRKSLQNSDAYFLVQKQALEDLSAKQEEVNKLAKHLASIMGTQDIVS
Ga0311022_10372723Ga0311022_103727232F099238MNAIECLAVLHEENMAMVKRLLRPAETEDDARRRSSSDIILTWPREPGEILTPLSTPTEYDYRVRHAQAAKDAP
Ga0311022_10383360Ga0311022_103833601F079404SQKGSIYQVGGAEVWRIAGTGYLFGTPKKASEDWPSEWFYIEDVPLPDPVRIGLPEFDSAPLKKRLSWRPRSPQRESDKDVHYLMSRIRLLAHSELTMIGVMAACIMQGVQPLQYRGHPMWDFNGEDDATRYGRKGPDSVAALLKILSTLYKGEEEEFLRVNPQGGFSMYNPPSWVSGHFYLP
Ga0311022_10398536Ga0311022_103985361F028669MYARREIKKQQFKCWSNQFITNANNGDEERGGRTLLQIRVMGKGRRAIEKIGRSKNCVKR
Ga0311022_10404096Ga0311022_104040963F068993VKAEVYDYFFKEWLKVKEEYTIKKGIRSFSAYVTYRLAELLTQDKKPKQKINPSPELHL
Ga0311022_10405063Ga0311022_104050639F047561VIIMVKSNIQPQNIVPDFGTLKRGKLDILVNWDITSNTKTDDMGNEYTEWQYESVRLNWVLPAVYESEAAIRAYLDANYNEGENILGWAQATRVNKSLYRN
Ga0311022_10407684Ga0311022_104076841F012765YKLQESLDDMICLRQLVSNKDTIIKDLCASKKSVVQELETARLAVKAAEETSATLRAQRDKAMDKAIRAGRILMRRPGVVVPYNIMADVNAAPDSSSRPFSSVASEKNIAK
Ga0311022_10416911Ga0311022_104169111F096761MFICSSHQALVDGMASQLRSQGASIPEVASSLERWNPVSLHRRVSELEATNAGWC
Ga0311022_10418544Ga0311022_104185443F069747ARQYGEVVLPDEASGQGPGTLATRLSRCEESMACVFAVRVQGLPSFTRVAVQS
Ga0311022_10437599Ga0311022_104375991F035108GSAGDLLSELSHLHERVRLVMQGVAKALWPSVSLPEGVAELAEKLKGARRCFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYSQQDCRLDRLLDGIEEEFSQSA
Ga0311022_10453053Ga0311022_104530532F053724MREVRVLVRLQVDECEPDAEFDRETMEDSAVEAVENAMRFAYDNGFSHTYADELSIGFVDAVLYEEDLDDEDGLDEE
Ga0311022_10453274Ga0311022_104532742F067310VQAWKKSSAHCGADVALSLVCVHCKEVKEEKLAALKVANTKKLQFQSFMETFIDAATRIADGIDLDEFIAPASPPPSE
Ga0311022_10454768Ga0311022_104547682F094706RGKLYIDDIGWGPEAGSIEYGYRVPFGSIHVFIGKIIEPGPEPDICADLVETAQRARSARVKPAMKRAFVGVIHGGSYEDRSEFRGATVVCSGDESSTGETESLYQLQDGRIGSCSVQSILITQINFSVNGYSGMWHCFAG
Ga0311022_10457520Ga0311022_104575201F004001VVGSPPLGVFKNSGDVTLRDVVWSSHRCGLMVGLDDL
Ga0311022_10460664Ga0311022_104606641F079404VSGAEVWRIADTGYLSGTPKKPSEDWPSEWFYMEDVPLPDPVRRGLPEFNNAPLKKRRSWRPRSPQVEDDREVLYLMNRIKALAQSGLTITEVMSICIMQGVQPLQYHGHPLWCFNGEDDATRYGRNGPGDAAALAKMLSKLFKGEEEEFTRIKPRDGFSMYNPPSWVSYIPLLLFSRIFCCKYSPCQFAAGTAKGHKGGQQPFSTTRGP
Ga0311022_10495071Ga0311022_104950713F020363VARVFALVVRCRCMRLLVYSRGGKHRDTRRESPAAAGAGRTADHLTVLFSQKVLAVRKGNDIYRPV
Ga0311022_10496900Ga0311022_104969001F035626MAPSIIGHDAVQGKVFLPGQIFVFGGSTLWANSLGHLEQIESYVPGHQVRFGNLDYTADIRGDLIFDGFKPMSGALHNHDEHDVTLSSDSVR
Ga0311022_10501600Ga0311022_105016003F004001LVESPSLEIFKKCGNVALKDMVSGHGGDELMVVLDDLRDIFQP
Ga0311022_10503702Ga0311022_105037021F002994NLLTLFANLNKQQKEKFNELISAIHEKDELLDNQEDFLIKENKKHVKTKNVYAQEVEKNEKLTSELSTCHDIVSNLRNENAKLIAKVEKFDVCDDSFVSLRNDNANLIAKIDKLNASLSSLKIENEKLIAKAKDLDVRNASISNLRDENDILHAKIVELNTCKPSTSFVEHVTICTRCRDINVDAIHDHLALIKQQNDHIAQLSAKINEHDLENEKFKFARSMLYSGRRYGIKDGIGFQQGDNVKLNALPKRLSNF
Ga0311022_10504406Ga0311022_105044061F038012MLFQFQPLCCVQGHQPADQAAQSHIQPGLECLQGRG
Ga0311022_10507187Ga0311022_105071871F030405AMQGYDVVLFIVALAKTVTPGGSPRREPGQAAPPTT
Ga0311022_10508714Ga0311022_105087141F027342EAQKALQEIEAMRKIAAGKAFNMQSKHVKVNYLLLTQVRSSPGAFTDLPRSVSDAARYYQAMEGSSTEKLFCSQYTGTEHPMPVSDQLKQLVELHKAAEQAMRGLIVRMWPGDSLPNSYFGLVRRLVDACPRLEVIKRSVCIEGARRAFARVKVQWAKMDAVKLVKEGPPQGKEHRHPEMYYEGVLKGARLVADECAKDVIFE
Ga0311022_10515472Ga0311022_105154721F020828LSDQLKQLVELHKAAEQAMKGLIVRMWPGEPLPDSYFGLVRRLVNACPRLEVIKRSVCIEGARRAFARAKVHWAKLDAEKLVKEGPPEGKEHRHPEMYYNSVLKGSRLVAEECAKDVIFE
Ga0311022_10517359Ga0311022_105173591F100368MSHGSLVGRKLREATSGVDRSQAGSACCGADPVEEIGQTCGLNVIVRRARDLE
Ga0311022_10517504Ga0311022_105175041F020828VPLSDQLKQLVELHKVAEQAMKGLLVRLWPGGALPGCYFRLVMRLVEACPMLEVIERSVGIEGARRALARAKVQWGKLDAEKLVKDGPPPGKEHRKPEMYYEGVLKGARLVADECSMDVIFQ
Ga0311022_10518733Ga0311022_105187333F056709MTSLQRHSPREAHKQLHLCMQRSGLSSIEVHITRPVGKMHFHFTGLEAEVRKAEKILADW
Ga0311022_10520869Ga0311022_105208692F014592MRGDPEGPIGWINYEAEAFEEVLNSRGDICAFSIARGIATVLEKKGCDHVKSLAQTETDLSSEDIKDPSAEASLVGGKFFTDIWENGGREMAQEIIRKSEKGIHDARKVAEAAEKSADLEGRIGINY
Ga0311022_10520869Ga0311022_105208693F032187LFTLCNIAAPSPPSEPAEPLADPNVKGDDEIRKMAEAIMDKVVDQLLNEAAEVVLRED
Ga0311022_10522423Ga0311022_105224231F010678ITFFDMLRGKLSEEEILEARHYAQRLKYPKGALVFNGTNEDDFLYCLLDNKEIPVCREIAKSMGFPKLEEGLSVMSKDDLADSLTYNSIKV
Ga0311022_10535781Ga0311022_105357812F096529VKRQEFIAGFEPQIVRISGKPKVIGYIKGNVFRSVVKYSKHVLYKREGRPPAIAKEAWVYRNLIRPRCRLWEVFDEERNIILRTSIANFDAHCEEWRHNDLVQLLLEEPHWQIERLGPPRPTQTRLF
Ga0311022_10538704Ga0311022_105387041F092835MKRFPRLTNPGVRLRVGYQRWQFWPIQTHFLDYYSLFWGSGVISTINEPWGAFTCRSSTLAILADSCPFHGLLLAVLGSR
Ga0311022_10539281Ga0311022_105392811F007409MSEAAKKAAAEMKLSLDEEKNLGFLIAMSKSNTEKITKEILEGLSEDTGDSESYDMDSSGEDSEDRPWRPNHSVYGKSTIKEHHLVNMRG
Ga0311022_10552340Ga0311022_105523402F095123SLVTCEGAMNALSREGCRHFEVFDQADEDFERDIYKVEDPVVKDSAGALYDRMWGLHGREVVRERAETARALLGLCFVTEGLLGRSDLRLKLFV
Ga0311022_10565004Ga0311022_105650041F002994KVKNAYALQVEKCEKLSSELSTCHETIDNLRNENAKLIAKVDSHICIDSISNPRDDNVDLLARIDELNVSIASLRIENEKLLAKAKDFDVCNVTISNLRSENDILHAKVIELKSCKPSTSIVEHVSICTRCRDVDINAIHDHMALIKQQNDHIAKLDAKIAEHNLENEKFKFARSMLYNGRRPGIKD
Ga0311022_10566492Ga0311022_105664921F086390IHFPAIHYFALFIGRCINGKDEACHMCVPDLCVLKSAVLGNKDYNLGAIVARRLHNNGLSGDLFGGIYATCVANYLGIPPREGDRELLPAYLDYNAMVSHHFLERNEQFLQYRLIFDRRRAVHITLPAPALFDYQAKGRYVITREEAHEYERRTEAARRHAAAQEAMAAASQYDPSYNFRYQPGYPWP
Ga0311022_10580066Ga0311022_105800661F068298LEWAAWRGGEVTDPGGVQGTFGRCVEGDGLARTIGDG
Ga0311022_10582465Ga0311022_105824651F039981YPKGALVFNGSGEEDFLYCLPDSKEISVCREMGRSFGFPTLEDGLSVLSKDELADNLAYNSIKV
Ga0311022_10582465Ga0311022_105824652F089982LVNKIKEDETNSKAQAGAQKNEIEDLRNQLTEAKVKCTVTEADRDASEYWKNYFEKTVAELRASKERCFEKFVECVKKMKASFANVGAYSTEDNFMRGDPEGVIEWISGEAEAFEEILIDRGDV
Ga0311022_10583528Ga0311022_105835283F099347MNLQEFIEHFEAFVTFIEEAWEQKDLEILKAIISDCKDFIHTKGHQFKCYSADSKTWQKLFDRNRQTRAELSKGMCEWCGKKKGVHCHHLIKRGRLVLYNDIRLLRMLCADCHRLFHS
Ga0311022_10585505Ga0311022_105855052F052316PRGSDGQEIPVSLVYDQVKIAAKFSQQDCKVDSLLDDIEEEFFESK
Ga0311022_10592178Ga0311022_105921781F076748PMRLIQLPGDSPPLYVSKSSFLQSDSSWFDWNDEEAVLFPNWETGIT
Ga0311022_10599936Ga0311022_105999361F105149MFRKMYQGGSSRKKGPRVVINELDDKPPMEADVRPCERPSEPFMVAAGIKDEFDAYVCNADLEEFMQDKCPQYQYLTDSFVRRFKFTSSRNSQSVLFDIYDKSYTMDLEDFTTACKLLQWGNVNEPSKSEYKDFLANITVGESREI
Ga0311022_10613745Ga0311022_106137452F034384MNVLRLESRVVGVVDYLARLKVAMSWIDTALWPGATLQNDLESLMTRLNEIPGRVQEWKKSSARCGADVALSLVRDHCKEAREENLAAIKVANTKRHDFRSFMETFIAAATRIADGIDLDEFVEPASPPPVE
Ga0311022_10628354Ga0311022_106283541F027342FADLPRSVSDAAAFYQAEEGSLAEKIFWSQYAEAGHPVPLSDQLKQLVELHKVTEQAMRGLIVRLWPGEAMPRSYFGLVRWLVDACPWIEVIKCSVCIEGARRALACAKVHWGKMDAEKLVTDPPPLVKEYRKPEMYYEGVLKGSRIIAGECSKDVIF
Ga0311022_10629955Ga0311022_106299551F076912LGKSALLSNGKGSNADKVQDSDTSLLVSNKADKTAKEDYLEDSETTPKSCLGLVFELLATTACTSYSNSLSESVWFLESQLQAERHRSAVLQQEAKGLQKSLEHLDAYFLVQQQALEDFSAKQDKANKLAKLIASMVDTQDNVS
Ga0311022_10643492Ga0311022_106434922F064746MNKIIWMALILLVGVFAIGGMSGTSGNDDAKNVTIDGYTFEGDFDNKWISGYGDTETYKPANLEDIQFGIPDGAYDWSGAENYNAFRYRSGEPSGSITKYGWAHIFVLKPDENLSYSSSIEMLRHAAYMFINPKDHRNAVIGGDLTEKEIEYNGRQAYYIEVQGELITSEDYPAFRNDNSQGAIAFFLDDGKVCVIDAFTTNNFGMSAWDIIDSITVTP
Ga0311022_10649358Ga0311022_106493581F020862MQNLRSKSIKVQIXKKSLTSLQNRCLEFSNRCVQRLKQVFYFVGASSEKFTPSVEDLPGAFEHIEGEIDDLDKVIAGHGDFCALVASRGTTVAFLQSGCEHGKIINRPNFCLSPADLDNIPNLARSIANRFIKLVWTKGGRSKAGDEARSHL
Ga0311022_10657805Ga0311022_106578052F081962LVEQLYTGSQRALAVVALSNEVPTHLADVLRRLAVLPQRLQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQKDFAACVKSVRPVATLIGNDTDLTKYQPGHDAENQRIPTPRYEAVSLIPPTRKHTFAPEVDPAGLIDDEAQFEALSGIDWKSSTFQDMETAGGAERDEPEASAQQRL
Ga0311022_10658140Ga0311022_106581402F052316MVKTRYAKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYSQRDCKLGSLLDGIEEEYNQSI
Ga0311022_10664848Ga0311022_106648481F037171MYVCARIENDPVEEPEELTGEAPEQQLVGGGKCPLTYLCPIHSLIHLPHFTFIPKD
Ga0311022_10668089Ga0311022_106680891F011632VWAAQRGGGVTEPGGVQRAFGCCVEGHGLAGTIGDGXMVGLDDPVGLVQP
Ga0311022_10668477Ga0311022_106684771F079404AEIWRIAGTGYLSGTPKKASEDRPSEWFYMEDTPLPEPVQIGLPEFSNAPLKKRLSWHPRSPQWDNDRDVQYLMGRIRLLAHSGLTMIGVMATCIMRGVQPLQYRGHPMWDFNGEDDATRHGRKGPGSVADLVKILSSLYKGEKEDFLCASPSNGFSMNNPRSWVSGRLSIRSMFAKLNVSLCDFDAGTAPGRRG
Ga0311022_10678902Ga0311022_106789023F006329VVEPEILTDPIVERLNLVEEENNYLKEKIRKIEEEKMILELHVADVVDDHKIKMEKMRLKIRKIRKYAIDSEAWYHYAVGSIVTLVAILIVFVVAFKCFS
Ga0311022_10680387Ga0311022_106803871F003406LKAREDIKDIIMRPIWQRFGLRKPKVEVDEAVEECQRAFGVVCSFIGTRDLVQEHIAFRVWPLVEKWEMPKETITKPDEGGMIRMKFTFRYEGKFVEPDDDWLKCIEATSDELLGTYSKAEDTALSAAFGGQKKKRLNRVFDAIRFVYPDYHYPIRGQKRKGTASVKEVASAAPSEPTPKRKKMKVL
Ga0311022_10683838Ga0311022_106838381F092835NPGVRLRVGHQHSQFWRILAHFLDYYSPFWGPEAISIVIEPEGALMCRSSTLAFLADSCPFHVLLLAVLGSRSDFHE
Ga0311022_10684898Ga0311022_106848982F029455MPDRIIDLDLWEDGNADQLPAITVTGQGLHFEGSTVEFDRLLLILGGWLR
Ga0311022_10686504Ga0311022_106865041F035626MAPSIIYNDAVQVGVFLPGQIFVFGGFALWANSLGHLEQIESYAPGHQVRFRSLNYTANIRGDLIFDRLEPRPSAPHYLKGHDLALPPDSVLEAAHASVPTPNAEPIAPIEDE
Ga0311022_10689127Ga0311022_106891271F105149MYQGGSSVKKGPRIAIHEQDDDLPRKAEVRACEWPSDDFMVKAGFKEEFDAYVRNADLEDFLQDKCPRYYQLTDSFVLRFKYKCTRNSPSVLFDIYDTSYTMDLEDFTTACKLPEWGNLNDPHKSEFRDFLASITVGESRDIAQATIRIIHFPVVGGKTGRS
Ga0311022_10692144Ga0311022_106921441F076748MTFIQLPGDTPPLYVSKSSFSQRDSSWFDWNDEEALLFPNWETGIT
Ga0311022_10703743Ga0311022_107037432F038489MARVEKDHSDRLVSTPCYVQGCQPPHRAAQSHISHSVP
Ga0311022_10703804Ga0311022_107038041F081962SVLTKLKAVYTLVEQFYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRVQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQRDFAACVKIVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEAISLVPPTRKHTFAPEIDPAGLIDEEAQFEALSGIDWKSSTFQVLGTAGGEERDEPETSTQQAS
Ga0311022_10705509Ga0311022_107055091F052316GAREAWVMVKTRYMKADPNHKAEVGPVGPDGKEISVSLVYGQVELAAKYSQQDCKLDSLLDGIEEEYNESD
Ga0311022_10714532Ga0311022_107145322F104139CPHLCCQPFNEIWEGVDPSSTPSCCSGTLLAPELPWVVSAFPPGAQSLVQALT
Ga0311022_10718730Ga0311022_107187302F011632VLEWAAQRGGGVTKPGGVQRAFGCCVVGHGLAGTIGERRMVGLDDPVGLFQP
Ga0311022_10734352Ga0311022_107343521F102692FVIKDLRVFKRSVVQELEAARLAVKAAEDTSTTLKAQHDKAMDKAIRAVQILMRRPGVIVPDDIIADVNAAPDSSSRPSSSVAPEKNITK
Ga0311022_10750949Ga0311022_107509491F020828MRGLIVRMWPGEPLSGSYFGLVRRLVEACPRLEVIKRSVCIEGARRAFARVKVHWAKLDAVKLVKEGPSEGKEHRCPENYYESVLKGSRLVADECAKDVIFE
Ga0311022_10756234Ga0311022_107562341F027342LAAALESVKSAKAEAQKALQETDAMKKIAAGKVFYMQSKHVKVNYRLLTRIQSSLGAFAYLPRRVSDAAQFYQAEDGSSTKKLFWSQYAEAKHSVPMSDQLKQMVELHKAADQAMKGFIVRLWPVDALPNSFFGLVRRLVDACPRLEVVKRSVCIEGARRAFARVKMQWVKLDAVKLIKEGPPEGKEHRHPEMYYEGVLPGARLIADECSQNVIFE
Ga0311022_10759894Ga0311022_107598941F027342TSAVEAAKNAKAEAQKALQEWEELKKIAAGKAFSMQSKNIKIKYLFLTRIRSSPGAFVDLPRSASDAAAFYRAGESSSAEGVFWSQYSEAGHPVPLSDQLKQLVELHKAAEQAMNGLIVRLWPGEALPGSYFGLVRRLVETCPRLEVLKRSTCIEGARRALARVRVHWD
Ga0311022_10765665Ga0311022_107656651F035108MSVGMLTGRPAEEMPGSTGDLLPELLQLHERVRQVMSGVAQALWPSVSLPEGLGGLADKLQGVRQRFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPMGPDGKEIPVSLMYGQVELAAKYSQRGYKLDNLLDGIEE
Ga0311022_10775208Ga0311022_107752081F035108MSVGLLTGRPAEEMPGSTGDLLPELLQLHERVRQAMQSVVQAMWPSLSMPEGLGELAKKLEGVRQRFRLWKISACHQGAREASAMVKTRYTKADPNRMAEVGPMGTDGKEIPVSLVYGQVELAARYS
Ga0311022_10776502Ga0311022_107765021F075851MARVRSTARVDREGDETEAVETVPISEAMKRSGLVTPEDVPAAEVEQADIEEADSEDDYNIAVPSKPSHLDFEKSTISEADFPKMVKLGYFSEDKKELIRFSGEETTPKPEKDEIVVFKSFLKAGL
Ga0311022_10782463Ga0311022_107824631F038084VAWYSHLFQNFPQFTVIHMVKGFGIVIKAEIDVFLVLSCFFDDPADVGNLISGSSAFSKTSLNILKFTVHVLLKPGLENFEY
Ga0311022_10792465Ga0311022_107924652F034976MVYWMKMKDAKPVRCQKCGKPLGYVTVLAEGLRFQQPIQNVKVVAICMECFQKK
Ga0311022_10796351Ga0311022_107963512F014346MLEKTLESPFDCKENQPDDSEGDQPWDFFGGNDAEAETPVLWPPHVKS
Ga0311022_10799862Ga0311022_107998622F020492MRMQASLLASAALTAEVDVLKQSLEKSEQELGHAKKQLEEKEGKKYPV
Ga0311022_10801409Ga0311022_108014091F002994ELLDSQEDFLIKENKKHVKVKNAYALEVEKCEKLSSELSTCHDVISNLRNENAKLIAKVEKSNVCDDSIDNLRNDNASSIAKIEKLNASLASLRNENEKLIAKAKELNVCNVSISNLRDENAILHAKIVELNTCKPSTSTVEHVTICTRCRDINVDAIHDHLALIKQQNDHIAQLSAKFNENDLENEKFKFAISMLYSGRRPGIKDVIGFQQGNNVKLNAPPKKLSNFVKGKAP
Ga0311022_10802336Ga0311022_108023362F102132MNTQTVVKNLESAINRICKDIKDKKGGSGADKLDSLAKLVNAYSRLIERDKEKEYDPMEDGDPTYYKKLEANNKDRRGI
Ga0311022_10805426Ga0311022_108054262F075851MARVRSTARVEHEGDEAEGVEPVPISEAMQRSGLVTSEAVPAAEAEQAAAEAEQGDIEEADSDSDYNITVPSKPSHLDFGKSTISKADFP
Ga0311022_10810065Ga0311022_108100651F081962MLIKLKAVYTLVEQLYSGSQRALAVVALSNTPPCLLHDVLKHLAVLPQRIKDLRQASARAGAVAALSRAKAWVPELDLADLTLGYPSLKEDGSVFDDQDFTACVKVVRPLATLIGNDTDLTKYSPGYDSENRRIPNVPYDQVSLIPPTRKHTFAPKVDSAGLIDDEAEFEALSGIDWASSTFQDKATNGEAEKDNPESSSPPKE
Ga0311022_10813382Ga0311022_108133821F092835MIKKPGVRLRVGHEHSLFSPILARFVDYYSLFWGPGVISTINEPLCGFMFWSSTLAVLADSDPFRGLLLTIFGPQTNFHSC
Ga0311022_10814483Ga0311022_108144831F027342QEIQAAKKIAAGKTFFMQSKHVEEAFLLLTRIRSSPGAFADLPRSISDAAEFYRAQEGSSTEKLFWSQYAGAEHATPLSDQLKQLVELHKAAEVAMKDLIVRIWPGELLATSFFGLIKRMGDSCPRLEVIKRSVCIEGARRALARAKVHWGKLDAEKLAKDGPPEGKPHSVPEKYYDGVM
Ga0311022_10829083Ga0311022_108290831F001813MFCVQGMFRSCVEGNGLVRTIGERXMIGLDDLVGL
Ga0311022_10830291Ga0311022_108302911F094706HKYNVCSIPIRKSRRSKIYIDHEGWGPDAGSIEYGYRVPFGGIHVFISKIGEPGPEPDLCTDLIETAQRARPARALPALKHAFVGCIHGGLSDGSGSGDETAVGSDGESSTDESNSLYQLQDGRLMGCFDGDSILDPFEPPSRVGIFMAGAQPVQNPAAGAGNPVPSPAQVLM
Ga0311022_10833681Ga0311022_108336812F083289YVYLQLKMPGHKGTITVHGSRKIALECEEGDAAYAESVCAAEELKFYKDNVDPTDMTSLKKPTTEHEPVMKFKSADDTKLVDFVPGDSSKQFSISANLDPK
Ga0311022_10838051Ga0311022_108380511F091813DLLAEDSSDAAPVGTLAVVPLPEVDTTLDVPRPVSTRPRRPSRTSQPEPSADEQKKKRRRLRRVSSFDEDAGTLAPAAEEVTATGLTDTEPNGCAQTATDPNGGAACVVTVEDEEEEDEVPLSRKNSRQLIAGGESSGVPSPALSALIGLQELSLANFDQTLEQMVPEDLLSEPEGDDATEACVVVPDAGLRTSRA
Ga0311022_10841081Ga0311022_108410811F014592AFSSEENFTRGNPEGPIEWISHEAEAFEEILNSRGDICAFSGARGIATVLERKGCNHVKSLAQTETALSSKDIKDPSAESSLVGGKFFTDIWDNGGREMAQEIIQRSEKGIHDARKIAEAAEKGAEPEGQIGIN
Ga0311022_10841081Ga0311022_108410812F032187LFAVCNSNIAVSSPPSEPAEASPGPHPKGDDEIRKMAEAIMDKVVDQLLNEVAEVVLRED
Ga0311022_10861029Ga0311022_108610291F007409MSEDKKVVAETKLSLSEEKNLGFLESIAKTNTEKITREILEGLSEDTGDSDSYDVESGGEDSEDRSWRPSHAVFGKSTIKQSHLDNM
Ga0311022_10861371Ga0311022_108613711F104139PYLHGEPLNEVWEGVDPGSISSSHSGVLLAPELPWVGPAFLPGAQSLLQALT
Ga0311022_10871025Ga0311022_108710251F000388MKVIKVTKEYFQTEDEKVYFFEPLEKEISAEDMQKIVDANEKLVNGLKDGTNTISK
Ga0311022_10873598Ga0311022_108735981F076912LEKSTPLCNGRESNADKVQDSETTLLVSKKGDKNYRVDGETTPKSCLDVVFELLASTAGTSSSNSLPESLWLLQSQLQAERHQSAVMRQEVKGLRKSLQNSDAYFLVQQQALEHLSAKQEKVNKLAKHLASIMGTQDIVS
Ga0311022_10873955Ga0311022_108739551F092835PGVCFRVGHQQSQFWTIVARFVDYYSSFWGPRVISTIDEPQGAFTCRSSTLTVFVDSDLFPGLLLTVLGSPSDFYGC
Ga0311022_10876419Ga0311022_108764191F104139PGSSPSSHAGTLHAPGLSWVGPAFPPGAQSLVQALT
Ga0311022_10880032Ga0311022_108800321F086390HLNGISGDLFGGIYATRVANYLNVPIHGNDIELPPAYLDYSAMVRHQFLERNEQFLLYRLIFDRQRTINVALPAPTFFNFQAKRRYVITREEANEYERRTEAARLQAAARQAVAAASQYDPSYNFGYPSGQPWP
Ga0311022_10892610Ga0311022_108926106F074913MWRWRRVAVARVFALVVRCRVMRLLLYSRDGKNRDTRRESPAGAGAGRGANHKTASLFTQLSRHGAPMTYTDLL
Ga0311022_10896193Ga0311022_108961931F004454LSRSRRVVVEIREDLHRAIRKQAILNDIKIYQLTNAIVEDFLKDEERVKALIKKL
Ga0311022_10897487Ga0311022_108974871F094706LKGSFEGIKGYAVGRMTKSRRSKLYIDYATWGPDAGSIEYGYRVPFGGIHVFIGKIGEPGPEPELCTDLIETARRARPARARPALRHAFVGCIHGGLSGRSGSGDETAAGSDGESATDESNSLYQLQDGRLMGCSDGDSIPDLFEPPSQVGV
Ga0311022_10897896Ga0311022_108978961F018877TDVWDNGGREMAREIIQKSEKGIHDARKVAEAAEKSAEPEGQIGIN
Ga0311022_10908138Ga0311022_109081381F105149MFRKMYQGGSSRKQGPRLAIREPDNELPREAQVRPCEWPSEEFMVQAGIKDEFDAYVHNADLESFVSDKCRQYLYLTDSFVRRFKFTSSRNSHTVLFDLYDKSYTMDLEDFTAACKLAQWGNV
Ga0311022_10909895Ga0311022_109098951F076748MPTPRSFIQLPGDSPPLYVSKSSFLQSDSSWFDWNDEEAVLFPNWETG
Ga0311022_10921231Ga0311022_109212311F028765KNILLEKQEDLLYEEHDKFVEAQKSLALEIKRNEMLACEVSTCHDSISNLKSINDDLNAKLVEANKSNSCVEHVEICTRCKDVDINACSEHLVSISKLSDEVASLNAQLKTSKSDFEKLKFARDAYTVGRHPSIKDGLGFKREAKNLTSHKAPIPAKEKGKAPMATSAKRNHAFLYHDKRQTRNRSYDAFDSYVYDSHAMFAPSSSYVYDRNVTRRNVVPKRNAIHHVPRRNVIHAPRKI
Ga0311022_10926080Ga0311022_109260801F059631MVSKMANVTWLEGAFVETIKGWQSGWFYITAPRDPEWAAAPEFQSGIPTRFTSWKETGLSWGNSAEVTRLQTCIKDLISRKVKLVTVVQVMLFRHILPCQRRAFNLWESDPAQHQTLSRLFDTKHEDAWKVLFKSSEVSPPVTEDRGFCAKRRASAVS
Ga0311022_10935282Ga0311022_109352821F020492MGMQAALLTSAALTAEVNSLKQSLERSEIELGRAKKQLEDKEGK
Ga0311022_10936743Ga0311022_109367431F004001VESLSLEMVKKYVDVALSDMVSGHSDDGLIVGLYDLSGLFQP
Ga0311022_10938975Ga0311022_109389751F094706VTNPQQLAPTLALSHDGFEFLKGSFDGLKGYVVGRMTKSRRGKLYIDNAGWGPEADSVEYGYRVPFGGIHVFIGKIGEPAPEPDICTDIIETARRASSSPVQPEARHVFVGVVHGSGYEDGPVSDGETVVCSDDESSGETDSLYPLQDGRIEGGSEGHGIPDSPGLPNWAAIFMAGTQSAPHSSTAAAMLSGSTTATPAGVGSSAPPPAQVLSD
Ga0311022_10951243Ga0311022_109512431F104139QPLNEVWEGVDPGSTPSSHSGVLYAAELPWFGPAFPPGAQSLFQAVT
Ga0311022_10951402Ga0311022_109514021F027342SLELDSKTRASELAVAIENAKSAKAKSQKTLQELDEVKKIAAGKAFFMQSKNIKVNYLLLTRIRSSPGPFADLPRRVSDAAAYYRAEEGSSTEKVFWSQYAEAEHPVPLSDQLKQLGELHKAAEQAMKGLIVRLWPGEALPGSYFGLVRRLVEACPRREANKRSICIAGARRALAHAK
Ga0311022_10972277Ga0311022_109722771F103105MIPTPYDTWPVGMSLNKAAQLLGVDRKTLAKNKALLDRCSEVVGDKPKVIRDRLLRELKI
Ga0311022_10975455Ga0311022_109754551F086390GESREITQATIGSIHFPAIHYFELFVGRCINGKDEACHMCIPDLSVLKSVVLGDRQYNLGAIVARRLHHNNISGDLFCGIYATHVANYLEIPIHENDMELPPAYLYFNAMVCHQFIERNEQPLQYRLILDRRCTVHVALPAPAFFDFQTKGRYVITREEAKEYERRTEAARFQAAARQEV
Ga0311022_10980919Ga0311022_109809191F079404LSGTPKKASEDWPSEWFYVGDAPLPYPVRIGLPEFSAAPLKKRLSSRPRSPRLEEDKSVHYLMGRIRLMAHSVLTMIGVMATCIKRGVQPLQYRGHPMGDFNGEDDATGHGRKGPDSTEDLVKILSSLYKGEKEDFLRTNPLNGFSMINPRGWVSEHLEGPNPCFRSLSFLHYVFGAGSTPDCG
Ga0311022_10992971Ga0311022_109929711F006329EYLKEKIKRIEEEMMTLELYVVDVVDDHKMKMNAMRMKMDAMRLKLKKIRKYAIDNEAWYDYAVGSIVTLLEIFITFVVMRVSFL
Ga0311022_11000587Ga0311022_110005871F067310MTRLNKIPDRVQEWKKSSARCGADVALSLARVHCKEAREDKLAAIKVANTKKHDFQSFMETFIAAATRIADGIDLDSFVEPAGPPSAECIL
Ga0311022_11000660Ga0311022_110006602F035108VYVGLLTGHPAEEMPGSTGDQLPELLQLHERVRQALSGVAQALWPSVSLPEGLGGLAEKLQGARQRFRLWKISACRQGAREAWAMVKTWYKKADPNHMAEVGPVGPDGKEIPMSLMYGQVELAAKYSQQDCKLDSLLDGIEEEYNQSI
Ga0311022_11007089Ga0311022_110070892F043815VISYRSKWPAGWKSEWFYVKVDKDEDKLVQSPLELTFGETRPRCNMIRGSPSQIAMAEFRVISDHIGTRDLVQEFLAFKVFPTMRDWEMPKLEGEKKKGELIRLPYYYKFKKHFKKPCQEWLDTIEIMCNDILRNYSKKEDQSMTAAFDSRPKRRLNRVLDALNF
Ga0311022_11017848Ga0311022_110178481F081962EQLYTGSQRALAVVALSNDVPHLLQYVLKLHAVLPQWVQDLRRASARAGAIAALSRAKAWIPELDPADLALGYPSLKEDGTVFDEQDFTACVKDIRPMATLIGNDTDLTKYQPGYDSENRRIPTPPYDEVHLIPPTRKHTFAPEVDTTGLIDDKAEFEALSGIDWASSIFQDKTADGEAEKDNSESSSPPKE
Ga0311022_11019333Ga0311022_110193331F012765QESSDEVARLTQLLSAKDATIKELRASKKTIARELETAQLAAKTAEETAATFKAQRDKAMDKAIRAGRILMRRPGVVVPEDIKADVHAAPDSSNHPSSSVVPEKDIGK
Ga0311022_11022732Ga0311022_110227321F086390PSEPRKSEFRDFLAGITVGESRDIAQATIGSIHFPAIHYFALFIGRGINGKDEACHMCVPDLSVLRSAVLGDKHYNLGAIVARRLHNNRINGDFFGGIYATRLANFLGVTIREDDIELPPAYLDYEAMVRHRFVERNDQFLQYRLIFDRRRTYHVALPASTFFDFQAKGRYFITREEAKEYKRRAKIARLQAVADDAMTVASQYDPNYNFRYPPGHPWH
Ga0311022_11024190Ga0311022_110241901F076748MMFIQLPGDYSSLYVSKSSFSQRNSSWFDLKDEEAVLFPNWETGIT
Ga0311022_11027085Ga0311022_110270851F103019MLLFRHVGKTSSIPPPAGGLTAAIVVVTRRRKEYHVVAAVEGHELKTPETKHRPGLERLRETTHLELDGKLVVNTQQAPTWRANCRRFDPWGALDRRVNCRCVSQPKW
Ga0311022_11031763Ga0311022_110317632F084191LPNRNKTVVPRGVAFMNTRHRRKRLYPADEQAKRDEYFRDIGLLKMDERRLRQKRNFELWCEGREKEMT
Ga0311022_11040325Ga0311022_110403251F027342LLKKYESLERDSKTQESDLVKALQSAQDAKAEAQKALQEIQAAKKIAVGKAFIMQSKHVKETFFLLTRIWSSPGAFADLPRSISDDVEFYRAEEGSSTEKLFWSQYIGAEHPMTLSDRLKKLVELHKAAELSMKDLIGRLWPAEPLPSSYFGLVKRLVSVCPRLEAIKRSVYIEGA
Ga0311022_11044057Ga0311022_110440571F020492MGIQAALLTSAALTSEVDALKQSLERSENELGLAKKQLKDKEGK
Ga0311022_11063651Ga0311022_110636512F020492MGVQAALLTSAALTAEVNALKESLERSESELGRAKKQLEDKEGT
Ga0311022_11064112Ga0311022_110641127F022683MASEMADQMKPLTDFYAKWSKDSLDMMSKGMAMYNRMSRAWTVVGEGSAAEKPEDMLKKWTEAFSGSYNELFEMYAQPFKMFGMGGQTPGKEAWEEAFAKWQKMFTAMPSGPAPAAGDEFMNFSKNWFEGYSKIWQTWMESMQRMGEACKSAVSEGEKPDAAMGAFTEISDRFMQQWSAFVTEQAQAFFTLWRSRLPSEKKEPAKKAKKE
Ga0311022_11064112Ga0311022_110641128F041288MFKRFSSRLYFLQLGVAIPFLILAGIASSATLLKSRLLPTEQTLKSSLGSEKFNTLRFETYGGLPENRMIGYFLYREGISVKGDGPQIESIGKLSLNEVLADHERVARAKFYGRLGHVMIREITREGVVVGYAVNDPKMEITLWDVTKYPSAISLELRYKDLQPKGQRYDAGPR
Ga0311022_11090443Ga0311022_110904431F086390FPAIHYFALFIGRCINGKDEACHMCVPDLSILRSAVLGDKSYNLGAIVARRLHNNRFNGDFFGGIYATRLADFLGVDVREDDIELPPTYLDYNSMVYHQFVERNESPLRYRLIFDRRHAVRITLPAPAFFDYQAKGRHFITREEADEYERRAEAARRHATAEEAIAATSQYNPGYNYGYPPGQPWQ
Ga0311022_11091094Ga0311022_110910941F076128MILEIIVLLFFLAASLYLAYQFRSCGQQMGILQGSNASLSADLEKTREENIKLVAELQKTRGDLAVSRKELEKTRAALNSCTDAINGGS
Ga0311022_11093285Ga0311022_110932852F015450KEFELQTTEGLLAEAEAKITELNTKLLYQLEGFKQEKLKLNEKLEAEIQNGLVLKKSLIDLQNKCLKFSNQCVQRLKKVFYSVGASSEEFIPSVEDLPGAFEHIEGEIDDLDDVIAGHGDFCALVASRGTAAAFLKSGCEHGKIINRPNFSLSPADLDNIPNLARSIANRFIKLVWTKGGRSKAGDEARSHLKPVTKSYLVLTSSFKLESSLLYFNIYRMTKPTKLKSKKLNLKPKLNGY
Ga0311022_11099651Ga0311022_110996511F089982LQGLILSNALRAQKNIKDEGCTIALNNLRSEVIELRNEGLEKDKILISLVNKIKEDEASSKVQAEAQKNEIEDLQKQLAEAKLKCVVAEADRDASEYWKNYFEKTVAELRASKERCFQNSVECVKKIKTSFANVGAYSNEDNFIRGDLEGVIE
Ga0311022_11100145Ga0311022_111001451F014346TVVLEKTLESLLNYKEIQQVHPKGNQSQIFIGRTDAEAETLILWPPYVKN
Ga0311022_11107504Ga0311022_111075041F001813TDPGGVQGTFGHGVEGHSLMRTIGDGWMVGLCDPVGLFQCW
Ga0311022_11111355Ga0311022_111113551F038489MVWVEKDHNDHLVSTPCYVQGRQPPDQAAQSHIQPG
Ga0311022_11115622Ga0311022_111156223F005658MAWIEKDHNAHPVPTPCYVQGRQPADQAAQSHIQP
Ga0311022_11116012Ga0311022_111160121F068298QRGGGVTEPGGVQRAFGWCVEGHVLARTIGDGEWLD
Ga0311022_11117563Ga0311022_111175631F020828PLSDQLKQLVELHKAAKLAMKDLIVRLWPAEPMPSSYFGLVKRLVSACPWLEVIKRSVCIEGVRMAFARAKMHWAKMDTTALMTEGLPKGKEHRRPKKYYDSVLKVSRLVEEQCTKDVIFESMHSFYPVI
Ga0311022_11122939Ga0311022_111229391F018877SIIGGKFFTDIWDNGGREMAGEIIRRSEKGIHDAREVAEAADKSTEAEDQLGTK
Ga0311022_11123948Ga0311022_111239483F018877SIIGGKFFTDIWDNGGREMAGEIIRRSEKGIHDAREVAEAAEKSAEAEGQLGIN
Ga0311022_11129342Ga0311022_111293422F079404FLGIEPHFALWKRLFCLVPRSYEGSIYQVSEAEIWRIAGTGYLSGTPKKAPEDWPSEWFYMEDAPLPDPVRIGLPEFSNAPLKKRLSWRPRSPQREDDGSVHYLMGRIRLLAHSGLTMIGIMATCIMRGVQPLQYRGHPMWDFNGEDDATRHGRRGPSSAADLAKILSGLYKGEEEDFLHTNTLNGFSMNNPRSWVSGHLSTRSILPKSSILLFDFDVGAAQGRGGHTKPNSTARGSGTI
Ga0311022_11129396Ga0311022_111293961F105149MYQGGSSRKQGPRPAIREPDNELPRGAQVRPCEWPSEDFMVQAGIKEEFDAYVCNTDLESFEEDKCRQYLYLTDSFVKRFKFTSSRNSHNVLFDLYDKSYTMDSEDFNTACKLPRWGSASEPRKSEFKEFLASITVGESREIIQATIGSIHFPVIHYFAIFMGR
Ga0311022_11139197Ga0311022_111391971F020828AMKGFIVRMWPRDALPNSYFGLVRRLVDACPWLEVIKRSVCIEGARRAFARVKVQWAKLDAVKLIKEGPPEGKEHRHPEMYYEGVLNGARLEADECTKDIIYE
Ga0311022_11146617Ga0311022_111466171F076912LGKSALLSNDKGSNADKVQDHETSLLVFNKADKTAKENYLEDSEATPKSCLGLLFELLATTACTSYSKSLSESVRFLESQLQAERHRSVMLRQEAEGLRKSLEHSDAYFLVQQQELDYLSTKQEKVNKLAKHLASIMGT
Ga0311022_11148487Ga0311022_111484871F059631MVGKMPNVIWLEGSFVETIKGWQSGWFYITKPRDPEWAAAPEFRSGIPTRLTSWKEKGLTWGNSEKLTGLQTCVQNLVNKKIKLVNVVQVMLIRRILPCQQRAFNLWEFDPAQHRTLSRLFDTTYKDAWKVLFKGAEAPASATKDRGFSSQRQAGEVSY
Ga0311022_11157215Ga0311022_111572151F014346MLEKTLESLLDCMEIQPVHPKGDQSWVFIGKTDVEAETQILWPPDAIS
Ga0311022_11170121Ga0311022_111701211F035626MAPTIIDSYAVQGETFLPRQIFVFASFPLRANSLGLLEQIESYTPDHQVRFGSLTYSTDVRGDLIFDGFEPLPCASRGHDEYDLALPSDSV
Ga0311022_11180011Ga0311022_111800111F035108EEMPASAGDLLQDLSQLHERARQAMQGVVQALWPSNSLPNGMGELVEMLKGARRRFWLWKISACRQGGREAWAMVKTRDAKADPNHMAEVVPGGSDGQEIPVSLVYDQVALAAKFSQRDCKLDSLLDGIEEEYSQSK
Ga0311022_11185521Ga0311022_111855211F075851MAMVRSTVRVTCDGEEAEGAKTAPIFEVMQRSGLVVSEDAPAAEAEQVDAEEFESEDDYSAVLTKPSHLEFGKSTVTEGDMSKLMNLGYFSEAKKELVRFGGEEITPKSGKDEVVVFKSF
Ga0311022_11196490Ga0311022_111964901F093003VEQERFKRRLVATASCLKKKQQQLRADQDLLVDRWTEVLAAEEYKLERPSKSYPKRRLLPQLEEEATKPTSPAYDAPDRPPRGRDREAFRPSTQAAPRHRSKHTRVRGDATDLRDILENKARQTRSIYGSHGRPATRDASRHVGHNKYGTAEYNRPSSSELRRDLAQYRGAAHPLCFTDEVMDHQIPEGFKPVNIESYDGTTDPAVWIEDYLLHI
Ga0311022_11197704Ga0311022_111977041F027342AFADLPRSMSDAAAFYRAEEGSSTEKVFLSQYAEAGHPVPLSDQLKQLVQLHKAAEHAMKGLIVWLWPGEALPGSYFGLVRRLVGACPRLEVIKHSVCIEGARGALACAKVHWGKLDAEKLVKDGPPPGKEHRKPKNYYKDVLKGARLVADECSRDVIFE
Ga0311022_11206010Ga0311022_112060101F059631AFSVGCEAFVRICAHFGLWLKTFKVKPKVVRGSQAECGGTMAGKMANVLWFEGSFMETLKGWQSGWFYITEPGDPEWTAVPEFRSGPPTRLVSWKETGLSWGDEKEVTGLQTCIQSLVNKPIRLVNVIQVMLVRRILPCQQRDFNLWEFDPAQHQTLSRLFDTTYEDAWKVLFKGAEAPASASEDRGYSSQRHASEVSYLHLLQDVKLFS
Ga0311022_11215612Ga0311022_112156121F020828EHATPLSDQLKQLVELHKAAEVATKDLIVRIWPGELLPTSYFGLIKRMVDSCPRLEVIKRSVCIEGACRAFARAKVHWGKLDAEKLVKDGPPEGKPHRVPKKYYDGVMKGACLVADECTKDIIFE
Ga0311022_11226300Ga0311022_112263002F052316WEMVKTRYIGLDPDHMAQVGPEGPDGKEIPMSLVYDQVMTVAKFSQQDCKLDGLLDGAER
Ga0311022_11228443Ga0311022_112284431F076912LLVCNKADKTAKEDYLEDSETTPKSCLGLVFETLATTACTSYSNSLSESVRFLESQLQAERHRSAMLRQEAEGLRKSLEHSDAYFLVQQQALEDFSAKQDKANKLAKLIASMVDTQDNVS
Ga0311022_11231728Ga0311022_112317281F020828VSDTAAFYRAEEGSSTEKVFWSQYDEAGHSVPLSDQLKQLVELHKVAEQAMKGLIVRLWPGEVMPGSYFGLVRRLADACPWLEVIKRSVCIEGARRALAHVKVHWGKMDAEKLVTDGPPEGKEHCKPELYYEGVLKDACLVADECSKDVIFE
Ga0311022_11238991Ga0311022_112389914F061390MVIISKDEAERLDRLVARYGQRTVMEALEAKMMGSWSVTYFPDVDSWEVSDYGDQNFVIKDGGKCNCGKGFGKNGSCIHQVLVELKKWDLEDELGVTE
Ga0311022_11250414Ga0311022_112504141F032472VPSPIGPMASSTNNAVQGETFLPGQIFIFGGFALRANSLGHLEQIESYAPGRQVRFGSLNFTADVRGDLIFDGLEPQPSAPHYCDGHDLALPPNSALVAAHESASAISPEPIAQIEGRWIDAALGASTSTAMEPNTNLVPCETRDSEAPDSSPDSEPPAPLPIDPDWAPVMEFTAADIFQCSPFGDILNSLKHLSLSGESWPDYGQDGWDADDEEIQRPPATHLVATVDDLTDM
Ga0311022_11257144Ga0311022_112571442F007409MSEDKKAAAEMKLSLDEEKNLGFLIAMSKTNTEKITKEILEGLSEDTGDSDSYDVDSGGEDSEDRPWRPSHAVFGKSTIKENHLVNMRGRYFRDLSVVRADEGEKTCPHPEENEVVVYRSFLKAGLRFPLS
Ga0311022_11258902Ga0311022_112589022F011632LEWTDQRGGGVTESGGVQRAFGCCVEGQGLARTIGEGRMVGLDDPVGLFQP
Ga0311022_11269059Ga0311022_112690592F020289MTEDEMVGWHHRLDGHGFGWTPAVGDGQGGLACCGSWGHK
Ga0311022_11273959Ga0311022_112739592F083289MPGHNGTITVHGSRKIALECEEGDAAYAESVCATEELKFYKDNVDPTDMTSLKKPTTEHDLVLKFKSADDTKLVDFVPGDSSKQFSINVNLYPK
Ga0311022_11287144Ga0311022_112871441F002471LGFKREAKNLTSHKAPIPAKEKGKAPMATSAKKNHAFLYHDRKNSRNAFRSYDAFDSHAYDSYAMTASSSHVVHDRNVGRRNVVHNMPRRNVVNAHRKVHGPSTIYHALNASFAICRKDRKIVARKLGAKCKGDKTCIWVPKEICTNLVGPNKSWVPKSQA
Ga0311022_11296264Ga0311022_112962643F105149MFRKMHKGVSSRKQGPRPAICEPDNELPRDPQVQPCEWPSEDFMVQAGIKEEFDAYVCNADLESFEADKCRQYLYLTDSFVRRFKFTSSFNSQTVLFDLYDKSYTMDLEDLILLVNSRSGVVL
Ga0311022_11299454Ga0311022_112994542F103319MADQYNSIGHHPKSTYMTSEGHALHNISGLDLIIDIAGVYFPLRSINYAANHNVTDEHGTGTHDPVALTNQEHTYTGTFTYASFLVTGENVLTQKDVLTLTQLLQDQADEGVSKYFDIYIIEVQGKRTPGTGTTFEEQVEAALQNESMVGYIEALVDCKVTKVNRDIPEKNTVVSSREFKYSYKI
Ga0311022_11310284Ga0311022_113102841F012765MEELDNQRRQLQESSDEVARLTQLLSAKDATIKELRASKKTIARELETAQQAVKVAEEAAVTFKTQRDKALDKAIRAGRILMRRPGVVVPEDIRADVVAAPDSSNRPSSSVVPERDIEK
Ga0311022_11316016Ga0311022_113160163F023356AAEAEAMSTELKKSKVITLRVEEPLFKAIEAQAELWNVKPAEAIRRVLRFYFLPVALEMQLRGESEKFWKGELTPEALREYMVFTLEATGKLSSSSLFLKGEASRLSEALEGKLSEALKEEREGAEP
Ga0311022_11320085Ga0311022_113200851F007409MSEEKKVAAEMKLSLSEEMHLGFLESIAKTNTEKITREILEGLSEDTGNSDSYDADSGGEDSEDRPWRPSHSVFGKSTIGQSHLENMRGRYFWDMSIVRAD
Ga0311022_11320111Ga0311022_113201112F027342MLIKHVEEAFLLLTRIRSSPGAFADLPCSVSDAAEFYRAQEGNSTEKLFWSQYAGAEHPMPLSDQLKQLVELHRAAELAMKGFIVRMWPGELMPSSYFGLIKRMVDACPRLEVIKRSVCIEGARRALARVKAHWGKLDAEKLVKDGPSEGKAHRHHEMYYDGV
Ga0311022_11321106Ga0311022_113211061F059631VKPKVVVGQQAECGGAMVGKMPNVTWLEGSYVETVKGWQSGWFYITEPRDTNWVAAPEFRSGIPMRLTSWKEKGLSWGSSVELTGLQTCIKNMMSKKIKLVNVVQVMLFRRILPCQQRVFNLWEFNPAKHQTLRELYDTMHEDVWRVLFKGAEVPPSLTQDRRLSAKRHANPVSFCISQGIYLPQLNDVRDLSSHAINMTG
Ga0311022_11325870Ga0311022_113258701F032472ETFLPGQIFLFGGFALRANSFGHLEQIESYTPGHQVRFGSLNYTADTHGDSIFDGFKPQLSVPHCVERHDLALPPNSALEAAHESAPTPSSEPTVQIEDRWLDTALGAAISMLMESNTNLVLCKTRDSEDPDSFPNSESPAPLPIESDWAPIMEFTAADIF
Ga0311022_11333624Ga0311022_113336242F020492MGVQAALPTSAAVPAEVDALKQSLERSENKLGLAKK
Ga0311022_11339513Ga0311022_113395131F015450CIQQLKQVFHFVGASSEKFTPSTEDLPGAFEHIECEINDLDEVIIENLENKIKEQSVAIEKKNFELQTIEGLLADAEAKITELNWKLLSQSENFEQEKLKLDAKLEAEVQKSSELKESLTSLQNKCLEFSNRCIQQLKQVFHFVGASSEKFTPSAEDLPGAFEHIEGEINDLDEVIAGHGDFCALTASRGTDVAFLKSGCEHDKIVNSPNFSLSPADLDNIPSLARSIANRFIKLVWTKGGRSKAGDEARSHFKLVTKLYLILTFSFEF
Ga0311022_11339775Ga0311022_113397754F059631MVGRMSHVTWLEGTFVETIKGWQSGWFYITEPRDPEWAAAPEFRSGIPTRLTSWKESGRIWGDSEELTGLQACVQKLVDKKLKLVNVVQVMLIRQILPCQRRGFNMWEFDPAQHQTLNGLFDTTYEEVWKVLFKGAEAPASATEDRGFSSQRPADEVSDIVLYGMLVIHSLTLCGI
Ga0311022_11339870Ga0311022_113398702F059631GAMVGKMPNVTWLEGSFVETIKRWQSGWFYINEPRDPAWAAALEFRYGIPTRLTSWKEKGLSWGNSKELTGLQTCIQNMVDKKLKLVNIVQVMLIRRILPCQQREFNLWEFNPAQHRTLNRLFDTTHEDAWRVLFKSAEVPPPITEDRGFSAKRHASVVSCFTFHMILVFYID
Ga0311022_11354193Ga0311022_113541931F103019GERTGRARMLFFHHAEKTSSIPPPAGGLSVAIVVVARRWKEYHAVAAVEGHELKTPEMKHRPGLERSLETAHLELDGKLFVNTQQAPTWRANCRRFETGGSLS
Ga0311022_11359967Ga0311022_113599671F076748MRFIQLPGDSPQHYVSKSSFSQSDSSWFDWNDEEVVLYQTGKLESPDLKVG
Ga0311022_11360295Ga0311022_113602952F066752MARQLAKNLILMMEIETLVTRPNSAEADKIRAKYLREINKRREIEQSTQN
Ga0311022_11384007Ga0311022_113840072F096317VLLAAAARTAKITGLTQDLEQAQGELGLARKQLEENKGE
Ga0311022_11385153Ga0311022_113851531F086390IAQATIGSIHFPAIHYFALFIGRCINGKDEACHMCVPDLCVLKSAVLGNKDYNLGAIVARRLHNNGRAGDLFGGIYATRVANYLGIAPREGDMMLPPAYLDYDAMVNHHFLRRNEQFLQYRLIYDRRNVVHVTLPAPYLFDYQAKGRYVDTRGGAAGLRGRRRQRRRMVERPTGQSQSGQRQQQLA
Ga0311022_11388880Ga0311022_113888802F021795MKKEADRIRRWRERKKAEGKSSFTVVLSHEAREILAEEKEKSGESYAVIMEKALLGLKKQGYTPPVLRHFPRREEVLARAAAQDPPPASHASRVNHEGDRQPRILIDDLANYPTLGDIEREQAAKELNGAYDLKSSEGLITRLLRSSAGPFGRKKKWFK
Ga0311022_11392233Ga0311022_113922331F032472LMAPSIIHNNAVQGEIFLPGQIFVFCGFALRANLLGNLEQISSYAPGHQVRFGSLNYMADIRGDLIFDGFEPQPSAPHCHDGHDLDLPPDSAQSAAQVSAPTLSSGPTTPVEDGWLDAASGAAISTAIEPNTNLVLHGARDSKVSDSYLDSEYSAPLLIESNRTPIMEFTAA
Ga0311022_11394372Ga0311022_113943721F045728MQLASAPRESSGQNERASMAVQAAPAPAGDSLLVSRF
Ga0311022_11394372Ga0311022_113943723F045728MQLASAPRESSGQNERPSMAVQAAPAPAGDPLLVSRFLPTRE
Ga0311022_11394572Ga0311022_113945723F105435LMLLGDALADGVAVGGHNVKGCDLPMLVNRARVHGLKIPMSLLWFWKGRPTWHESVFDTLELLSFGRSFEGNGVDDVARVFGLPPKLGQGRDFPLLWRADREGALAYNRRDVEIEIEIARICGCI
Ga0311022_11404749Ga0311022_114047492F032472VPCLLLPSGLDAQFGTPYPRSAGFDTDIGAFIESSSVSSPLGPMAPLIINNDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDGLEPRPSAPHYLEGHDLALPPDSVLEAAHASVPTPNSEPIAPIEDERLDVTSGASISKAIEPNASPALCMIRDSEDPDSFPNSEPPAPLPIESNWAPIIEFTAADIS
Ga0311022_11409542Ga0311022_114095421F035626VSSLQGFMAPSIVNNTVQGETFFPGQIFVFGGFALRANSLGHLEQIDSYTPGHQVRFGSLNYIADIRGDLIFKGFEPAVIAPPHPDERNLNMSSDHTEEMVPATAT
Ga0311022_11411533Ga0311022_114115331F076748MSQLISTTPMRFIQLPGDSPQLYVSKSSISQSDSSWFDWNDEEALQFPNWEIGIT
Ga0311022_11416112Ga0311022_114161121F076748FIQLPGDSPPLYVSKSSFLQSDSSWFDWNDEDAVEMS
Ga0311022_11416566Ga0311022_114165661F081962LCNAGPRSSNLNQSMLTKLKAIYTLVEQLYTGSQRALAVVALSNEVPTHLADVLRRLAVLPQRFQELRRASARAGAIAALSRAKAWLPELDPADIAIGYPNLKEDGTPFDQKDFTACVEEIRHVATLIGNDTDLTKYQPGYDTKNQRIPTPHYEEISLIPPLHKHTFAPEVDPAGLIDDEAEFEAVSGIDWKSSNLPGQGNRRRSGKG
Ga0311022_11418386Ga0311022_114183863F018007MFNGWKITNILDVGLCELDTADGPYNKTGYRLEHREDGFAVTVGLMEYISGWSALEILYWLNEKQAIPRRYDNAKRY
Ga0311022_11420205Ga0311022_114202052F031785ASSEKFTPSAEDLPKTFEHIEGEIDELDEVIAGHGDFCAWLASRGTAAAFMKAGCDHGKIVNRPNFSLSPSILDDIPDLARSISNRFVKMIWTKGGREKAGDEARSHLDPVRNHTLCLPFPVNLILTSNDLIHVG
Ga0311022_11432152Ga0311022_114321521F005658MAKVEKGHNDHRVSAPCYVQGHQPPDQAAQSHIQPG
Ga0311022_11435560Ga0311022_114355601F002994LYANLNIEQKEKLNELISSIHEKDDLLDSQEDFLIKENKKHVKVKNAYALQVEKCEKLSSELSTCHETIDNLRNENARLIAKVDSHVCDASIPNLRNDNDDLLAKIKELNDSLASLRVENENLIAKAKDFDVCNTTISDLRTKNDMLHAKVVELKSCKPSTSTVEHVSICTRCRDVNINAIHDHMALIKQQNDHIALLDAK
Ga0311022_11436208Ga0311022_114362081F059631VGKMPNVLWLEGSFVETLKGWQSGWFYITEPRDPKWVAAPEFRSGPPTRLTSWKETGLSWGSKEEVTGLQTCIQTLVNKQLKLVNVVQVMLIRRILPCQQRAFNLWEFNLTQHRTLSRLFDTMYEDAWKVLFKGAEAPASTTEDRGFSAQRHASVVSCLYLLQGISFS
Ga0311022_11440711Ga0311022_114407111F079404PSEWFYIEDVPLPDPIRIGLPEFDNAPLKKRQSWHPRSPLEEDDRDILYLMIQISFLARSGLNMIEVMAICIMAGVQPLQYRGHPTWYFNGEDDATRHGRKGPGSAAELIKILSTLYKGEEEEFLRVNPQGGFSMYNPPSWVSGDFFSPIRFVFP
Ga0311022_11443072Ga0311022_114430721F004001MQSPLLEVLKSRVDVALRDVVSGHGGGRLVVGLDDFS
Ga0311022_11447181Ga0311022_114471811F014346VVLEKTLESPMDCKEIQLVHPKGDQAWVFIGRTDVAAETILWPPEAKN
Ga0311022_11449661Ga0311022_114496613F014592SGARGIATILEKKGCEHVKILAQSEAALSFEDTKDPSAEASIIGGKFFTDIWDNGGREMAGEIIRRSEKGIHDAREVAEAAEKSAEAEGQLGIK
Ga0311022_11453046Ga0311022_114530461F076748MRFIQLPGDSPPLYVSKSSFLQSDSSWFVWNDEEAVLF
Ga0311022_11453046Ga0311022_114530462F076748MRFIQIPGDSPQIFVTKSSFLQSDSIWFDWYDEEAVIFPNRETGIT
Ga0311022_11454300Ga0311022_114543001F034384MDWLLAAELCQDFDEETGRVETGLDPIASPVCDETAMNMLRLESRIASATSYLVRLKEVVSRIDSSLWPGATLQNDLESLMTRLNEILDRVQEWKKSSARCGADVALSLVRVHCKEAREDKLAAIKVANTKKHDFQSFMETFIVAATRIADGIDLDSFVEPAGLPLAE
Ga0311022_11456493Ga0311022_114564931F079485DPLDAAIEWIKSNLSPGDVFDEEQHAEHARNNIEIYAVYSESNILGYIAGTFNPGEVFDTGQLETWAEDNGYVKE
Ga0311022_11460206Ga0311022_114602061F032472YLLERARTWVNTVFFVPCSPLILDPELGTPYPRSVGFDIEIGAFIESSTVPSMKGSMAPSIVYSDAVQGEAFLPGQIFVFSGFALRANLLGHLEQIESYAPGHHIRFGSLNYMADIRGDLIFDGFEPLPSAPHCHDEHDLALPPTSGPKAAPASALTLNSEPTALIEDGRLDATSG
Ga0311022_11464100Ga0311022_114641002F052316MTLFFRTLNEAGNTKVDPNRMARVGPLGSDGKEVPVSLVYDQVEVAAKYSQQDCKLDSLLDGIEQEVFES
Ga0311022_11464755Ga0311022_114647552F034384VNDEVAMNVFRLESRVAAVVDYLARLKVATSRIDSTLWPRETLQHDLESLMARLNTVPGRVQEWKKSSARCGADVALCLARVHCKDAREDKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0311022_11475069Ga0311022_114750691F076748MRFIQLPGVSPTLYVSKSSFLQSDSSWFDWNDEEA
Ga0311022_11480046Ga0311022_114800461F043815VISYRSKWPVGWKSEWFYVKVDDDKEKLVQSPLELIFGETRPRCKMTAEGPTWTALAEFKIIAEHIGTRDLVQEFLAFRVFPTMKEWTMPKLKGEKKEGELVRLPYYYKFKKYFKAPCQEWLDTIEVMSNEILGNYSKKEDQLMTAAFGTRPKR
Ga0311022_11486799Ga0311022_114867991F020828AGHPVPPSDQLKQLVELHRVAEEAMKGLIVRLWPGQAMPGSYFGLVRRLVNACPRLDVIKRSACIEGARRALARIKVQWGKLDAEKLLTDPPLPGKEYRTPEKYYKIVLKGAYDIADECSRNVIFE
Ga0311022_11488159Ga0311022_114881592F104139EVWEGVDPASTSSSHSGASHAPELPWLGPALPPGAQSPVQAMPLHFCYALE
Ga0311022_11488626Ga0311022_114886261F035626MLSLIGPMAPSIINNNAVQGETFSPEQIFVFGSFALRANSLGDVEHIDSYAPGHQVRFGNLNYTADICGDLIFDGFWPTPGAPNNHDEHGLDR
Ga0311022_11489305Ga0311022_114893051F075851MARVRSTARVDREGDETEAVETVPISEAMKRSGLVTPEDVPAAEAEQAGIEETDSEDDYSSAVPSKPSHLDFGKSTISEADFPKMVKLGYLSEAKKELIRFGGEETIPKPRKNEVVVFKSLLKAGLRFPLNKMIAGVLKKYGI
Ga0311022_11494141Ga0311022_114941411F046965IEELNVSLASLRNDNEKLISKAKDLDVCNASISDLRDKNDILRAKIVELNSCKPSTSTVEHVSICTRCRDINVDAIHDHLALIKKQNDHIAQLNAKINEHDLENEKFKFARSMLYSGRRPGIKDGIGFQKGDNVKLNAPPKRLSNFVKGKAPMPQDNEGYILYPAGYPESKIRKIHSRKSHSGPNHAYMYKGETSSSRQPTHAKLPKKKIPNASNDHAISFKTFD
Ga0311022_11500615Ga0311022_115006152F098130MPGPHPRRRPVCDDVLLHRSHVRDWAPPGWHWEVLPRGARRLMRNPAPGPVGDPELVWWLSRGPVSVRREPAPPEEVRRRVRKEDEHVHRYMTAMDVRFSNTWQVLRGSHPSYDPVVVPSLWVSTARASGTASELDNLIVFDLY
Ga0311022_11503654Ga0311022_115036542F068298ELEWAAQRGGGVTEPGGVQRAFGCFVEGHGLVRTVGEG
Ga0311022_11504557Ga0311022_115045572F051165MTTSFQKTLTILASIASVLAGVVTIASFLSGEDVTLPPSLTTPSSDHQPIIIHARAVFIEKNMTYAIDYDKNLIMLNESTIVLQ
Ga0311022_11508055Ga0311022_115080551F092835MGLLFYHQHWQFWPILARFMDYYSLFWGPRVISTINECWGAFTCRSSTLALLADSSPFLVLLLTVF
Ga0311022_11508055Ga0311022_115080552F092835MRLHVGHQHWLFWPILARFMDYCSLFWGPRVITTIKKPWDAFKYRSSTLAVLADTGAFHGLLLTGLGSLSDYHD
Ga0311022_11519907Ga0311022_115199072F027437LFDCLLLDMTRQISTLEEKHSRDQAELVQRCSDFEEKYSQSQAELAQVSAALDDANALSSSLRTQLDSEKVTYGTVPCVIVFLLLA
Ga0311022_11538244Ga0311022_115382442F076912KILEKSTLLCNGKGSNADKVQDSVASRLVSKKDDKNYIEDTETTPKSCLDVVFELLATTAGTSSSNSLPELVQLLVSQLQVERHRSNVMQQEAEGLRKSLQNSDAYFLVQQQVLEDLSTKQEKVNKLAKHLASIMGTQDIVS
Ga0311022_11540592Ga0311022_115405921F002471KLKFARDAYTIGRHPSIKDGLGYKREAKNLTSHKAPISAKEKGKAPMASSVQKNHAFMYHDRRQSRNAYRSCNAYNAFDSHAMFASSSSYVHDRNVGRRNVVHNLPRRNVVNVPRKVNEPSTIYHALNASFAICRKDRKIVARKLGARCKGDKTCIWVPKDICANLAGPNMSWVPKTQA
Ga0311022_11544710Ga0311022_115447103F061597VDCRKKTLDKLTDQPGNLIPIDVAEVPDLSASRDNSDLAEVDPCDPTTTSKPEAPMQSLNQLPVVTDLADARSA
Ga0311022_11549912Ga0311022_115499121F105149MFRKMYQGGSSRKQGPRPAIREPDHEPPREAQVRPCEWPSENFMVQAGIKEEFDAYVRNAELEGFMLDKCPQYYYLTDSFVRRFKFTSSRNSHTVLFDLYGKSYTMDLEDFNTACKLPQWGSTSEPRKFEFK
Ga0311022_11552585Ga0311022_115525851F020492MGLQAALLTSAALTAEVDALKQSLERSENELGRAKKQLEDKERK
Ga0311022_11560937Ga0311022_115609371F002002MTTLWAFLVAQLVKYPPAMRETWVLSLGREEPLKKEMATHSSILAWRIPRMEEPGGLQSMGLLRVRHD
Ga0311022_11563984Ga0311022_115639842F083289LICEEVDATYAELVCATEELKFYKDNVDPEDMTSLIKPTTKHDPALKFKSVADNKMVDFVPGDSSK
Ga0311022_11565292Ga0311022_115652921F055836MESFEGEVVAIYRKKWSRQFLGFVAVTMRWPMLLVLTRGRLLKINCIFTVYPGSQRDVDGYFPKGFKWFLKPAASGKPFVAGVITTGNGLGRGLVLAVPNTVDQFKQDKKLVGTIMKNLKLTKSLTGAKTIAIAGQGPRFFKSHFPYEQPFVYGLKGRVFSVVETVEQVADRHGLTKNETTVAILGVGEIGASIIANLEEKGYRAVGIDIRIAEGRVEIGREGMETLREADLIVVQTPRGDDVVPYYENLKKTAILIDDAHPRITVRPGEVKFYKVAIGRSG
Ga0311022_11568424Ga0311022_115684244F021528MIDTLKLMLNEYEITDDSEIRVQPASYELGTGSKVEYPLFQTPSHGSHYGSKAYLNAENWNLTLKPLPGGRATGAFLQLSVPKNYYGSNFYSVGEQGTQAVLSKVEGELKEKGVHTPLIEADMSRVDTFKNIEPEDPFSSYYTLFSLLKARRAIQRGYGTTFLLSNSQQEFCVYDKLEEMRERNIETGGLPPTMRFEHRLLNKQKIQNVYGMSKVGELFKGGYEVVKEKQVESWKASLFNFTTEEFVVLGSKQLEQEMRRFKEKSPSGWFSKFLKAYGAYYLASHAGKEVIIEALQNFEVDRMKVWRAVQVFEEAERELMVLKQEEGSKKTLGALYEELRRKVCLN
Ga0311022_11568424Ga0311022_115684248F069750LQENSFFIEGERFVIKERKSRKGKKTQYYLIRLQPFQYVSSLFPTGEEESYTFDYEQKLYRLERKEHSVTLKFL
Ga0311022_11569135Ga0311022_115691353F048337MAQIEETVTIEGVMRREEMPDTETAKLRDYRTEAVTKGATYTIIDPLPFDFIVQNLFYRVTEAFDGTVTIGTDAAPERILAAADFIKKVGKKSTAKSIMFEAGKALKLFMGAGTTGKIEVHVTGFLLKPSLL
Ga0311022_11573718Ga0311022_115737181F039980MFEGVDSCLQEEKSALVASRDNLDRLYRDSSNSLTILERSHRFTMEELDNHRCKLQESTDDVIRLRQLISAKDAAIKELRASKKSIAQELETAQLAAKVAEETSITLRAQRDRAMDKAIRAGRILMRRPGVVVPDDISADVNTAPDSSSRPSSSDAPEKDIAK
Ga0311022_11596949Ga0311022_115969491F093003HLEEEALKPHSPVYDAADRPLRGRAKEAFQLEVQPAPRRHSIKNTKARGNTEDRRYILDSKEKIYGTRARAPTRDDDRCVGYTKSKSGWAGYSKQDSYELCRDIARHRGSAHPLCFTDEVMNLEFPEGFKPVNIESYDGTTDPIVWIVDFLLHIHMARGEDLHAIKYLPLKLKGPARHWLNSLPVDSISCWEDMEAAFLGNFQGTYVRAPDAD
Ga0311022_11605746Ga0311022_116057461F035108MLTGRPEEEMPASAGDLLQDLSQLHKRARQVMQGVAQALWPSSFLMNGMGELVDMLQGARRRFRLWKMSACRQGAREAWAMVKTRYAKLDPNHMAEVGPAGPDGQEIPVSLVYDQVALAAKYSQHDCKLDNLLDGIEDE
Ga0311022_11611810Ga0311022_116118101F033819NNGIQSQLVELSVRLTRMEKDIQEIKKTLFESDKKIGDMEKNEAGRNPLIERRLDNLEKRTDKHEDEIDQLVKITQSLANTNKVLTWVAGLAGAGVLSWLIAQILSLIG
Ga0311022_11611810Ga0311022_116118102F024321MLEEILKLIAGMAGLGAFTSMLINLLKSVGLVKDGQSEQAFKIADLVIFVIVTVIYLTKAPVDWAQVDEWLVLLTALLGYVVSVFSGEFTHDTIKGTPLIGYSYSEKKLNK
Ga0311022_11614467Ga0311022_116144671F035626MSSPVGSMASSTIINDAVQGETFLPGLIFVFGGFALRANSLGHLEQIESYAPGRQVRFGSLNFTAGVRGDLIFAGFEPQPSAPHCHDGHELALQPDSTLEAALEPAPIFNSEPAAQIEDGWLDTASGVATSTAIEPNTDL
Ga0311022_11615450Ga0311022_116154502F092835MRLRVGHQYSQFWPILARFLDYYSPFXGLEAISIVIEAQGALTCRSTTLAVLADFGPFQGLLITILGSQSDFQNK
Ga0311022_11618459Ga0311022_116184593F001813WRGGGVTDPGGVQGTLGCCVERRDLVRTIGDGRMAGLGDPVSLFQRL
Ga0311022_11619152Ga0311022_116191521F052316VKTRYTKADRNHMAEVGPVGPDGKELPVSLVYDQVELAAKYSQQDCRLDSLLDGIEEEFNQS
Ga0311022_11621477Ga0311022_116214771F032472AVQGETFLPGQIFIFGGFALRANSLGHLEQIKSYAPGRQVRFGSLNFTADIRGDLIFDGLEPQPSVPHCYDGHDLALPPNSASVAAQESAPVLSPEPIAQIEDWWLDTASGTPTSTAMEPNTTLVPREARDSEVPDSLPDSGPPAPLPIESDWAPVMEFTATDIFQHSPFGDILNSLKHLSLSGESWPDYGQDGWDTDDE
Ga0311022_11621953Ga0311022_116219531F032472VSSPIGPMSFSSNNAVQDETFLPGQIFAFGGFALRANSLGHLEQIESYAPGHQVRFGSLNFTADVRGDLIFDGLEPQPSVPHCYDGHDLALPPNSALVAARESASAISPEPIAQIEDRWMDTASGASTSTAMELNTNLVPRENRDSEVPDSLPDSGPPTPLPIESDWAPVMEFTAADIFQHSPFGDILNSLKHLSLSGESWPDYGQDGWDTDDE
Ga0311022_11634282Ga0311022_116342823F093490MKTLLSIALILIATTVFATPFLVSDPQSGVTSYQLTGWSETTVTAQADGSLRMDVADAVQGTTYNLTIAASNVWGCSTTVPFVLQKQLPSAPSQLRLVP
Ga0311022_11634712Ga0311022_116347122F006329MILELLVADVVDDHKIKMDAMRLKIRKIRKYAIHTEAWYHYVVGSVVTLVAIMIAFVFALKCFT
Ga0311022_11642785Ga0311022_116427851F076748MRFSQLPGDSPPLYVSKSSFSQSDSSWFDWNDEEAVLFPNWETGI
Ga0311022_11649731Ga0311022_116497312F076577VNLWPESKVLALMELAFHFGAINYELNNGKKRREQWKNFKENAIDKGLKHINPDPRCTHPVNLDVLDHCWGYAEKIDKGEEINMNELCEGCEFFKKEVNNENPTQ
Ga0311022_11667881Ga0311022_116678811F039656TNCILREIKYFQTLTKLNGDILTIAGRDAVIVGKGRATFTLPMGTQIVIEDALLYPDSTRTLIGYRYPQK
Ga0311022_11667986Ga0311022_116679862F020862VFHSVGASSAKFTPSAENLPRTLEYIEGKVDALDEVIGGHADFCALVASRGTATAFLKAGCTHGNIVNRPNFSLSASDLIDIPSLARSIGNRFMTQIWVSGGRKMAGDEARSHLKPVRNLCLLLLPSPLKF
Ga0311022_11670477Ga0311022_116704771F020828MPLSDQLKQLVELHKAAKQAMKGLIVRMCPGDALPNSYFGLVRQLVDACPRLEVIKRVVCIEGARRAFARAKVHWAKMDAEKLVKEGPPQGKEHHHPEMYYEGVLKRARLVVDDCAKDVIFE
Ga0311022_11676838Ga0311022_116768382F002002MQETLVRSLGWEDPLEKEMATLSSILAWRISWTEEPSKLHGLQHQVHGVTNSRM
Ga0311022_11681660Ga0311022_116816603F034384VETGLDPINSPMEDEAAMNVLRLESRVAGVVDYLARLKAAASRINTTLWPGEMLQNDLESLMTRLNEVPGRVQEWKKSSARCGADVALSLVRVHCKDAREEKLASLKVANTKKHDFRSFMETFIAAATRIADGIDLDEFVAPSSPPPEE
Ga0311022_11684501Ga0311022_116845012F028669MYTQREIKKQWFKCRSDEFITNVNKGDEERGGQTLLQIAVIGKGRKRIEKIENRSKGVFIGTNQGDGEGKKGSRKDRK
Ga0311022_11689088Ga0311022_116890881F002994FLIKENKKHVKVKNAYAQEIEKCENLTRELSICHDIISNLRTENVSLIAKVEKSNVCHDSINNVRNENASLFAKIDKLNESISSLKTENDNLIYKAKDLNVCNVSISNLRNENAILHAKIDELNACKPSTSSVEHVAICTRCRDINVDVIHDHLTLIKQQNDHIAQLTAKINEHEIENEKFKFARSMLYSGRRPS
Ga0311022_11690789Ga0311022_116907891F032472GLMAPTIIDSDAVQGDTFLPGQIFAFGGFALRANSLGHLEQIESYTHGHQVRFGSLNYMADIYGDLIFDGFKPLPSAPHCHDGLDLALSPNSALEAAPASAPTFNSEPTAPTEDGWLVPAAEAAASTAIEPNTNLILHEARDSTLSDSPPNSEPSAPLPIESDWAPIM
Ga0311022_11697914Ga0311022_116979141F007510MDGGALEAAVHGVAKSRIRLSDFTLTFHFHTLEKEMATHSSVLAWRISGTGEPGGLPSMGSHRVGHD
Ga0311022_11697914Ga0311022_116979142F014346VVLEKTLESPLDFKEIQPVHSEVDQPWDFFGRNDAKAETLVLWPPHVKS
Ga0311022_11703944Ga0311022_117039441F020828MPLSDQLKQLVEFHRAAELAMKGFIVRMWPGELLPSSYFGLIKRMVDACPRLEVIKRSVCIEGARRAFARAKVHWGKLDAEKLVKDGPPEGKAHRHPEMYYDGVMKGARLVADECTKDAILE
Ga0311022_11707954Ga0311022_117079542F089982MALNNLRSEVIELRNEGLEKDKILNSLINKIKEDEATSKAQSETQKCEIEDLRKQLAEEKLKCAIAEADRDASEYWKNHSGKTVVELRSSKERCYEKSVACVQKIKTSFVNIGAYSNEDNFVVGDPEGPIEWIKGEAEAFEEVLSGRGDVCAFSGARELRPS
Ga0311022_11708598Ga0311022_117085981F020828VAMEDLIVRIWPDELLPTSYFGLIKWMVDSCPRLEVIKRSVCIEGACWALARAKVHWGKLDAEKLVKDGPPEGKPHRVPEKYYDGVMKGACLVADECSKDIIFE
Ga0311022_11724425Ga0311022_117244251F038084KAEKDIFLELSCFFDDPAGVGDLISGSSVFSKASLNTWKLTVHILLKPNLENFEHCFISV
Ga0311022_11726267Ga0311022_117262671F038003SAISLQHAALKQAADASPLAKGLLGVTLVPETTVQSVPDVPSSPPVDQEVPTDSHLTPFGFSLDPPSDFALVDALVEASPNPLGYRMRSLWDRLTDVSTYGPSGSEEDDEPDSCWDFSGLGDPSAMRDFRTACGYCLSDCSDGSRSLGDESCGPSRECFHIELGDPSEGSHLGMPEDGDIPRPVPLADIPPELAEVPAP
Ga0311022_11736373Ga0311022_117363731F034384VVLPRSCSLCLKVNLYAQQSFSTVIFPFDHCLDSVIVLAEFCQDFEEETSRLEPNLDPVNSPMDDKVAMNVFRLESRVAAVVDYLARLKVAPSHIDSTLWPRETLQNDLESLVARLNTVPGRVQEWKKSSARCGADVALCLARVHCKDAREDKLAALRVANTKKHDFRSFMETFLAAATR
Ga0311022_11740769Ga0311022_117407692F004001VVESLSLEMFKKHVDVALKDMVRRHGGDGLTVGLDDL
Ga0311022_11741484Ga0311022_117414841F034384VETSLDPINSPVKDEATMNMLRLESRVTGVVDYLARLKVAVSRIDTTLWPRETLQNDLESLMTRLNDVPGRVQEWKKSSARCGADVALSLVRVHCKDAREDKLASIRVANTKKHDFQSFMETFIAAATRIADGIDLDQFVAPSSPAPEE
Ga0311022_11745275Ga0311022_117452751F020363MLQFADLCALTFGGMWRWRRVAVARVFALVVRCRIMMLFLYSRVGKNRDTKRGSPAGAGAGRTADHVTVLFSQKILAVREANDIYRPVRLSFLLLLA
Ga0311022_11752828Ga0311022_117528281F059631GLWLKTFNVEPKVVGGRQAECGSAMVGKMPNITWLEGSFVETIKGWQSGWFYITEPRDPEWAAAPEFRSGIPTRLTSWKETGLSWGNSVEVTELQTCVKDLIDRKVKLVTIVQVMLFRRILTCQRWDFNLWEFDPAQHQTLSRLFDTMHEDAWKVLFKGSEVHPTHHRGSQILRQVPSHRSKLVLSLSRDT
Ga0311022_11757221Ga0311022_117572211F033854MXQTAAEEQSDRIASDIEVWMKQRCVIEFLCAEKMAPFDIHXHLLNVYGDQTVDVSTM
Ga0311022_11762804Ga0311022_117628041F003406NDLKERENITKIIMRPIWSRFGLRKPKVEIDEAAEGCRRAFGIVCSFIGTRDLVQEHVAYRIWPLIDNWEMPKEAISNPSEGGLVRLKYTFRFRDQFIEPDDDWLKCVENTSDELLGAYS
Ga0311022_11763809Ga0311022_117638092F081962LAVVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARSGAIAALSRAKAFLPELDPADIALGYPSLKEDGSAFDQKDFAACVKAVRPVATIIGNDTDLTKYQPGYNAENQRIPTPRYEAINLIPPARQHTFAPEINPDGLIDEEAQFEALSGINWKSSTFEALGSAEAEDEPGTSTQQAS
Ga0311022_11764001Ga0311022_117640011F086646MDFIFRIQNHYFEKGTPWVELDKIKQRSWFLSVDIEDDEAVPCYDAVHELRISKGIAFKSVKILTGKTQETHPYWEALLDMSSTELRDVTFKDLPGESGIYMLNIWFDYDGEELNFGDDFKKLCEYRHKWDDGWVCSRC
Ga0311022_11773716Ga0311022_117737161F002471VAGLNAQLKASKSEFDKLKFARDAYTIGRHPSIKDGLGFKREVKNLTSHKAPISAKEKGKTSMATSVKKNHAFMYHDRRQSRNAYRNCNAYDAFDSHDIFASSSSYVHDRNVRRRNVVHNMPRRNVVNVPRKVNEPSTIYHALNAYFAIFRKDRKIVARKLGARCKG
Ga0311022_11776990Ga0311022_117769901F012765MEELDNQRRRLQESSDEVTRLTQLLSAKDATIKGLRASKKSIAQELEAAQLATRVAEETAVTFKAQRDKALDKAIRAGRILMRRPGVVVSEDIRADVNAAPDSSNRPSSSV
Ga0311022_11797554Ga0311022_117975541F004815VALGSLGWWLATLHIAGGWNEKTIVVLFNSGHSMILWFS
Ga0311022_11805852Ga0311022_118058521F047964MALADAAMLCVQENSFMPRPKDLVEKIDKYDLERKWQVVEPSTERTYWVLFREEYETTDDINEIECKEIFADEYVGAPKLKKESETKNMSDEERLIQFRKLYKEQKQYV
Ga0311022_11807327Ga0311022_118073271F011632WAAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGDGRMVGLDDPVGLFQP
Ga0311022_11807910Ga0311022_118079101F102634EIEGYGMVDGEFIQSEQGWFCREVKGVRWNFREWGAQEPMETPEEAAVYLLSLDIDDIANNN
Ga0311022_11809567Ga0311022_118095671F020492MGLQAVLLTSAALTAEVNTLKENLERSENELGHAKKQLEEKEGE
Ga0311022_11809790Ga0311022_118097902F065522VPFCFSLPSLWTALPSDPVLFDYLLLGMTRQISTLEEKHSRDQAELVQRCADFEEKYSQSQTELGQVSAALDDANALSSSLHAQLDSEKVIYKTVLCLAVFLLLAWFLKELIFARRKKSVSLLLLATVLTDCIVILATR
Ga0311022_11811039Ga0311022_118110393F036355VDQVKTGGRILYNDGRPGHQGVAAIVLAVDVEGMTVQFEDRADTSYIRFSDRKWMDYISVVE
Ga0311022_11814956Ga0311022_118149561F059631RLDVESLEAYLLIRPHFGLWLKTFNVKPKVVRDNQAECGGAMVGKMANVLWLESSFVETLKGWQAGWFYIPEPRDPKWVAAPEFRSGFPTRLTSWKETGLTWGNSVELPILQSCVQSLVNKKLTLLIVVQGMLIRRILTCQQRAFSLWEFDPAQHQTLSRLFDTTYEDAWKVLFKGAEAPASATEDRGFSSQRQAGEVSYFTLYRTLIFHSLTLCGI
Ga0311022_11818031Ga0311022_118180311F076912LENSTALSIGKGSNADKVQDSETSVLVSKKADKNYLDDSEGTQKSCLDVVFELLATSAGTSSSNSLPESVRLLEYQLQVERHRSDVLRHEAEGLRKSLQNSNTYFPVQQQALEDLSAKQEIVNKLAKHLASIMGTQDIVS
Ga0311022_11818607Ga0311022_118186073F093582MPYGLIVLVASVALVVVYVFVTDAAFWSKALVAGLLLLSFAWRYGTFLQAALGVFLSLYFTYLKSRAERG
Ga0311022_11822148Ga0311022_118221482F079404AGFVALCELFLGVEAHFALWKRLFFLVPRSQAGSRYQVGGAEVWRIAGTGYLSRTPKTASEDWPWEWFYIDDVPLPDPIRVGLPEFNSAPLKKRLSWRPRSSQRESDRDVLYLMGRIRLLAHSGLTMIGVMAACIMRGVQPLQYRGHPMWDFNGEDDATRYGRKGPASAAVLVKILSSLYKGEKEEFLRVNPQAGFSM
Ga0311022_11833619Ga0311022_118336191F035108VKKPANRVISVGMLTGRPAEEMPGSAGDLLPELSQLHEQVRQVMQGIAQALWPSASLPGGMGELREMLRGARWCFRLLKISSSRQGAREAWAMVKTWYTKADPNHMAEVGPVGPDGKEIPVSLVYDQVELAAKYSQQDYRLDSL
Ga0311022_11859440Ga0311022_118594401F092835SGVRLLVHRHHSQFWPILTCFINYDSPFWDPEAISIVVELQGVLMCWSSTLRVLADSGPFLGLLLSSGVPN
Ga0311022_11862994Ga0311022_118629941F003622NAYAKGNENKPNYTNREFMNALIIFQTALMDKMWDNQDFDKMEMQDRENMAVQCGLDLRKLIHTYTGLDTHKIEEFL
Ga0311022_11865705Ga0311022_118657051F055526QKKKRRRLRRVFSFDEDASTLAPAAEEMTATGLADIDPNGCAPPAADPNEDVVCAVTVEDEEEENEIPLTRKNSRQFVASGGSSGVPSPALSALIGLQELSMANFDQALEDMVPENLLLEPADADATETCAAVPDAGLRSSRASSTLEHDLEGRDADLDRPDPMEVAEGPSTLEVVTAESLDPLNSADTCPAPEDVDGEDSARGGLSSGEECRPLPSPRGCCRG
Ga0311022_11867122Ga0311022_118671221F034384FEEETSRVETSLDPINSPVKDETAMNMLRLESRIAAVGDYLARLKAATSHIDTSLWPEEALQNALESLMTRLNEVPSRVQEWKKSSARCGADVALSLVRVHCKEARDDKLVSLKVANTRNHDFRSFMETFIAAATRIANGIDLDEFVAPSSPPQEG
Ga0311022_11867865Ga0311022_118678651F067310DVALYLVRVHCKDAREDKLASLQVANTKEHDFRSFMETFIAAATRIVDGIDLDEFVAPSSPPPEG
Ga0311022_11870004Ga0311022_118700042F020492MGLQAALLTSAALTAEVDALKQNLERSENELGLAKKQLEDKEGE
Ga0311022_11870593Ga0311022_118705932F035108MSAGMLTGRPAEEMPGSAGDLLPELSRLHEEVRQVMQGISQALWPSVSLPEGIGELAEKLKGARRRFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYSQ
Ga0311022_11882599Ga0311022_118825991F013401DAANIAVTKGLLFPNVGHKCLMAKDGKKKKVKSRSSTKYETSSDEDNSCDEEDNLCTLFANLNVQQKEKLNELISAIHEKDELLDSQEDFLIKENKKHVKVKNAYALEVEKCEKLSSELSTCHDVITNLRNENASLIAKVDSNVCDASIPNLRDDNVNLLAKIEELNVSLASLKIENEKLIAKAKELDVCNASISDLRDNNDILRAKIVELNSCKPSTSTIEHVSICTRCRDVDIDAIHDHM
Ga0311022_11889413Ga0311022_118894132F020828RAEEGSSIEKVFWSQYAEAGHPVPPRDQLKQLVELHKVAEQAMKGLIVRLWPGEAMPGRYFGLVRRLVDACPWVEVIKRCACIEGARRALARAKVHWGRLDAERLLTDAPPPGKEYRTPEMYYKTVLKGACKIADECPRDVIIE
Ga0311022_11896336Ga0311022_118963361F095123VPDREPGLRCLQWVQEELLELPAVVGGLMSYASLVTCEGAMNALSREGCRHFEALDQVDEDFGRDIYEVEDPVVKESAGALYDRMWGLHGCEVVRERAEAARAQVTLSFVRCLLDVFCACAC
Ga0311022_11899752Ga0311022_118997522F081962VVTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARSGAIAALSRAKAFLPELDPADIALGYPSLKEDGTAFDQKDFAACVKIVRPVATLIGNDTDLTKYQPGYNAENQRIPTPRYEALSLIPPARQHTFAPEIDPAGLIDEEAQFEALSGINWKSSTFEVLGSAGGEDRNEPGTSTQRAS
Ga0311022_11907988Ga0311022_119079881F081962QLYTGSQHALATVAPSNEVPTLLVEVLKKLSVLPQRFNELRRSAARVGAVNALSRAKAWLPKLDLADIATGYRSLKKDGTPFEENDFTACVKEIRPVATLIANKVDLTKYQAGYDEENRRIPTPHYEVTSLIPPLRNHTFAPKVDPAGLVDAEAEFEALNNIDWSSSTFQERES
Ga0311022_11912306Ga0311022_119123061F094706RAHGGFEFLKGNFEGTKGYAVGRMTTSRPGKLYIDDVGWGPKAGSIDYGYRVPFGSIHVFIVRIGETGPEPNICTDLIETAQRTRSAQIKPAMKRAFVGMIHGGSYEDGSELRGATAVRSDDESSTGETESLYQLQDGWTESCSDGDSIPDPSDLPNWVGIFMAETQATLHSSTAVAMIFGSAAVAAAGAGGPVRPPAQVLSELFDVLAVLMAEVNAPDQ
Ga0311022_11916515Ga0311022_119165152F073228MAVTIGDIMDMNSSKYGKFLHRIVMVFPHNMEVDRTELARLIKINNNTLTFERKNGEKFRIDERDIEHMELFRSPNYRGGI
Ga0311022_11918305Ga0311022_119183052F043478MDPYDGHSAWKFQYSHPVKAEAKGRRISLLSWLATLVFLSGTLLFAYQLYGWFEHNEWTRYPSVALAKYLPAGCFGFLNEVSAVKASVLWLLDRADLSVILILMGFLIAKFFVDSK
Ga0311022_11919827Ga0311022_119198273F084191MNTRHRRKRMYPTHEQAKRDEYFREVGQIKMDERRLKQKRNFELWCEGRDNEIEDVR
Ga0311022_11924733Ga0311022_119247331F013401SSSEDEDDLLALFANLNMQQKEKLNELISAIHEKDDLLDSQEDFLIKENKKHVKVKNAYALEVEKCEKLSSELITCHETIHNLRNENANLLAKVDSIACNVSIPNLRNDNDDLLAKIEELNISLASLRVENENLIAKAKDFDVCKVTISDLRDKNDILHAKIVELNSCKPSTSTIEHVTICTRCRD
Ga0311022_11927102Ga0311022_119271021F006329MELELHVADVFDDHMIKMEKMRFKIRKIRKYAIDSEAWYHYAFGSIVTLVAILIAFVVAFKWFS
Ga0311022_11927341Ga0311022_119273412F031785HGDFCAWVASRGTAAAFLKAGCEHGKVVNRPNFTLSSSILDDMPDLARSISNRFIKMVWTKGGREKAGDEARSHLEPVRNDISCLPFPLGLILMIP
Ga0311022_11929431Ga0311022_119294311F096317AAAHTVEVSVLKRDLGRAEEELSLVMRQLEENKGK
Ga0311022_11936845Ga0311022_119368451F020828PVPLSDQLKQLVELHKVAEQAMKGLIVPLWPGEAMPGSYFGLVRRLVHVCPWLEIIKRSVCIEGAHRALARVKVHWGKMDAEKLVTDGPLEGKEHRKPELYYEGVLKGACLVANECSKDVIFE
Ga0311022_11942494Ga0311022_119424945F026449CSVYNSISKSMMITRRLGGGDEANYTYVEEADDDANKDSA
Ga0311022_11944703Ga0311022_119447031F093003LSEDEVSLGDNEFIVLEDPVEQARFKRRLMVTTNSLKKKQQQLQADQDLLADRWTEVLAAEEHELERPSKSYPKRRLLPHLEEEAWKPHSPVYDAADRPLRGRAREAFQPKVQTAPRRHSVKNTKARGNTEDLRDILDSKAKIARSIYGTRARAPTWDDDRRVGYTKSKFGRAEYSRQDSYELRRDIAWHRGAAHPLCFTDEVMNHEFTEGFKPVNIESYDGTTDPAVWIEDFLLHIHMARG
Ga0311022_11949669Ga0311022_119496692F001813QDAYYNSVQGMFGCCVEGHGLARTIGEGQMVGLDDPVGLFQP
Ga0311022_11952005Ga0311022_119520051F020828PDAAAFYRAEEGSSTEKVFWSQYVEAGHPVPLSDQLKQLVELHKVAEQAMKGLIVRLWPKEAMSGSYFGLVRRLVEACPRLEVIKHSVCIEGARRALARAKVHWGKVDAEKLVTDAPLPGKEYRTPEMYYKGVLKGARLIAGECSKDVIFEQTRICYHVR
Ga0311022_11952072Ga0311022_119520721F096850NIESIKNQKGPAVTPKRKRMVTVLDVLETIESSNTTPKKTAETSVTETKVFDAEAPRQQAETETGPSKPTKGEKMSEPIPVEEISAVAPEASPAVPEYIVRHASGKKLSEKEKQEAQFYAQKLKYQKGALIFNGSGEEDFLYCLPDSKEISVYREMSKSFGFPTLEDGLSVLSK
Ga0311022_11959654Ga0311022_119596541F004815RLDVALGSLVSWWATLHIAGGWKEMITVVLSNPGHSMVL
Ga0311022_11962036Ga0311022_119620364F072820MKPLHQVIEDAVTIRGIIDYLEKSVEPVGLHEIAMTQHISNGTALRLCRILEKAIIIEHPVVTRIVVGVSQEVPQLAWQLTKSFWLGGCVYNAEDLARGAA
Ga0311022_11968671Ga0311022_119686712F083289QLTLPGLNGTITVHGSRKVALECEEGDAAYAESVCATEELKFYKDNVDPTDMTSLKNPTTEHELAMKFKSADETKLVDFVPGDSSQQFSISANLDPK
Ga0311022_11970368Ga0311022_119703681F027342AAGKAFIMQSKHVKETFLLLTRIRSSLGAFADLPRSISDAAEFYWAEEGRSPEKLFWSQYIGTEHLMPLSDQLTQLVKLHKAAELAMKDLIVRMWPAEPLPSCYFSLVKQLVNACPRLEVIKQSVCIESARRAFARVKVHWAKMDAKKLVTEGPPKGKEHRHPEKYYDNVLKGARL
Ga0311022_11984187Ga0311022_119841873F065281NKMAKKSIVTSIRLNEDDYLKFKALKEKSGTSWTKLVAHINNILEQELKDAKED
Ga0311022_11992255Ga0311022_119922551F079404AGYVAFYELFLGCEVHSELWKRLFCLVPRTQEGSIYQVGGAEIWRIAGTGYLSGTPKKTSEDWPSEWFYMEDVPLPDPIRMGLPEFNNAPLKKRRSWRPRSPQEEDNREVLYLMGQIKTLAKSGLTIIEVMSICIMRGVQPLQYRGQPMWHFNGEEDATRYGRKGPNSVAALAKILSDLYKGEEEEFVCIKPRDGFSMYNPQAG
Ga0311022_11993010Ga0311022_119930102F020828MKGLIVRLWPREAMPGSYFGLVRRLVDACPWVEVVKHSACIEGARRALARAKVHWGRMDAEKLVTDAPPAGKEYRMPEMYYKSVLKGARMIAGECSKDVTFE
Ga0311022_11994364Ga0311022_119943642F092835VRLSVGHQHSQFWPILARFVDYYSLFWGPGVISTIDEPQGALTCRSSTLAVLAESGPFCGLLLTVSGPQTSFNIF
Ga0311022_11995373Ga0311022_119953731F038489MAWVEKDHNDLVSTPCYVQGHQRPDQAAQSHIQPGLECL
Ga0311022_12002816Ga0311022_120028162F027342MISKHVEESFLLLTRIRSSPGAFVDLPRSISYAAEFYRAEEGSSTEKLFWSQYTGAEHPMPLSDQLKQLVELHNAAEQAMRDLIVRMWPGEPLPGSYFGLVKRMVHACPRLEVIKQSVCIEGARRAFARAKMHWAKLDAEKLVKDGPPEGKEHRYPEKHYDGVMKGARLVANECPKNIIF
Ga0311022_12005864Ga0311022_120058642F020289MTEDEMVGWHHRLDGHELEQAPGVGDGQGSLACCSPWGCNGSDMERLN
Ga0311022_12013519Ga0311022_120135192F061390LEETTGREGSVGMVIISKEEAERLDRLVAQFGQRTVMEALEAKMLGSWSVTYFSDVDSWEVSDYGDQNFIIKDGGKCNCGKGYGKNGSCVHQVLVELKKWDLEDELGVTE
Ga0311022_12016008Ga0311022_120160081F020828VPLSDQLKQLVELHKVAEQAMKGLIVRLWPKEAMPGSYFGLVQRLVDACPWVEVIKHSACVEGARRALAHAKVHWGKLDGEKLVKDGPAPGKEHRKPENYYKDVLAGARL
Ga0311022_12016718Ga0311022_120167182F020828TPRAHERPAEATGRAPQGGRTGHEGLIVRMWPGDPLPDSYFGLVRQLVNACPRLDVIKRSVCIEGARRAFARAKVHWAKLDAEKLVKEGPPEGKEHRHPEMYYNSVLKGSRLVAEECTKDVIFE
Ga0311022_12016818Ga0311022_120168181F004001LPREVVESLSLEVFKNHVHVALRHMVNGDGLLVGLSGLFQL
Ga0311022_12029946Ga0311022_120299461F098130NDVLLTHVRDWAPPGWHWEVLPGGPRRLMRNPAPGPVVDPHLLWWHSCGPLSVRREPAPPEVVRRLVREEDEHVHRYMAAMDVRFSNTWQVLLGDHPSYDPVMVPSLWVSTARTSGTASGLDYSVVFDLY
Ga0311022_12060658Ga0311022_120606581F014592IEWIDHEAEAFEEILNSRGDICAFSGARGIATILEKKGCEHVKILAQSEGALSFEDARDPSAEASMAGGNFFTDIWDNGGREMAREIIQRSEKGIHDAREIAEAAEKSAEPEGQLGII
Ga0311022_12069586Ga0311022_120695861F033854MAAEGQSDKMVCDMEVRVKQRCVTEFLHAETMALNDIHQCLLNIYGDQTVDEAVGGVLQQ
Ga0311022_12070095Ga0311022_120700951F081962VVTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGSAFDQKDFAACVKAVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEALSLIPPTRKHTFAPEIDPAGLIDEEAQFEALSGIDWKSSTFQALGTAGGEERDEPETSTQQ
Ga0311022_12074839Ga0311022_120748391F003406PTFQKRWPRDWMKEWFYVKNDLKAREDIKDIIMHPIWQRFGLWKSKVEMDEAAEECQRAFGVVCSFIGTRDLVQEHVAYRVWPLVEKWEIPKETISKPDEGGLVRLKYTFKYGDKFVEPDDDWLKSIEAISDELLGPYSKAKILHCPQPSEAGRRKG
Ga0311022_12079030Ga0311022_120790304F073228MAITIGDIMDVNNSKYGEFLYKIVMVYPHNMEVDKTELARLIKINNNTLTFERKNGEKFRIDERDIEHMELFR
Ga0311022_12082201Ga0311022_120822011F067310DRVQEWKKSTARCGVDVALSLVRVHYKEVRQDKLAAIKVANTQKHDFRSFMKTFIAAATRIADGVDLDEFIEPASPPPAE
Ga0311022_12084790Ga0311022_120847901F093003QDLLADRWTEVLAAEEYELERPSKSYPKRRLLPRLEEEATKPTSPAYDAADRPPRGRDREASRPSTQAAPRHRSKSIKARGNAPDLQDILEDKARQTRSIYGSCGRPTTRGDNRRAGHGKYGQAEHSRQSSFGLRRDIAQYRGATHPLCFTDEVMDHQIPEGFKPVNIESYDGTTDPAVWIEDYLLHIHMARGDDLHAIK
Ga0311022_12099414Ga0311022_120994142F045728MSLASVPRESSDQNERPLMAAQAAPAPAGDSLLVSRFLPTRE
Ga0311022_12108601Ga0311022_121086012F058179MNGTEIVALVAWYAFIAVCILAFYLLSTMLSDAATLSMIGSCTGQGFTNITVEADLLLASINQTANGTSWQIWGAPV
Ga0311022_12117134Ga0311022_121171341F035626MASSIINNNAVQCETFLPGQMFMFGGFTLRANSLGHLEQIESYAPGRQVRFGSLNYTANIRGDLIFDGFEPLPCAPYGHDEYDLALPSDSVQEIAPTAAPTLNSVPVVSSMDGWMDP
Ga0311022_12118712Ga0311022_121187121F055595MKRAHLTYRRRLWPPQKLARLREIEHAFQGRAFGEELARVNFELTIEERHRYLEGMRELGRRNRR
Ga0311022_12121909Ga0311022_121219091F001813PGGVQGTFGRCVEGHGLMRTFGDVWIVGLGDPVGLFQPW
Ga0311022_12130923Ga0311022_121309231F053881MKAIANISKDSLGEKEGKLYSKVYRHIVQNFEIDEIAADQIAMAIVNQKCILLPRLLSGEDVDISLASESIRKWLSEYRLTPKSREKDKEVTINLS
Ga0311022_12130923Ga0311022_121309232F070633VLDVSHSNSDDGFTYSVRQHIPLGPKRCKSSYNLVVVPLSDGIMTSIERDNFNIAMDTEGRLILTRKDRKVQLVFDYGSGFMTGVLGGVLYDTFEIPKKEETDYHG
Ga0311022_12137457Ga0311022_121374572F053764MVDTEIRLIIFFAAKDGEALYGQQRQDMELTVAQIMNSLLQNSDLN
Ga0311022_12138869Ga0311022_121388691F086390ATIGAFISLLNFIFSLHRKVQNGKDEACHMCVPDLCVLKSAMLGNKDYNLGAIVACRLHNNGLSVDLFGGIYATRDANYLGISPHEGEIELPSAYLDFDAMVRHRFLLRNEQFLQYRLIFDIHSSIHVTLPAAFLFDFQAKRRYVVTWEEAAEHEGRAEAARQHAAAQEAFAAASQYDPSYN
Ga0311022_12139981Ga0311022_121399812F096761MFIRSSYQALVDGMANQLKSQGASIPEVASSLERWNPVLLHRRVSELEATNAG
Ga0311022_12143897Ga0311022_121438972F004001SLEVFKNCVDVTQRDTVSGHGGDGLMVGLSGLFLP
Ga0311022_12144701Ga0311022_121447016F005744MDDETFEIIKAGAPDAPPEQALYRIQQTYPDGSGGRLNVDWDGLRRLHELIHDRITMEGCVCETCDTKGCHRPATWEIECRGAGVSGRLIYSCDEHCPDPAILSPQDEMRRLVEE
Ga0311022_12146257Ga0311022_121462572F065522MLVGALFLLLLCLCSWIVLPSDLISFDYPLIGMTRQIAVLEEKHSQDQAEMAQRCADFEEKYSQSQTELNQVSAALDDANALSSSLHARLDSEKVTYETVPHLAMLLLLVWIPKELIFVCRKRNVSLLLLATIWTDYIVILATR
Ga0311022_12149017Ga0311022_121490171F034976NLLRLLVPFLEAGSDEAMNNAQPVRCQKCGKPVGYVTVLARGVMGLQQPLQNVKVVAICMECAQKKK
Ga0311022_12149812Ga0311022_121498122F093490MKTLLSIALILIATTVFATPFLVSDPQSGVTSYQLTGWSESTVTAQADGSLRMDVADAVQGTTYNLTIAACNVWGCSSTVPFAFGKQLPSAPSQLRLVGQ
Ga0311022_12151186Ga0311022_121511862F002002MVRNLPAMQETRVQSLGQEDPLEKGMASHCIILAWRIPWTEEPGGIQSMGLQRDKTEAT
Ga0311022_12156904Ga0311022_121569041F033854MATEGQSDRMASDMEARMKQRCVSEFLQAEKIAPANVHQHLLNVYGNQTAQ
Ga0311022_12160513Ga0311022_121605131F059631TWLKGSFVETIKRWQSGWFYITEPRDTNWAAAPEFRSGIPTRLTSWKEKGLSWGSSVELDGLQKCIRNMASKKLKLVNIVQVMLFRRILPCQQRDFNLWEFDLAQHQTLSELFDMMHKDVWRVLFKDAEVPPSLTKDRGLSAKRPANPVSFVHLVGILLHIA
Ga0311022_12160644Ga0311022_121606442F057477MTTPKLKDSSSTALLALAVLFLTPGLLILSPDGRIFFLVMAGLVSAVVAIAAPSGKKRLAAAVGLLIAVVMALQTWPDYRAHADAWKRHTSGQLESRGE
Ga0311022_12174261Ga0311022_121742612F005658MAWVEKDHNTHLVPTPCYVQGHQPPDQAAQSHIQPGLE
Ga0311022_12183690Ga0311022_121836901F076748TPMRFIQLPGDSPPLYVSKSSFSQSDSSWFDLNEEKAVLFPNWETAFS
Ga0311022_12188798Ga0311022_121887983F095123CLEWVQVELQELPAVVGGFMSYASLVTCVGAMNALSREGCRHFEVFDQADEDFDRDVYKVEDLVVKDSAGALYDRMWGPHGREVVRERAETAMAQVTFSFVWRLLDVGCACVC
Ga0311022_12190303Ga0311022_121903031F031785VIAGHGDFCAWVASRGTAAAFLKTGCEHGRIVNRPNFTLSPSILDDIPDLARSISNRFIKMIWTKGGREKAGDEARSHLEPVRNHTLCLPFLVSSILTYNDLIHVG
Ga0311022_12196812Ga0311022_121968121F020828GQKPTTRHLSELINSRTEGNILNSNSIAQHPVPLSDQLKQLVELHKAAEQAMKVLIVRLWPGGALPGSYFRLVQRLVEACPRIEVIKRSVCIEGARRALARAKVHWGKLDGEKLVKDGPPPGKEHCKPENYYKDVLKGACLVADECSRDVIFE
Ga0311022_12199175Ga0311022_121991751F067453GPLPGGGYEGKTKRLDRAVQRFAEWLQTRIAGPVQVRFNSHRLSGGAFVYPGLAAEAPVTFDTPEIGLGARLVTPPAVARRRDRAWQHGEGSSLPALEWEDCWTERTPLAYNVLIYPEFLRDPANLGEERPGSRFGYWAADTPQEAYRLLKRLVNFSMRLTTA
Ga0311022_12208284Ga0311022_122082841F039981VYNVTDEDDFLYCLLDNKEISVCREMAKNIGFLKLEVGLSAMSKDDLADSLAYNSLKVRKLWTYKKIIICLLFSC
Ga0311022_12210768Ga0311022_122107681F062644ASGGSSGVPSPALSALIGLQELSMTNFDQALEDMVPENLLLEPADVDATETCAAVPDAGLRSSRASSTLEHDLEGRDNDLDRPDPVETAEGPSTLEVVTAESLDPLNSADMCPAPEGVAGEDSAQVRSVGHYPAPEGVAGGDPAQVGSANLDPAPEGVRAGSPSCTSMDVHVGSPPHSGGMTVARTSDQGVALEGSIPTGLKLNSAECTELVPAGLLRAASGGGLIPDYQLISPDLGISSFFSNLQVRCRALI
Ga0311022_12211071Ga0311022_122110711F038003VALVPETTVQSVPDVTMSLLIDRKVPTDSHPTSFGFSLNPPSALALAGALVEASPNPLGFRMRSPWDGPTAVSTYGPSGSEEDDEPDFSWDFSGLGNPSAMRDFMTACDYCLSDCSNGSRSFGDEDCGPSHECFHIDLGGHNEGNHLVMPEDDDPPGPAPRVDILRELAVVPVPAGGQDPQLEQIREMQARLDEGAGTLEPCHRDIGQERAGQPPAGEA
Ga0311022_12212629Ga0311022_122126292F076912LEKSTPLCNGRESNADKVQDSETTLLVSKKGDKNDLVDSEKTPQSCVDVVFELLASTAGTSSLNSLPESLWLLQSQLQAERHQSAVLRQEAEGLRKSLQNSDAYFLVHQQALEDLSARGFKRWRI
Ga0311022_12213442Ga0311022_122134421F038084SSNCCLLTCIQVFQEAGQVVWYYHLSQNFPHFIVIHTVKDFGIVNKAKIDVFLELSCFFDDLAGVGNLISGSSAFSKTSLNIWKFMVHVLLRPGLETFEPYFTTV
Ga0311022_12224684Ga0311022_122246841F093003VPEDPVEQERFKRRLMATVNSLKKKQQQLQADQDLLADRWTEVLAAEEYELERPSKSYPKRKLLPRLEEEAYIPSSPAHNTADRPPRGRDREASRPSTKTVPRHRSKSTKPRGNAPDLRDVLEDKARQSRSIYGSRGRPTTHDEYRRAGYNNPGRAEHSRQRSLELRHDIAQYRGAAHPLCFTDEVMEHQIPEGFKPVNIESYDGTTDPAVWIKAYLLHIHMARGDDLHAIKYLPLKLKGPARHWLNSLPVESIGCWEDLEAAFLDNF
Ga0311022_12228041Ga0311022_122280411F079404KAFEDWPSEWSYMEDAPLPDPVRIGLPEFSNAPLKKRLSWRPRSPRREGDSSVHYLMGRIRLLAHSGLTMIGVMATCIMRGVQPLQYRGHPMWDFNGDDDATRHGRKGPGSADDLVKILSGLYKGEKEDFLRTNPLNGFSMNNPRSWVSGRMHI
Ga0311022_12233894Ga0311022_122338941F035626MAPLIINNDTIQGETFLPGQIFVFGGFTLRANSLGHLEQIESYAPGHHVRFGSLNYTADIHGDLIFDGFEPRPSAPHYLEGHDLALPPDSVLEAAHASVP
Ga0311022_12236106Ga0311022_122361062F045728MQLASAPRETSGQHERPSIAVQAAPAPAGVSLLVSRFLPTRELTNNRIILHRTSS
Ga0311022_12238491Ga0311022_122384911F033854MVSNMEVRMEYRCVSEFLYMEKKSPNDIHQHLANVYGDQPVDVSTVRW
Ga0311022_12246643Ga0311022_122466431F072104SLGGIRYDLLDTRADRAGVPDLSVSGDNSDLVEVDPHDPTTTSDPEAPMQSLNQLPMVTDLADARSA
Ga0311022_12250434Ga0311022_122504341F059631FVMWLQIFCVKPKIVSGQQAECGGAMVGKMSNVTWLDGSFVETVKGWQSGWFYITEPCDANWVAAPKFTSGIPMQLTSWEKKGLAWGEPTELTGLQFSIKNMIEKKIKLVNMVQVMLVGRILPCQRQAFTLWEFDPAKHQTLRELFGMTHKDVWKVLFKATEVPPSTSEDRGLSATWIGNPVSSLNITRCTFPNI
Ga0311022_12262331Ga0311022_122623312F020862VKFNPSVENLPETFEHIEGEVDALDEVIAGHADFCALLASRGTAVAFIKSGCEHGKIVNRPNFSLSPSDLIDIPSLARSIGNRFITQIWVKGGRKMAGDEARSHLKPVKNLSLLLYLLLELCTSLIPF
Ga0311022_12265175Ga0311022_122651751F037171MYACNRIENDPVEEPEELAGEAPEQQSVGGGKCPLTYLCPIHSLIHLPLYTFMPKD
Ga0311022_12266407Ga0311022_122664071F093003MAARPPRGRDREASRPSPQAMPRRCSTKARENAPDLQDVLEDKAKQTRSIYGSSRRPTARDGDLHSGYNKSGRAEHNRHSSFELRRDIAQYRGAAHPLCFTDEVMDHKISDGFKPVNIESYDGTTDHAVWIEDYLLHIHMARSDDLH
Ga0311022_12271269Ga0311022_122712691F035626MAPSIIASDAVQGEAFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGNLNYTVDIRGDLIFDGFEPMPDAPHSRDEQDVTLPSDSVREIACSPTPAVNPEQIAPSESGGMDPAREAALSVAIEPDTDFTPYERRVAEPLDSSPATDSEPLT
Ga0311022_12271921Ga0311022_122719211F034384VEPGLDPVNSLVKDEAAMNVLRLESRTASVVDYLARLKVAMSRIDTSLWPGTTLQNDLESLMARLNEVPGRVAERKKSSARCGADVALSLVRVHCKEEQEEKLAAIQVANTRKHSFQDFMETFIAAATRIA
Ga0311022_12275959Ga0311022_122759592F075047MKKHLVFLMACLVTTWGCASVVFVSQETGKGQLLSATAEVPLQPSALFVTATDDSMPDVSRDGRWVAFRRVVGGVERIIVRQVGDAAGTSERDIAQGTRPRWSPSGSWVLFRNQGKIYQVRPDGTSLMQLTSPPANMTDNFGHDYWNATTVVFGRGTGTGPGQVAALYLLDLASSALTGPVLGCSQPVVSHDGSRMTCEIKYYYGWGIMHYVQVYAVPSLQALGSIGFTYGPNATTIQNVGGIAFSADDERLLFSAVPPGETKREIYSIRLDGSGLTRLTNNGWDDVSPDGYKPQLW
Ga0311022_12276469Ga0311022_122764691F027342AALPSRVSDAAEFYQAEEGSSTEKLFGSQYTGTEHPMPLSDQLKQLVELHKAAEQAMRGLIVRMWPGEPLSGSYFSLVRRLVDACPRLEVIKRSVYIEGARRAFARAKVHWAKLDAIKLVKEGPPEGKEHCCPEMYYESVLKGSRLVADECAKDVIF
Ga0311022_12276604Ga0311022_122766041F076748MRFIQLPGDSPPLYVSKSSFLQSDSSWFDWNDEED
Ga0311022_12278492Ga0311022_122784921F020828MPLSDQLKQLVDLHNAAEQAMGHLIVRMWPGEPLPGSYFGLVKWMVHAYPRLEVIKQSVCIEGARRAFARAKVHWSKLDAQKLVKDGPLEGKEHCYPEKYYDGVMKGARLVANECPKNIIFE
Ga0311022_12278842Ga0311022_122788421F084191VAFMNTRHRRKCLYPADEQRKRDEYFRDIGLLKMDESRLRQKRNFELWCEGRDKEMT
Ga0311022_12283652Ga0311022_122836521F073159MPYRKKGAVRKGKGSMCNICGLNCGKGGALKAHVEGSHGVDYNAYKKCFYEEVKTVIADSWDDSVQTKSGRTVVTHVLVRRFMGYPGPRGAPRA
Ga0311022_12290074Ga0311022_122900747F029801MPGCLLRKGNRGFAVLGKAVPLGLVAFGREDVSRSWALTAEFGCLRLERLSGDEEVTGEQVFLPLPADYDYGIVGAGNAPEMTRVVFGLLASELEQLVNALRRGSFPVLGFSQRDLRCSLSCCLIPGCWPHVVTSNEASHGNVVSLEAFMRVIVASLPQARLRARFPELRPVFEQMARLVARRRYGVPFTREMLELMPRPAPRRS
Ga0311022_12305162Ga0311022_123051622F091320LADRLKEHKELAVVFTKGRSDITEELQGIYEEASGWPETNELRLLVVLDQTRQLKAKNLAYCINELGKRGVGFVLITQYSTSIPPEIRNVGTYFIMAVMSETEIKRFKDVTLHPSSKLITRLPRAVSFVFSPYWYPEPFFIKHRKLKERNA
Ga0311022_12305578Ga0311022_123055781F004001VESLSLKVFKSCADVALRDVVSGHGGGGLVVGLGDLCGLFQCWLF
Ga0311022_12306754Ga0311022_123067541F093003AEEYELERPSKSYPKRKLLPRLEEEAYKPTSPAHNTTDRPPRGRDREASRPSTKAIPRCRSKSTKSRGNAPDLRDILEDKARQSRLIYGSRGRPMIRNDNRHARYSNSVRAEHSRQSSLELRRDIAQYRGAAHPLCFTDEVMDHQIPEGFKPVNIESYNGTTDPAVW
Ga0311022_12306977Ga0311022_123069771F004815KARLDVALGSLVCWLATLHIAGDWNSMSIVVLFKPGHSMAL
Ga0311022_12309519Ga0311022_123095191F059631MLGKMPNVTWPEGSFAETVKGGQSGWFYITEPRDANWVAAPEFRSGVPMRLTSWQERGLTWGPLAELTRLQKCIQNMIENKIKLVTVVQVMLVRRVLPCQRRTYSLWEFEPAKHQTLLELFDTTHQEIWKVLFMAGETPPPTTEDRGLSLKR
Ga0311022_12333194Ga0311022_123331941F027342RIWSSPRAFADLPCSLSDVAEFYRAEEGSSTEKLFWSQYIGSEHPMPLSDQLKQLVELHKVAELAMKDFIVRLWPGEPLPGSYFGLVKRMVNACPRLEVTKWSICIEGARRALARAKVHWAKMDAEKLVTEGPPKGKEHRHPEQYYDNVLKGARLVAEECAKDVIFE
Ga0311022_12344056Ga0311022_123440561F020828MPMSDQLKQLVKLHKAVEQAMRGLIVRMWPGDALPNSYFGLVRRLVDVCPRLEAIKRSVCIKGARRAFARAKVHWAKMDTKKLVKEELPQGKEHRLPEMYYEGVLKGRNSKFAPKAVEGFLLGYDSNTK
Ga0311022_12359560Ga0311022_123595601F007409MSQEKKVVAEMKLSLSEEKNLGFIESIAKTNTEKITREILEGLSVDTDESDSYDVESGGEDSEDRPWRPSHTVFGKSSIKQSHLDNMRGRYF
Ga0311022_12368774Ga0311022_123687742F030981MGKVRRCDKRCHTAKGTRCQCWCGGFFHGSAGAANRATLAQGATERLEKHGFRKDETAYIGQEELSMKDLPGAEAR
Ga0311022_12376297Ga0311022_123762971F020289MVGWHHQLNGQEFEQAPGDGERQGGLARCSPWGHRESDTTEPLNSNNHPD
Ga0311022_12385263Ga0311022_123852632F047387MASEIASEVLKDEEYADAEYRRFHKEKDKYMDFDEFCREEGI
Ga0311022_12387475Ga0311022_123874752F035626MAPSIISNDAAQGEVFLPGHIFVFSGFALRANSLGHLEQIESYAPGRQVRFGSLDFTADIRGDLIFDGFEPQPSVPHCHEGHDLALPPDRAQSTAQVSAPTLSS
Ga0311022_12390640Ga0311022_123906401F020862SLKTEMEKNSNLQKSLKELQEKCLDFGSRCMQRLKDVFHSIGASSEKFTPSAENLPSTLEYIEGEVDALDEVIGGHADFCALVASRGTATAFLKAGCTHGKIVNRPNFSLSSSDLIDIPSLARSIGNRFMTQIWVNGGRKMAGDEARSHVKPVRSLYLLLLPSP
Ga0311022_12392225Ga0311022_123922251F076912LYNVRESNADKAQDSETTLLVSKKGDKNDLVDSENTPQSYVDVVFELLATTAGTSSSNSLPKSVRHLESQLQDERHRSDVMPQEVEGLRKSLHNSDVYFLVQQQALEDLSAKQEKVNKLAKYLASIMGTQDIVS
Ga0311022_12399087Ga0311022_123990872F020363MWRWRRVAVARVFALVVRWRVMMLFVYSRVGKNRDTRRGPPAGAGAGRTADYLTVLFSQKVLAVRSAYDIYRPVMHCAYYIFSSSPLDVTL
Ga0311022_12404890Ga0311022_124048904F064746GYTFEGDFDDKWSSGYGDTKTYKPANLEDQFGIPIGAYDWTGTENYNAFYYDSGEPSGSITKYGWAHIFVLKPDEDMANVLKSATRLLINPRNHRNAVVAGDLTEKYIEYNGRQAYLVEIKEELMDGFVDYRDYAAIAFFLDDGKVCVIDAFTTDNFGMSAWDIIDSIEL
Ga0311022_12418900Ga0311022_124189001F020289MTEDEIVGWHHRLDGREFEQAPGVGDGQGGLACCGPWGRKESE
Ga0311022_12423456Ga0311022_124234561F032472SVLSPSGWMAPTIINSDAVQGETFLPGQIFVFGGFALRANSLGRLEQIESYAPGRQVRFGSLNYTADIRGDLIFDGFEPLPSAPHCPDEHDLDLPPNSALKAAPAAASTLNSEPTVPIKDGRLDATSGAATPTVIEPNTSPVLCETHDSKEPDSSPDSEPSAPLPIESDWAPIMECTTADIFRRYPEVTEVSLFIMRAVAGLWSARFGYGR
Ga0311022_12426897Ga0311022_124268975F004001VEESPSLEVFKGRGDVAQRDMVSRHGGDGLMVGLDDLSALFQP
Ga0311022_12426907Ga0311022_124269071F083289ASYDESVCSTEELKFYKDNVDLADMTSLKKPTTKHDPVLKFKSADDTKLVDFVPCDSSRQFSISANLDPK
Ga0311022_12429936Ga0311022_124299361F002471NVKIEIASKSTTCVENVAICNRCKEFDIDACSDHIASIARLNNEVASLNDQLKTSKSEFDKLKFARDAYTIGRHPSIKDGLGFKREAKNLTTHKTPISTKEKGKAPMANSVKKNHAFMYYDRRYSRNAFRSNDVFDSHAYDSYAMTASSSHVMHGRNVFRRNVVHQMPRRNVVHNAPRKVVNEPSEIYCALNASFAICRKDKKIVARKLGARCKGDKTCIWVPKNICANLVGPNMSWVPKSQA
Ga0311022_12434665Ga0311022_124346651F029075LVAAQVQDFGPAHATATTGFLAASTAEGGNECGGSVSEFFDFTDSGSSAEWTEESSEEDLDYFAALDVAAAEAALHAADAPSVPGPSTGHRRRRAVAKRRISAEEGARLRVSRVGRQELLSLPAVSGVGEGELRSLFAGEELRIMLFNYREMGIIPKVEPM
Ga0311022_12443891Ga0311022_124438911F086390RDITQATIGSIHFPAIHYFALFIGRCINGKDEACHMCVPDLSVLRSAVLGDKHYNLGAIVARRLHNNRINGDFFGGIYATRLANFLGIPIRDYDMELPPSYLDFSAIVHHQFVERNEPPLQYRLIFDRRHAVNIVLPAPTLFDFQAKGRYFITREEANEYERRTRAARLQAAAHDAIATASEYDPNYNFGYPPGQPWP
Ga0311022_12444634Ga0311022_124446341F092835PGVRLRVGHKHSLFRPILACFVDYYSLFWGPEVISAINEHRGAFTCRSSIHTVFVDSGPFRGLLLTILGSQSDIHGC
Ga0311022_12477244Ga0311022_124772441F102692EETAATLKAQRDKAMDKAIRAGRILMRRPGVVVPEDIRADVNAAPDSSNRPSSSVVPEKDIGK
Ga0311022_12477693Ga0311022_124776932F020492MQDALLTSAALIAEVDALKQSLERSENELGLAKKQLKDK
Ga0311022_12488619Ga0311022_124886192F058971MTPNLIINLDIEPITLMWNGQAVSIPGTYELVPDEMVKHLHRRVMAIALHERKRIPFCGKLVGQARNGNGKGSVWLVEDDRGQLIKSQKPMVVEGV
Ga0311022_12492884Ga0311022_124928841F007510MDGGAWWAAVHGVAKSRTRLSDFTFTFPFPALEKEMATHSSILAWRIPGTGEPGGLPSMGLHRVGHD
Ga0311022_12494252Ga0311022_124942521F079404VGGAEVWRIAGTGYLFGTPKKACENWPSEWFYIDDVPLPDPIRAGLPEFNGAPLKKRLSWRPRSSQRESDRDVLHLMGRIRLLAHSGLTMIGVMAACIMRGVQPLQYRGHPMWDFNGEDDATRYGRKGPASAAALVKILSSLYKGEEEEFLRVNPQGGFSMYNPPSWVSEQLCLPIRFIF
Ga0311022_12495721Ga0311022_124957211F098130MPGPHPRRRPVRDDVQPTHVRDWAPPGWHWEVLPGGARRLMRNPAPGPVVDPDLVWWRSRGPVSVRRDPAPPEVVRRRVREEDEHVHRYMVALEGGRFSNTWQFLQGSHFSYDPVRVPSLWVSTARAAGTASVLDSSVVFDL
Ga0311022_12501761Ga0311022_125017611F076748RLIQLPGDSQTLYVTKSSFLQIDSSWFDWNAEEAVLFPSWELESPDLKVG
Ga0311022_12507141Ga0311022_125071411F057793MEKKSITPSIRMDDDQYLKLKALKEEYGVSWNKLIKLVNELLENDMKD
Ga0311022_12511688Ga0311022_125116882F034384VETGLDPINSPVKDETAMNVLRLESRIAAVVNYLARLKAATSCIDTSLWPKETLQNDLESLMTQLNEILSRVQEWKKSSTRCGADVALSLVRVHCKEAREDKLVSLKVANTRKHDFRSFMET
Ga0311022_12515662Ga0311022_125156621F076912LDNNTPLCNGKGSNAYKVQDSVISLLVSKKAEKNYLDDSERTQKSCLDVVFELLATTAGTSSSNSLPESVHLLESQLQVERHRSDVLRQEAEGLRKSLHNSDAYFLVQQQSLEDFSAK
Ga0311022_12516672Ga0311022_125166722F015419MKYKVQLTDEAGNVFLYDVSRSSSSEKTLNDFILEALQISEDKRELPVKIQCPNGLEVAPSIKMKFENYGSPLLGDKLEAMHITWRDXITANVWQYETVAL
Ga0311022_12529256Ga0311022_125292561F013401TKYASSSDDNSSENEEDNLHILFANQNMQQKEKLNELISAIHEKDDLLDFQEDFLIKENKKHVKVKNAYVLEVEKCEKLSSELSTCHDTIANLRNENAKPIAKVDSNVCNVSIPNLRDDNVDLLAKIEELNVTLASLTNENERLLTKAKELDVCNVTISDLRDKNDILRAKI
Ga0311022_12534589Ga0311022_125345892F052316MVKTRYMKSDPNHMAEVGPMGPDGKEIPVSSVYGQVELAAKYSQQDCKLDSLLDGIEEEFNQSN
Ga0311022_12542522Ga0311022_125425223F001813PGGVQRAFGRCVEGHGLARTIDVGQMVGQDDPVGLFQP
Ga0311022_12550306Ga0311022_125503061F034384ETSRVETGLDPINSPVKDEAAMNVFRLESRVAGVVDYIARLKVAVSRIDTTLWLGETLENDLESLMTRLNEVPGRVQEWKKSSARCGADVALSLVRVHCKDAREDKLASLKVANTKKHDFQSFMETFIAAATRIADGIDLDQFVAPSSPPLEE
Ga0311022_12553207Ga0311022_125532071F004001VQSSFLEAFKKCGDVALRDVVSGHGGDGLMDGLGNLSGLFQP
Ga0311022_12565397Ga0311022_125653971F067310QEWKKSSARCGDDVALSLVRVHCKEAREDKLAAIEDANPKRHEFPSFMETFIAAATRIADGIDLDEFIEPSSPPSAE
Ga0311022_12571026Ga0311022_125710261F089982LQGLILSNALRAQKNAEDESCTIALNNLRTEVIKLRNEATEKDKILLSLVDKVKEDEASFKAQAEIQKNEIEDLRKQLTETKEKCGLAEANRDISEYWKNYLEITVEELRASKKRCFEKSLSCVEKIKASFANMGAYSNEDNFIRGDPEGVIEWISGEAKAFEEILNDRGDVCAFSGARG
Ga0311022_12591337Ga0311022_125913371F037171MYVCARIENDLVEEPEELAGEAPEQQSVGGGKCPLTYLCPIHSLIHLPHYTFMPKV
Ga0311022_12617997Ga0311022_126179972F079404FCLVPRSHEGSIYQVGGAEIWRIAGTGYPSGTPKKASEDWPAGWFYIEDAPLPDPVRIGLPEFSNAPLKKRLSWRPRSPQLEEDKSVHYLMGRIRLLAHAGLTMIGVMATCIMRGVQPLQYRGHPMWDFNGEDDATRHGRKGPDSVEDLVTILSGLYKGEKEDFLRTNPLNGFSMNNPRPWVSEHSACPTHAF
Ga0311022_12619320Ga0311022_126193201F095123TSLVTCEAAMNALSREGCRHFEALDQVDEDFGRDIFEVEDPVVKESAGALYDRMWGSYGREVVRARAEAARAQVRLSFTRRLLDAVCACVC
Ga0311022_12623897Ga0311022_126238971F085858MKDFKEVIKLKAIPTTFKFRCTLCNLEIVEYDWHFGLIKMNQHVVEAHPNEVQSLDMEELYSR
Ga0311022_12634600Ga0311022_126346001F030486RYVALAQSRGGACFCTRGAMQDYKVICLFSRWQKP
Ga0311022_12640317Ga0311022_126403171F034384VDVLRLESRVAAVVDYLARLKVATSRIDTTLWPGETLQNDLESLMTRLNEVPSRVQEWKKSSARCGADVALSLVRVHCKDARKDNLAALKVANTKKHDFRSFMETFIAAATRIADGIDLDEFVAPSSPPQEG
Ga0311022_12652181Ga0311022_126521811F005658MAWVEKNLNDHLVSTPCYVQGHQPPDQAAQSHIQPGLECLQGWGIHNLL
Ga0311022_12653533Ga0311022_126535332F070267LYEIRSKTALDEGFVSTWPPLLGLSLLRKYELPGYLEETLLHSHFSFLHRSLSPLAVIDLADLVVRQSFSRHGKLVVESPLPDATIESTPGSSIQDQFSAIGYRKFVEIRLPPQKDGR
Ga0311022_12658478Ga0311022_126584782F052316MVKTRYTKADPNHMDEVRPVGPDGKEIPVSLVYGQVELAAKYSQQDCKLDSLLDGIEEEYTQSN
Ga0311022_12662047Ga0311022_126620471F052316MVKTRYKKADPNHMAEVGPEGPDGKEIPVSLVYSQVELAAKFSQRDCKLDSLLDGIEEEYNQ
Ga0311022_12663134Ga0311022_126631341F003406IWQRFGLRKPKVNMDESAEECQRAFGVVCSFIGTRDLIQEHIAFRVWPLVEKWEMPKETITKSDEGGLVRLRYTFRYEGKFVEPDDDWLKCIEATSDELLGPYSKAEDTALSAAFGGRKKKRLNRVFDAIGFVYPDYRYPTRAQKRKNTASAKEIASAAPSEPTPERKKINV
Ga0311022_12665047Ga0311022_126650472F036104MNQEGIPLSLGVVIAAAILGALIVAGMVIFAVFSII
Ga0311022_12668807Ga0311022_126688071F014592NFSRGNPEGPLDWISHEAEAFEEILSSRGDICAFSGARGVATVLERKGCEHVKSLAQSEAALSSEDIKDPSAEASMVGGKFFTDIWDNGGREMAQEIIQKSEKGIHDARKVAEAAEKSTEPEGQIGIN
Ga0311022_12670442Ga0311022_126704421F105149MLRRMYQGGSSAKKGPRIAIREQDVNLPRDANVRACEWPSDDFMVEAGFKGEFDAYVRNAEQEDFLQDKCPQYYQLTDSFVRRFEYISAHNSSSVMFDIYDTSYTMDLEDFTTACKLP
Ga0311022_12672587Ga0311022_126725872F038084VIHTVKGFNVVNEAEVDVFVELSCFFYDPMDVGNLISGSSAFSKTSLKLVHILLKPNLEKFEHYFASM
Ga0311022_12672587Ga0311022_126725873F038084NFPQFIVIHTVKGFGIVNKAEIDVFSGTLLLFDDPADVGNLISGSSAFSKTSLNIWKFTVHVLLKPGLENFGHYFSRM
Ga0311022_12674406Ga0311022_126744062F027437MARQISILEEKHSQGQAELVQRCSDFEEKYSKSQTELAQVSAALNDAKTLNSALRAQLDSEKVTYETVPCITVFLLPA
Ga0311022_12675582Ga0311022_126755821F052316MVKTRYTKLDPNHMARVGLVGPNGKEIPVSLVCDQVEVAAKYSQQDCKLDRLLDSIEEEVFESK
Ga0311022_12675811Ga0311022_126758111F076912ADKVQDSETSLLVSKKADKNYIEDTETTPKSCLDVVFELLATTAGTSSSNSLPESVRLLESQLQVERHRSDVMRQEAEGLRKSLQNSDAYFLVQQQVLEDLSAKQEKVNKLVKHLASIMGTQDIVSWALLKWFEFWTCFAAAFICTGRQL
Ga0311022_12678836Ga0311022_126788361F035108VSVGVLTGRPAEEMPGSTGDPLPELLQLHERVRQAMSGVVQALWPSVSLPEGLGGLAEKLQGVRRRLRLWKISACRQGAREAWAMVKTQYPKADPNHMAEVGPVGPDGKELPVSLMYGQVELAAKYSQQDCKLDSLIDGIEEEYN
Ga0311022_12678988Ga0311022_126789881F027342ESKTQASELAAALETAKSAKAEAQKALQELEEMKKTATGKEFLMQSRNIKVNYLLLTRIRSSPGAFADLPRSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKVAEQAMKGLIVWLWPREAMPRSYFGLVRRLVDACPWVDVIKHSTCIEGARRALARTKVDWGRLDAERLLTDPPPAGKEYRTPKMYYKTVLKGARNIADECPRDVIIE
Ga0311022_12685877Ga0311022_126858771F027342MKKIAAGKAFYMQSKHVKVNYLLLTRIRSSPGAFADLPYSVSDAAQFYQDEEGSSTEKLFWSQYLRSEHPSPLSDQPKQLVELHKAAELAMKDLIVRLWPAEPMPSSYFRLVKRLVSACPRLDAIKRSVCIEGARMAFACAKMHWAKMDATKLMTEGPPVGKEHRKAEMYY
Ga0311022_12690801Ga0311022_126908011F053764MVNTKIRLIIFFAAKDGEALYSQQKQDQELTVAQIMNSLLPNSDLK
Ga0311022_12695417Ga0311022_126954172F029140MKDASKEILRFWNTQWEAYMKSMAAMQEQGEAMLEMIQKSGVLQEGSQKMVKEWADKYKAIQKTYLDMVEDHFEKLEEIISSGP
Ga0311022_12695636Ga0311022_126956362F052316MVKTRYTKLDPNHMARVGPVGSNGEEIPVSLVYDQVEVAAKYSQQDCKLDRLLDDIEEEV
Ga0311022_12698944Ga0311022_126989444F006925MANVKVEVLEDFGREAELRRKWMRMWEKLGERILKLPKWMKTIILEDVNTAIANRIASMEMIQNAHRNH
Ga0311022_12702610Ga0311022_127026101F032472PFSPVTIPLDAQFGTPYPRSAGFDTDIGAFIESSSVSSPLGLMASSIINHDAVQGETFLPGQIFVFGGFALRANSFGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDGFEPRPSVPHCPDGHDLTLPPDSAQSAAQVSAPIISSEPTALVGDGRLDATPGATISTVVDPNTSLVLCRARDSKVPDSVPDSESPAPLPIEPDWAPITEFTAADVFQHSPFGDILNSLKSLSLSGEPWPNYSQHGWDTDDDEI
Ga0311022_12704425Ga0311022_127044252F004815CSTCDALNRLPKELVDAPPLDALKARLDVALGSLVWWLATLHIAGAMIILVLFNPGHSVI
Ga0311022_12711529Ga0311022_127115292F031785GDFCAWVASRGTAAAFLKAGCEHGKIVNRPNFTLSPSILDDIPDLARSISNRFIKMIWTKGGREKAGDEARSHLEPVRNPSLYLPSPSYLIFTLDTWIHVG
Ga0311022_12718930Ga0311022_127189301F067310KSLMTQLNEVLGRVQAWKKSSAWYGADVALSLVRVHCKEARDTKLAALEVANTKKLQFQSFTKTFIDAATRIADGIDLDEFIEPASPPPDE
Ga0311022_12720499Ga0311022_127204991F059631TEPRDPEWAAAPEFRSGIPTGLTSWKETGLSWGNSEEVPGLQTSVQNLVDKKVKLVNVVQVMLFRRILPCQRRAFNLWEFDPAQHQTLSRLFDTTHEDAWKVLFKGAEVPPPITEDRGFSAKRQASAVSCFTFHMILIFYRLTPYGI
Ga0311022_12731956Ga0311022_127319561F020828MKGFIVRLWPGDALPNSYFDLVRRRVDACPRLEVIKRSVCIEGARRAFARVKVQWAKLDVVKLIKEGPPQGKEHRTPEIYYEGVLKGARLVADECPKDVIFE
Ga0311022_12734693Ga0311022_127346931F027342GAFADLSHSISDAAEFYRAEEGSSTDKLFWSQYIGAKHPMPLSDQLKQLVKLHKAAELAMKDFIVWLWPGEPLPSSYFGFVKRMVNACPRLEVVKWSVCIEGARRALARAKVHWGKMDAEKLVTEGPPKGKEHRHPEHYYDNVIKGARLVADECMKDVIFE
Ga0311022_12735315Ga0311022_127353152F020492LQAALLTSAALTAEVGALKQDLERSEQELGRAKKQLEDKEGE
Ga0311022_12748125Ga0311022_127481251F045728LTGRYMQLASAPRESSGQNERASMAVQAAPAPAGDSLLVSRFLPTRK
Ga0311022_12761879Ga0311022_127618791F006329MELELHVGNVVDDHKIKMEKMRLKIIKIRKYAIHSEAWYHYAVGSIVTLVAILIAFVVAFKFFS
Ga0311022_12768349Ga0311022_127683491F038084VIHTGKGFGIINEAEVDVFLESSSFFYDTMDVSNLIPGSSAFSKSPLHVWKFSVHILLKP
Ga0311022_12772695Ga0311022_127726952F096317VNKQVVLLAAVACTAEIAGLTQDLERAQGELGLTRRQLEESKGE
Ga0311022_12778128Ga0311022_127781281F081962IKLKAVYTLVEQLYTESQRALAVVALSNPSPHLLQDALKGLVVLPQRIQDLRRASSRAGAVAALSRAKAWLPELDPADLALGYPSLKEDGTTFDDHDFTVCVRAIRPVETLIGNDTDLSKYASAYDSENRRIPNTPYDQISLIPPIRKHTFAPEVDPASLIDDEAEFEALSGID
Ga0311022_12785879Ga0311022_127858791F007409MSEDKKAIAESKLSLSEEMNLGFLESIAKTNTEKITREILEGLSEDTGDSDSYDVESGGEDSEDRPWRPSHAVFGKSSIKQSHLANMRGRYFRDLSIVRADEGEKTCPTPEE
Ga0311022_12789083Ga0311022_127890831F083289YHAMFGWPAYAKFVAXPCYVYLQLKTPGRKGTITVHGNKKIAFEREEGDVAYAESVCATKELKFYKDNVDPADMTPLKKPTTEHDPLLKFKSADDTKQVDFVPGDSSKQFSISANMDPK
Ga0311022_12790753Ga0311022_127907532F003406MPKETITKTGEGELVRLKYSFKYGDKFDEPNDDWLKCIKDTSDELLGPYSKAEDNALSAAFRSQKKKRLNRVFDAIGFMYPDYRYPSKGQKRKSATSGKGDASAAPSEPAPKRKKVKVLTHRPRYIEPAEVPEFGGETSSATKAEESALTNRNEEPATMPKASPAKSGA
Ga0311022_12799681Ga0311022_127996812F100338MANELQKSHRYRVNISTSVKGVKTWDCTVEGENWDMADLLLESDRLVKQLEDRYPIKIEE
Ga0311022_12802714Ga0311022_128027141F076748PTPMRFIQLPGDSPPLYVSKSSFLQSDSSWFDWNDEEAVLFPNWESGIT
Ga0311022_12805209Ga0311022_128052091F020828SDQLKQLAELHKVDEQAMKGLIVRLWPREAMPGSYFGLVRRLVDACPWVEVVKHSACIEGARRALARAKVHWGRMDAEKLLTDAPPAGKEYRTPEMYYKSVLKGARMIAGEFSKDVYLSRLTFCYLFAENFVHMRLSNVS
Ga0311022_12812197Ga0311022_128121972F003406MKEWFYVKNDLKAREDIKEIIMRPIWSRFGLRKPKVEIDEAAEACQRAFSTVCAFIGTRDLVQEHVAYRIWPLIDSWEMPKETITNPSEGGLVRLKYIFRFGDQFIEPDDDWLKCIEATSDDMLGPYSKAEDNALSAAF
Ga0311022_12820401Ga0311022_128204012F096317MVIVYVNKLALLLTAAARTTKVARLKRDLGQAEEELGLVKRQLEENKGKQYPI
Ga0311022_12823787Ga0311022_128237871F076748MRFIQLPGDSTPLYEPKSSFLQSDSSWFDWNDEEAVLFPNWETGIT
Ga0311022_12824801Ga0311022_128248011F070092GMASDLAIERRKKELYDEVMIAKENAFKEELAELSGEIRKIEDSYREPKKDPTTKLLEFEQIKAKIRSTPSKELKELTHKFQNTGAIPGILWERPDHVDVLVAELRNRGLDEEADLTWDYAYNKLKVDRPWENNPLYKQLKSLHNKVSVLAGFKDMLKFLDGTNNAVYISETLKYKGG
Ga0311022_12826439Ga0311022_128264391F035626MAPPIINNDAVQGETFLPGQIFVFGGFALWANSLGHLEQIKSYAPGRQVRFESLNFTADIRGDFISDGFEPQPSAPRCHDGHDLALLPDSALEAAHESAPTLDSEPAMQIE
Ga0311022_12827801Ga0311022_128278013F064746CGCLDTAAEQKSVMIDGYTFTASLNDKWVNSSGDVSKYKPADLEDQFGIPDGAYDWTGFADYSAFDYRSGEPSGSITKAGWAHIFVLKPDEDLADSSSIDILKHAAYMIINPKDHRNAVIGGDLTEKEIEYNGRQAYYIEVEGELITLENYHTFINDNSLGAVAFFLDDNTVALIGVETTNDFGMSAWDVIDSITVS
Ga0311022_12830581Ga0311022_128305811F020492MRMKASLLASAALTAEVDTLKQSLEKSEQELGRAKKQLEEKEGKKYLG
Ga0311022_12831580Ga0311022_128315801F051243MDSGEGNGTPLQYSCQENPMDGGAWKAAVHGVAECRTRLSDFTFTFHFHALEKETATHSRVLAWRIPWMEEPGRLQSMGALRVRHD
Ga0311022_12832207Ga0311022_128322071F076748MRFIQLPGDSPPLYVSKSGFSQSDSSWFDWNEEEAVLFPNWETGVT
Ga0311022_12836160Ga0311022_128361601F004815DVALGSLGCWLVTLHIAGGWNWMSTVVPFNPGHSVIL
Ga0311022_12842407Ga0311022_128424071F096317VNKQAVLLAIAARTSEVIGLKRDLEQAKGELSLTKRQLEENKGE
Ga0311022_12846287Ga0311022_128462872F038084AKVDIFLELSCFFDDPANVGYLISGSSAFSKTSLNIRKFTIHILLKPGLENFEHYFTSV
Ga0311022_12851426Ga0311022_128514263F002002MVKNLPAILETWVRSLGWEDPLEEGMATHSRILAWRIPCTEEPGGLQSMGSQRVGHD
Ga0311022_12854149Ga0311022_128541491F011632QALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGDGRMVGLGDPVGLFQP
Ga0311022_12859433Ga0311022_128594331F081962LLQDVMKHLTVLPQRIQDIRRASARARAVAALSRAKAWLPELDPADLALGYPSRKEDGTVFDDHDFIACVKVIRPVATLIGDDTDLTKYSPGYDSENRRIPNIPYDEVSLIPPIRKHTFSPDVDPAGLIDDEAEFEALSGIYWASSTFQDKATDDEAEKDNPESSRPPKE
Ga0311022_12860274Ga0311022_128602742F067453MITRSLGISPGVPWGGPLPGGGYEGKTKRLDRAVQRFAEWLQARIAGPVQVRFNSHRLSGGAFVYPDADPDARITFDTPEIGLGARLITPASVQRRRDRAWNKGEGSSLPPLEWEDCWTETVPLSYNVLIYPQYLRAPNDLGEERPGSRFG
Ga0311022_12876710Ga0311022_128767101F034384LAVEFCQDFDEETGKVETGLDPIASPVCDETAMNVLRLESRVTGVTSYLARLKEAVSRVDSLLWPRATLQNDLESLMARLNEIPDRVQEWKKSSARCGADVALSLVRVHCKEAREDKLAAIKVANTQRNDFQSFMETFIAAATRIADGIDLDKFVEPASPPPAE
Ga0311022_12881200Ga0311022_128812003F004001SPSLEVFKNCVDVALRDMVSRHGGVGSAVGLDDLRGLFQA
Ga0311022_12890368Ga0311022_128903681F035108MSVGMMTGRPKEEMPRSAGDLLAELLQLHEQVQQVMRDIAQALWPSASLPGGMGEMIELLKGARQCFQLWKISACRQGAREAWAMVKTRYTKADPNHKTKVGPIGSDGKEIPVHLVYDQVALAAKYS
Ga0311022_12891453Ga0311022_128914531F035108VSVGVLTGRPAEEMPGSTGDLLPELLQLHEHVRQAMSGVVQALWPSVSLPEGLGGLAEKLQGVRQRFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPVGPDGKEIPVSLMYGQVELAAKYSQRDCKLDSLLDGIEEEYNQSV
Ga0311022_12918227Ga0311022_129182271F076748MPTPMRLIQLPSDSPQLYLSKSSILQSDSSWFDWIYEEAVLFPNRKLESPDLKVG
Ga0311022_12922957Ga0311022_129229573F004001ESPSLEVLKKHVDEALRDMAIGHGGDRPMVGLDDLSGLFQL
Ga0311022_12925296Ga0311022_129252961F076748MRFIQLPGDSPPLYVSKSSFFQSDSSWFDWNDEEAGLFPDWETG
Ga0311022_12941428Ga0311022_129414281F076748MRFIQLSGVSPPLYLSKSSFLQSDSSWFDWNDEEA
Ga0311022_12941803Ga0311022_129418031F098130MPGPHPRRRHVRDDVLLQRTHVRDWAPPGWHWEVLPSGARRLVRNPAPGPVVDPHLLWWHSRGPRSVRREPAPPEVVCRRVREEDEHVHRYMAAMDVRFSNTWQVLWGDHPSYDPVMVPS
Ga0311022_12944808Ga0311022_129448081F096761QALVDGMASQLRLQGASVPEVASSLACWNPVSLQHRVSELEATNAG
Ga0311022_12959085Ga0311022_129590851F079404LGIEPHFALWKRLFCLVPRSHEGSIYQVGRAEIWRIAGTGYLSGTPKKTSEDRPSEWFYMEDVPLLDPIRMGLPEFANAPLKKRHSWRPRSPQEEDNREILFLMDRIKTLAKSGLTIIEVMSICIMRGVQPLQYRGKPMWHFNGEDDATCCGLKGPDSPAALAKILSDLDKEEEEDFIHIKPRDGFSMYNPQVG
Ga0311022_12995119Ga0311022_129951191F004815APSLQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVVLFNPGHSRI
Ga0311022_12997660Ga0311022_129976601F041289RLIKPFFPANAWIVARYAGDDHIIEIDWKLDGEPGRPNRRSRKIQITITEGAIEDYLDRDRKERDVFETNLKKLIHERFSHIDASMPAERNSSASADKLLIGRETLNA
Ga0311022_13003192Ga0311022_130031921F032472QIFVFGGFALQANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDGFKPQPSAPHCHDGHDLALPPDRALEVAQVSAPTLSSEPTAPIEDGWLDTASGAAISTAIEPNTIPVLCKARDSKVPDSSPDSEPSAPLPIESDWAPIMEFTAADIFQHSPFGDILTSLNLSLWQESPGRTMVRKVGTRTT
Ga0311022_13007484Ga0311022_130074841F081962VALSNNVPTHLADVLRRLAVLPQRFQELRRASARAGAIAALSRAKAWLPELDPADIALGYPSLKEDGTPFDQKDFAACVKDIRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEAISLIPPTRKHTFAPEVDPAGLIDDEAEFEALSGIDWKSSTFQDRETAGGAERDELEASAQQHL
Ga0311022_13009906Ga0311022_130099063F096317TIVNKQAVLLVAAARTAEVADLKRDLEQAQRELDFTKRQLKENKGK
Ga0311022_13013357Ga0311022_130133571F011632KGGQALEWAAQRGGGVTDPGGVERTFGCCVEGHGLVRTIGDGRRVGLGDPVGLFQH
Ga0311022_13019624Ga0311022_130196242F051165MTTSLQKTLTVLASIASVLAGVVTIASYLSGEDVAMPSSLTTPSSESQPIIIHARAVFIDGNMTYAIDYDKNLIMLNESTIVL
Ga0311022_13029163Ga0311022_130291631F027437MTRQISTLEEKHSRDQAELVQRCSDFEGKYSQSQTELAQVFAALDDANALSSSLHAQLNSEKVTYETVLCLVVILLLA
Ga0311022_13029163Ga0311022_130291632F039980MFEGVDFCLQEEKRILAASRDSLDRLYRDSSNSLTILERSHRFTMEELDNQRCKLQESTDEVTQLKQLISAKDATIKELRASKKSIAQELETARLAAKVAEETSVTLRAQRDRAMDKAIRAGRILMRRPGVVVPEDIRADVNAAPDSSSRPSSSIAPEKDITK
Ga0311022_13035608Ga0311022_130356082F104139VDPSSTFSGQSGTLLAPELPWVGPAFLPGAQSLLQAVTRHFHCS
Ga0311022_13045919Ga0311022_130459191F029075ANFLAASTVDDGNKSDESASKCSEFGDSGSSVEWTEVSSDEDLDYFAALDVAAAEASPRAADAKVVPGPSTGRRRRRAVAKRRVSEVDGSRLRVDRAGKQELLSSPAVASVGEGELRCLFEGEELRIKLFNYREMGIIPKVEPM
Ga0311022_13071522Ga0311022_130715221F004815LQAFKARLDVALGSLGCWLATLHIAGGWNWMSTAVLFNPGHSRIP
Ga0311022_13077959Ga0311022_130779592F105113MKYIAAVFTTLLFLLLICSLPSHAVVSSTVFSNGGSIIINTDESWETSNNLMRFGTVNDSYEYGGKTQTIVSLGRTGIMKSDSTRVETLGMLIAFDSAGMFSTQTNIPESMCDQSNFIAGYGNQSSSRYPETQTVEGLWGLMGSGPGTTY
Ga0311022_13084027Ga0311022_130840271F012765INSLTILERSHRFTMEDLDNHRYKLQESLDDMIRLRQLVSSKYTIIKDLRASKKSVAQALETARLAVKAAEETSATLRAQRDKAMDKAICTGRILMRRPGVVVPDDIVADVNAAPDSSSRPSSSVAPEKNITK
Ga0311022_13093148Ga0311022_130931482F104681MTLQNIIDEIKGICNQHPVMQERIMALKDAGYDNINYVYRKRNHNGLYSTIHLPKKRLYRIQIGYTELQKGYSAAWCVDVSSIDVVNEVELPF
Ga0311022_13095860Ga0311022_130958601F105149MYQGGSSRKQAPRLAIREPDHEPPREAQVKPCEWPSDEFMVHAGFKDEFYAYVQNVGLEDFLSDKCLQYYYLTDSFVRRFEFSSKCNTHTVLFDLYDESYTMDLEDFCEACKIPQWGSLSEPHKSEYNDFLASITVGENRNITPASMGSIHFPAIHYLLSL
Ga0311022_13096558Ga0311022_130965581F041847MNEKKGMHFGKLVVDFANAPAAEESGVAFIRGAAKAFGYGPEFLAKALDRYPTLERFAKALPADDRELVDLLLEERRLLSVINNLPCNISLSSYDYDGGRTLLFKIQPLEPRWDCENPYEEDDVRISVGAEGKTWLDEVAEMFDDRAPLTEDMDEVKGRLLGCMEEYIRLGDRILAIRRAIPAEKTHEAQKWAAYHSRIEAEQEVLAELRERWRATLGDIVEAGDLSRSQALLEVLVVYNVVNRRELAVGEDGAIYEKPLFGESYFTERAGLADEYYHNVLVYALVEFLKVPGNRRKLRKCRQCGAFFISPPGRPAGTECGRC
Ga0311022_13097539Ga0311022_130975391F035626MASSIVNNTAQGETFLPGQIFVFGGFALRVNSLGHLEEIDSYAHGHQISFGNLNYMADIRGDLIFDGFEPLPCAPRGLDEYDLALPSDFEKSHRQLLRPSVRS
Ga0311022_13101363Ga0311022_131013631F004001MTPCLEAFKKQVDVALRDVVTGHGGGGLMVGLDDLR
Ga0311022_13103442Ga0311022_131034421F020828MHKAAKQAMKGLMVRLWPGDALPNSYFSLVRRLVDACPRLEVVERSVCIEGARRAFARVKVQWAKLDAVKLIKEGPPQGKEHRTPEIYYEGVLKGARLVADECSKDVIFE
Ga0311022_13126342Ga0311022_131263422F005658MAWVEKDHNDHXVSTPCYVQGRQPADQAAQSHIQPGLECL
Ga0311022_13127599Ga0311022_131275991F081962VVTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGSAFDQKDFAACVKAVRPVATLIGNDTDLTKYQPGYDAENQRIPTPPYEALHLIPPARQHTFAPEIDPAGLIDEEAQFKAPAASTGSHQPSKSWDQPE
Ga0311022_13135216Ga0311022_131352161F035626MAPSIVNNDAVQGETFLPRQNFVFGGFALRANSFDHLEQIESYTPGHQVRFGSLNYVADIRGDLMFAGFETAATTPGHSKRHGLNLSSDCIQETVPVTAPALDPE
Ga0311022_13139287Ga0311022_131392871F084191PADEQSKRDEYFRDIGLLKMDERRLRQKRNFELWCEGREKEMT
Ga0311022_13144063Ga0311022_131440631F004001MCETSLEVLKNHMDVALRDVVSGHGRDELVVGQGDLRGLFQP
Ga0311022_13144791Ga0311022_131447912F032289IGLVNGIGLFDQVYFATQNDSTTAYTVGDISDLHDVESGGEVSQMSYFDLAVTFSMAGINLLFKIIEAIVFIFPTLVNQFRIPLPLAAVLQSMIYLQVAWGYAQWRSNRSGRSTD
Ga0311022_13147117Ga0311022_131471172F035108MSVGLLTGRPAEEMPGSSGDLLPELLQLHERVRQAMQGVIQAMWPSLSVPEGLEELAKKLEGVRQRFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPIGPDGKEIPVSLAYGQVELAAKYSQQDCKLDRLLDGIEEEYAESD
Ga0311022_13147387Ga0311022_131473871F103196AGLRKDSFVLRIETAAGTDESRRTAGGWLCFESETDALFYLFHVWFRHIKTNFTALDDAMSDTVDLVEKAMGIAVREGGFGNEVLKDMIVRALGRLASVSLTAGGYLHGDQFDSEVVEDCSKHNGGHDELASLAASGALDVRNQKHLKMLEAWMAAR
Ga0311022_13148967Ga0311022_131489671F057477SSTALLALAVLCLTPGLIILSPDGRLFFLALAGLVSAVVAVAAPSGKKRLAAGLGLLLAVVMALQTWPEYRAHADAWKRHTSKSLEGRGKKGCGSPALKSLAAERAI
Ga0311022_13154908Ga0311022_131549081F028669MYARREIKKQRFKCWSDQFITNVNKGDEERRGRTLLRIGVMGKGRRAVEKIERSKNCVKW
Ga0311022_13157013Ga0311022_131570132F009131SDQWANHLEINVKELRASQRRCYDKSIVCVKKIKSSFANVGAFSSEENFSRGNPEGPMEWISNEAEAFEEILNSRGDICAFSGARGIATVLEKKGCEHVKSLAQSEATLSSEDIKDPSAEASMIGGKFFTDIWDNGGREMAQEIIQKSEKGIHDARKVAEAAEKSTEPEGQIGIN
Ga0311022_13163534Ga0311022_131635341F045728LKRHLTGRYMSLASVPRESSGQNERPLMAAQAAPAPAGASLLVSRFLPTRE
Ga0311022_13166576Ga0311022_131665761F002471DEVASLNAQLKTSKSEFDKLKFARDAYTIGRHPSIKDGLGFKKEAKHLTSHKALISAKEKGKAPMTNSAKKNHAFMYHDRRHSRNVYRSYDAFDSHAMIASSSSIMHDRNVARKNVVNHMPRRNIVHVPRKVMNEPSTIYYACNASFAICRKDKKVIARKLGAKCKGDKTCIWVPKTIVTNLVGPNMSWVPK
Ga0311022_13167513Ga0311022_131675131F027342FFMQSKHVKVNYLLLTRIRSSPGAFADLPHSVSDAAAFYRAEEGSSTKKVFWSQYAEAEHPVPLSDQLKQLVELHKVAEQAMKSLIVRLWPGEAMPGSYFGLVRRLVEACPRLEVIKRSVCIEGARRALARAKVHWGKLEAEKLVKDGPPPGKEHRKPENYYKDVLKG
Ga0311022_13172482Ga0311022_131724823F070092MAINDRLKPVAELLETNRQKIDLMISHGMASDLAIQKRKKELYDEVMAAKEKAFKDELADLEGEIRKIEDSYREPKKDPTTKLLEFEQIKAKIRSTPSKELKELTHKFQNTGAIPGIPWERPDHVDVLVAELRNRGLDEEADVTWDYAYNKLKVDRPWENNPLYKQLKSQHNKVSVLAGFKDMLKYLDGTNNAVYISETLKYKEE
Ga0311022_13178949Ga0311022_131789491F001813PGGVQGTFGRCVEGHGLVRTIGDGWMVGLGDPVGLFQPW
Ga0311022_13182755Ga0311022_131827552F035626VFGVFALRANSLGHLEQIESYAPSRQVRFGSLNYTADLRGDLIFDGSEPQPSVPHCPGGHDLALPPNSPLEAAPASALTLNSKPTPPIEDGRLDATSGAATP
Ga0311022_13185825Ga0311022_131858256F029455MPDRIIDLDLWEDGAANQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLKS
Ga0311022_13189661Ga0311022_131896611F076128MLVEIIVLLFFLVASLYLAYQFRSCGHQMGILQGSNASLSADLEKTREENIKLVAELQKTRVDLALTRGELEKTRAALNSCTDAINGGS
Ga0311022_13193212Ga0311022_131932121F032472PRSAGFDTDIGAFIESSSVSSLIGLMASSINNHAIQGETFLPGQIFVFGGFALRANPLGHLEKIENYAPGRQVRFGSLNYTADIRGDLIFYGFEPLSSAPHCHDEHDLTLPPNGALVAAPAPAPTLSSESTAPIEDGRLDATSGAAIQTTFEPNTSPVLCEAHDSKEPD
Ga0311022_13199130Ga0311022_131991301F035108PGSSGDLLPELSQLHEQVRQVMQGIAQALWPSASPPGDMGDLIEKLKGARRRFRLWKILACRQGAREAWAMVKTRYTKADPNHMAEVGPMGPDGKEIHVSLVYDQVELAAKYSQQGCRLDSLLDGIEEEFSQSK
Ga0311022_13200218Ga0311022_132002182F067310VALSLVRVHCKEVKEEKQAALKVANTKKLPFQSFMETFINAATRIADDIDLDSFVE
Ga0311022_13202098Ga0311022_132020981F035108MSVGMLTGCPEEEMPGSSGDLLQELSQLHEQVWQVMQGIAKALWPSASLPGSMGELVHLLKGVRWCFRLWKISACRQGAREAWAMVKTRYTKLDPNHMALVGPVGPDGNEIPVSLVYAQVGLAAKYSQQDCRLDSLLDGIEEEVC
Ga0311022_13204509Ga0311022_132045091F002471LGFKREAKNLTSHKAPIPAKEKGKAPMATSAKKNHAFLYHDRRQTRNAYRSYNAYDDFSHAMFASSSSYVHDKNVDRRNVVHNMPRRNVVNIPRKVNEPSTIYHALNASFAICRKDRKVIARKLGARCKGDKTCIWVPKNICANLVGPNMSWVPKSQA
Ga0311022_13205072Ga0311022_132050721F027342AKKIAAGKAFSMQSQYVKKKYFLLTRIRSSPGAFADLPRSISDAAEFFRAEEGSSTEKLFWSQYLAPKHPMPLSDQLKQLVELHRVAELAMKGVIVRMWPGEIMPSSYFGLIKQMVDACPWLEVIKRSICIEGARQAFARVKVHWGKLDAEKLVKDRPPEGKAHRHPELYYDGIMKGARLVADECTKDTVFE
Ga0311022_13217515Ga0311022_132175151F086390YFALFIGRCINGKDEACHMCVLDLCIPRSVVLGDKSYNLGAIVARRLHHNRFNGDFFGGIYATRLADFLGVTIRDDDIELPPTYLDFNAMVHHQVVERNEPPLQYRLIFDRHHAVNIVLPAPTLFDFQEKGRHYITREEAEEYKRRTEIARLQAAAHDAMTVAS
Ga0311022_13220104Ga0311022_132201041F032472FLPGQIFIFGGFALRANSLGHQEQIESYAPGRQVRFGSLNYTADIRGNLIFDGFEPLPSAPHCHDEHDLALPPNSALEAAPASAPTLNSEPTAPIEDGWLDATSGAAIPMTIEPITSPALRETRDSKEPDSSPDSETSAPLLIVSDWAPIMEFTATDIFQHSPFGDIMKSLKSLSLSREPCPDHGQQDWDAEDEEIRRPP
Ga0311022_13221509Ga0311022_132215091F031785ASSEKFTPSAEDLPKTFEHIEGEIDELDEVIAGHGDFCAWVASRGTAAAFMKAGCDHGKIVNRPNFTLSPSILDDIPDLARSISNRFVKMIWTKGGREKAGDEARSHLDPVRNHTLCLPFSVNLILTSNNLIRVE
Ga0311022_13231428Ga0311022_132314281F004001SPSLEVFKSRVDVALRDVSHGHGEGGLMVGVGDLSGLFHP
Ga0311022_13241013Ga0311022_132410131F035626MASPNFNNSVQGESFLPGHIFVFSGFALRANSLGHLEQIDNYAPGHQVRFGSLNYTADIRGDLIFDGFEPQPSTPHCHDGHDLALLPDNAQSIAQVSAPTISLEP
Ga0311022_13253713Ga0311022_132537131F079778LSCSILSSLLLQGLILSNAVRAQKNIKDEGYTMALSNLRAEVIELRNEGLEKDGILISLVNKVKEDKANYNAQAEARKTEIEDLRRQLAEAKEKCALAEANQEISEYWKNHLEKIVEELRTSKERCFEKSLDCVKKIKASFAKVGAYSAEENFIRGDPEGVVEWISGEAETFEEILSDCGDVCAFSGAWGISAILEKAGCDHIKAVAQAEAAFSVDDMKDPSAEATLMGGNFYNDVWVNGGREMAHKIIKKSEKDTHDARAEAKRAEEAAERERRIGI
Ga0311022_13261229Ga0311022_132612291F038003VTHVPAPTAQAVPDVTSSPLGDQKVPTDSHPTSFGFSLNPPSDLALADAFIEASPNPLGFRMRSPWDRLTDISPYGPSGSEGDDEPNICWDFSGLGNPSAMRDFMTACDYCLSDCSNGSRSFGDEDCGPSRECFHIDLGGPSEGHHRGTPENGDPPRPAPRGDILRELAVVPVPAGGRTHTSSKSARGRPGSTREQKRLCRSAG
Ga0311022_13273420Ga0311022_132734201F092835SFPRLTNPVARLFFGHQHSRFWAILTRFVDNYSSVLGPKAFSVVVEPQGALTCRSSTLTDLADFGPFRGVLRSRSDFHD
Ga0311022_13279759Ga0311022_132797591F093490MKTLITIFLVLLGLATTVFASPFLVSDPQSGVTSYQLTGWSETNVVAQADGSLRMDVGSAVQGTTYNLTIAACNVWGCSVTVPFAFGKQLPNAPSQLRLVGQ
Ga0311022_13280626Ga0311022_132806261F073228MLTIGDIMKVENSKYGEFLYRIVMVFPHNLEVDKTELARLIKINNNTLTFERKNGEKFTMDERDIEH
Ga0311022_13284144Ga0311022_132841441F086390VARRLHHNRFNGDFFGGIYATRIANFLGVTIHDHDIELPPTYLDFNAMVHHQFVERNEPPLQYRLIFDRRHAVNIVLPAPALFDFQAKGRHFITREEANEYERRTRAARLHAAAHDAIAAASQYDANYNYGYPPGHPWQ
Ga0311022_13290374Ga0311022_132903742F034384VEPGLDPANSLVKDEAAMNVLRLESRVTSVVDYLARLKVAMSRIDTSLWPGTTLQNDLESLMVRLNEVPGRVAEWKKSSARCGADVALSLVRVHCKEAREEKLAAIQVANTRKHSFQDFMETFIAAATRIADGIDLDEFVAPSSPPLEE
Ga0311022_13290552Ga0311022_132905522F006329KEKIRKIEEEKMILELHVADVVDGHKIKMDAMWLTIRKIRKYAIHTKAWYHYAVGSIVTLVVIMIAFVFALKCST
Ga0311022_13297582Ga0311022_132975822F002002MTSLVAQTVKRLPTMWETRVRSLGQEDPLEKEMGTHSSILVWKIPWTERPGWLLSMGSQRVGHD
Ga0311022_13297631Ga0311022_132976312F067893MHPVYPRYTMAERLVLAVVAVVTWPIERFLGWVRR
Ga0311022_13300445Ga0311022_133004451F083289RKIALECEEGDAAYAESVCATEELKFYKDNVDPVDMTSLKKPTTEHDSDLEFKSAAETKLVDFVPGDSSKKFTVSANLDPK
Ga0311022_13300637Ga0311022_133006372F038084VVWYSHLFKHFPQFVVIYTVKGFGIVNKAMVNVFMELSCFFNNPMYVGNLISGSTAFSKSSLNILKFTVHVLVEAWLGENFEHYFASM
Ga0311022_13307076Ga0311022_133070761F004001LEVFKKCGDVALRDVVSGDGLVVGLDHLSGLFQPL
Ga0311022_13318057Ga0311022_133180572F007409LRFERHVFVISEEKMSQDKKVIAETKLTEEEKLFEQKKAVNPYIAGFLESMAKSNTEKITKEILKGLSEDTGDSDSYDAESGGEDSEDRPLKPSHSIFGKSTIKQNHLESMRGRYFRDMSIVRAGGDNNVPAP
Ga0311022_13318402Ga0311022_133184022F038084IVNKEEVDVFLELSCFFDDPVDIGNLISGSSAFSKSSLNIWKFMDHILLKPGLKNF
Ga0311022_13324118Ga0311022_133241181F068298MILLXKGGQALERAAQGAGGVANPGGVQGTFGRCVEGRGLVRTIGDG
Ga0311022_13324517Ga0311022_133245171F009131NVEELRASKKRCYEKSIECVKKVRTSFASVGAFSSEENFIRGDPEGPIEWISHEAEAFEEILNSRGDICAFSGARGIATILERKGCDHVKLLAQSEAALSSEDIKAPSAEASLVGGKFFTDIWDNGGQEMAQEIIRKSEKGIHDARKVAEAAEKSAEPEVQIGIDYWFLTLL
Ga0311022_13334632Ga0311022_133346321F015450LEKKNFELQATEGLLTEAEAKITELNTTLLRQSEQFEQEKQDLNAKLKAEAQKNSDLRKLLASLQENCLEFSNRCIHRLKKIFYSVGASSGKFTPSAEDLPKTFEHIEGEIDELDEVIAGHGDFCAWVASRGTAAAFLKAGCDHGKIVNRPNFTLSPSILDDIPDLARSISNRFVKMIWTKGGREKAGNEARSHLDPVRNHTLCLPFLVNLILTYNDLIHVG
Ga0311022_13336142Ga0311022_133361422F020492MHMQASLLASTALTTEVDTLKQNLARSENELGHAKRQLEEKEGK
Ga0311022_13336203Ga0311022_133362032F020828MPGSYFGLVRQLVDACPWVEVIKHSACIEGARRVLARAKVQWGKMDAQKLVTDPPPEGKEHHTPEMYYKGVLKGARTIAGECYKDVIFE
Ga0311022_13337365Ga0311022_133373651F059631GGQQAECEGAMVGKMPNITCLEGSFADMVKGWQSGWFYITEPHDANWVAAPEFRSEIPMRLTSWKERGLTWGPSDELTGLQTCVQNKMDRKIKLVNMVQVMLIRRILPCQRRAFDMWEFDPAEHQMLLELFDTTHKEIWKMLFKTGKVPPPLSEDRGLSAKRLASSVSPLTIYKMFLSQYICGRVF
Ga0311022_13351245Ga0311022_133512451F001813MRPNQHSTFVQGTFGRCVEGHGLMRTVGDGWMVGLGDPVGLFQSW
Ga0311022_13352733Ga0311022_133527332F003963MSTNLNSPVSSSRALSGEGWAAIAGAVGSAFLLVKRLLSPRPPRPEPMSRADFYAEMLDIRERLHAGHLATLEKLDVNHRELLAALERLSARVNVLEAGGARLDERTANRHAALR
Ga0311022_13370322Ga0311022_133703221F075047MKKHCIFLMACLAMTWGCASVVYVSQETGKGQLMSAADEVPLQPSALFVTAHDHSMPDVSHDGRWVAFKRVVGGGDRIIVRQVGDAAGTTERDIAQGTRPRWSPSGSWVLFSNQGKIYQVRPDGTSLMQLTTPPANVTDNYGHDYFNATPVVFGRGTGTGAGQFVGLYLVDIASAAVTGPVLGCGQPVVSHDGSRLACEIKYYFGWGIMHYIQIYTVPSLQAAGSIAFIYGPNQTPVQNAGGFAFSAEDERLVFS
Ga0311022_13371549Ga0311022_133715491F001813GGGVTDPGVQGMFGCCIEGHGLRRTIADGWMVGLADLVGLFQPR
Ga0311022_13374643Ga0311022_133746431F035626MASSLVNRDAVRDETFLPGQIFVFGGFALRADSFGHLEQIESYAPGHQVRFGSLNYMADIRGDLIFDGFKPRPSVPHCLDGHDLALPPDSAQSAAQESAPTISSKPTT
Ga0311022_13376450Ga0311022_133764501F020492MGLQAALLTSAALTAEVDVLKKDLERSEQELGRAKKQLEEKEGE
Ga0311022_13378840Ga0311022_133788401F011632MGCPERGGGIKERGGVQRAFGYCVEGHGLVRTIDEGRMVGLDDPVGLFQP
Ga0311022_13383534Ga0311022_133835341F086390MCVPDLNVLRSAVLGDKHYNLGAIVAGRLHNNSLNGDLFGGIYATHLANYLEIPIRDYDMELPPAYLDFNAMVRHQFVERNEPLLQYRLIFDGRHVVNIVLPAPTLFDFQAKGRYVITREEENEYERRTRAARLQAAPRQAVATASQYEPSYNFGYPPGQTRP
Ga0311022_13383716Ga0311022_133837162F103019LTPPPAGGLSTAIVAVARRWKEHHVVAAVEGHELKTPETEHRPGLERLLETAHLELDGKLFVSTQ
Ga0311022_13387430Ga0311022_1338743013F037787LKVYSDDPALPYKTTKLKALYTKSEIDGLFAKWGIKDVYWHWNPDHNDVFVQFKIVVEIDGVPLQISAKVEAPAIWNHEKRSMEESVNWNISMRVMFWFIKSLLEAAYLLQSSKTAAFLPYIASKDGEKTLKDVLIPRINELHRLDALESKVLKKEGKVIDIEEG
Ga0311022_13389821Ga0311022_133898212F092835MRLSFGHQHSRFWTILTRFVDYYSLFWEPKAISIVVEPQGALTCRSSTLTVLSDSDPFRGLLLTILGTRSDF
Ga0311022_13396461Ga0311022_133964611F002471KSNSCVEHVMICNRCKDFNVDACSEHLVCISKLNDQVASLNAQLKTSKSEFDKLKFARDAYTIGRHSSIKDGLGFKREAKNLTSHKAPIPIKEKGKAPMTNSAQKNHAFIYDRKCSRNDHHDRSCNAYDSNAMFASSSSSVYGRDMPRRNVVHVPRKASNEPSTIYHACNASFTIHRKNKKVIAKKLGAKXKGDK
Ga0311022_13401876Ga0311022_134018762F074913TFGGMWRWRRVAVARVFALVVRCRVMRLLVYFRVGKNRDTRRESPAGAGAGRGAKHKTASFVAQLSRHGEPMTYTDLLGAVLLFKLNL
Ga0311022_13410262Ga0311022_134102621F076577AINYELNNGKKRREQWKNFKENAIDKRLKYVNPDRRCGHPVNLDTLDYCWGYADKIDKGEEINMNELCEGCEFFKKEVKNENPTQ
Ga0311022_13410262Ga0311022_134102622F071725MKTLLNKPESEYLNLGSLDQELSWVLKIYSSGKINDLIYDGLLLYAHDEEIKAIREKLEKKEINEVGLFHELEKLSKVESLPG
Ga0311022_13418260Ga0311022_134182603F102171MSTIEKKIESVQEYNLLKLLKAISSSNPLTSYWIQLNHELCRAFATNAYAIIVADLEPNWWHDIFDGLPDFVFIDKLKRNEVHFIDGVKFDRVKYS
Ga0311022_13444543Ga0311022_134445431F043815MKTLVVSNRTKWPTDWKTEWFYVKIDEKKEKLVQSPLKLTFGLTRPQCNMTPGAPCPDAVYEFRVVAEHIGTRDLVQEYLANRVFPTLRELGMPKLEGKKKKNELVRLPYHFKFKKHFKEPCQEWLDTIEVMCNEILGNYTRKEDQLMTAAFGTRPKRRLNRVMD
Ga0311022_13447636Ga0311022_134476362F038084VVWYSHILKNFPQFIVIHTVKGFGLINKAEVKVFLELSCLFNYQVDVGNLISGSSAFSKSSLNTRKFIVYLLLKPGLENFEHDFASM
Ga0311022_13452823Ga0311022_134528232F004001SLEVFTNHVDVALRDMVSGHGGDRLMVGLGDLRELFQYS
Ga0311022_13458273Ga0311022_134582731F093003DPVEHERFKRRLMAMTNSLKKKQQQLRADQDLLADRWTEVLAAEEHELERPSKSYPKCKLLPRLEEEVYEPTSPGDNTADRPPRGRDREASRPFTRPVPRHRLKSTMPQGNAPDLRDLLEYKARQSRSIYGSRGRPMIRDDNRRVGHSKSGRAEQNRQSSFELRRDIAQYRGAAHPLRFTDEVMDHQIPEGFKPVNIESYDVTTDPAVWIEDYLLHIHMARGDDLHA
Ga0311022_13470404Ga0311022_134704041F001813GVADPGGVQGTFGHCVEGYGLMRTIGDGWMVGLGDPVGHFQPW
Ga0311022_13470707Ga0311022_134707071F069772MTEWFYVKNDLTTQEDVKSIIMRPIWQRFGLRRPKVKMDEAAEECQRAFGVVCSFIGTRDLIQEHIAFRVWPLAGKWEMPKETIKESDEGGLVRLKYTFKYGDKFVEPDDDWLKNIETLSDELLGAYSKAENTALSAAFGGRKKKRLNRVFDAVGFVYPDYHYPILGRKRKNTSLATEATTSATSEPAPQRKKMKVLTHRARFIEPATVPEFIGEVSLASEAIEPAPVPKIEEKSEAPSAEKAEKPRIEGQEILEILSPSANVETRKIQKGPLVTPKRKRM
Ga0311022_13477963Ga0311022_134779631F071823LVKNLPAVQETQVQSLGQKDPLEKGMATHSDILAWRIP
Ga0311022_13480206Ga0311022_134802061F004001LEVFKKRVDVALRDMACGHGRGGTVVGLDDLRGLLQPY
Ga0311022_13482272Ga0311022_134822721F031785SRGTAAAFLKAGCDHGKIVNRPNFTLSPSILDDIPDLARSISNRFVKMIWTKGGREKAGDEARSHLEPVRNHTLCLPLPSSSILTYNNLIHVG
Ga0311022_13486480Ga0311022_134864801F020492MQAALLTSAALTAEVDALKQSLARSENERGHAKKQLKDKEGR
Ga0311022_13490709Ga0311022_134907091F032472SSPIGSMASSIINDDAVQGETFLPGQIFVFGGFALRANSLGQLEQIEGYAPGRQVRFGSLNFTANIRGDLILDGFEPQPSVPHCHDEHDLALRPDSTLEAALEPAPIFNSEPAAQIGDGWLDTASGAATSTAIEPNTNLVPHKARDSEVSDSLPDSGPPAPPPIESDWAPIMEFTAADIFQRSPFGDILSSLKYLSLSGEAWPDCGQ
Ga0311022_13496002Ga0311022_134960021F032472MASSIDNDAVLGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGRQVRFGSLNFTADIRGDLIFDGSEPQPSVPRCHDGHDLTLPPDSTLEAAHESALTHSPEPIARIEDEWLDTASGAATSTAMEPNTYLVPHKAHDSEVPDSLPDSEPPAPLPVESDWAPIMEFTTADIFQHSPFGDILNSLNHLSLSGKPWPNYGQDGWDADDEEIQSPPTTHFVATVDDLTYVLDYDSEDIDGMDDDAGDYQEPVP
Ga0311022_13503649Ga0311022_135036491F052316MVKTRYTKADPDHMAEVGPVGPDGKEIPVSLVYDQVELAAKYSQQDCKLDSLLDGI
Ga0311022_13504900Ga0311022_135049001F032472YYLHREGPDLGKHRVPRLLLPSILDAQFGTPYLRSAGFDTDIGAFIESSSVSSLLGPMAPPIINSDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGRQDRFGSLNYTADIHGDLIFDRFEPLPSAPHCHDEHDLALPPNSALEAALASVPTLNSEPTSPIEDGWLDTASGAAIPTAIEPNTIPALCEPRDSKDPDSSPDSEPSTPLPIESDWASIMEFTAADIFQHSPFGDILKTPKSLSLLGEPWPDNGQQGWDSDDEE
Ga0311022_13508900Ga0311022_135089004F097614MFGVLSRKTIVTLAVLIPVLLGGCAPSQRVYTEGVLAADYRLMSKPELIRHLDRLENELARVHAGGAGPGGVPRDVYLGDLRQRMKDVQHEIGLRNIWERKSYWERREMWGPTR
Ga0311022_13516217Ga0311022_135162171F001813EPGGVQRAFGCCVEGHGLVRTIGDGRMVGLGDPVGLLQP
Ga0311022_13520983Ga0311022_135209831F020828MKDLIVWLWPAEPVPGSYFGLVNRLVSACPWLEVVKRSVCIEGARMAFARVKTHWAKMDAQKLMTEGPPKGKEHRHPEKYYDSVLKGSRLVAEQCAKDVIFP
Ga0311022_13522010Ga0311022_135220101F020828GLIVRMWPGEPLSGSYFGLVRQLVDACPWLEVITRSICIEGARRAFARAKVHWAKLDAVKLVKEGPPEGKEHRCPENYYESVLKGSRLVADECAKDVIFE
Ga0311022_13532910Ga0311022_135329101F003406KAEIDDAAEACQRAFNTVCSFICTRDLVQEHIAFRVWPLVEGWEMPKETIPNSSEGGVVRLKYIFRFGDKFDEPNDDWLKYIEATSDELLGAYSKKEDNALSAAFGGRNKKRLNRVFDAIGFVYPDYCYPLRGQGVKRKIAAAGKVAALSITAEPKRKKMKVLTHR
Ga0311022_13534680Ga0311022_135346801F020492MGMQAALLTSATLTAEVNALKESLEQSESELGRSKKQLKEK
Ga0311022_13535482Ga0311022_135354822F004001SLEVFKNHGDVALRDMGAYWHSGDGLMVERGDLSGLFQPY
Ga0311022_13541400Ga0311022_135414001F035626MAPPIIASDAIQGETFLPGQILIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYVADIRGDLIFDGFDIAVPAPCHFDEHDLNLSSDHIQEIAPVTALALDME
Ga0311022_13544110Ga0311022_135441101F039981VFNDTDEDDFLYCLPDNKEISVCPEMAKSMGFQKLEVDLFAMSKDDLADSLAYNSLKVHK
Ga0311022_13569289Ga0311022_135692891F020828QMVELHKAADRAMKSFIVRLWPGDALPNSFFGLVRRLVDACPRLEVVKRSVCIEGARRAFARVKLQWVKLDAVKLIKEGPPEGKEHRHPEMYYEGVLPGARLIADECSKDVIFE
Ga0311022_13571273Ga0311022_135712732F086390TQATIGSIHFPAIHYFALFIGRCINAKDEACHMCVTDLCILRSPMLGDQSYHMGAIVAHRLHHNRYNGDFFGGIYATRLAKFPEIDVREGDMELPPTYLDFDSMVSHHFVERNELPLQYQLIFDRRRAVCITLPAPAFFDYQARGGYTITREEVDENIS
Ga0311022_13574031Ga0311022_135740312F007510AVHEVMKIQTRLSDFPFTFHFHALEKEMTTHFSVLAWRIPGTGEPGGLPSMGCTKSDMTEAT
Ga0311022_13576306Ga0311022_135763061F105149MSRRMYQGGSSTKKGPRRAMREQDDEPPRDAEVRACEWPSDEFVVNAGFKDEFDAYVRNADLEDFLQDKCPQYYQLTDSFVRRFKYKCSRNSQSVLFDIYDKSYTMDLEDFTTACKLPQWGNVNDPHRSEYKDYLASITVGESRDIAQATIGSIHFPAIHYFALFI
Ga0311022_13579822Ga0311022_135798221F076748KWYNFIIPTHMRFIQLPGDSPIFYVSKSSFLHSDSSWFDWNDEEAVLFPNWETGIS
Ga0311022_13579822Ga0311022_135798222F076748MRFIQLPGDSPPLYVSKSSFLQGDSSWFDWNDEEAVLFPNWE
Ga0311022_13580342Ga0311022_135803422F103516MRTALILFLAALLAGCGAATNVQVMKPVNGEIQSFLTPELQKSRCYNFMSAGREGEMIARKSNVLLNECNLSAKDAVNRVIYLTYTTKDVYVAESGENQVISKRVMGNKDIEIESRLFYEKEGGVRGIQVLINDFVDKNYVKGYEPGWVVRALYREVKLQDGKIVVVRDGMTRDEFMKEDEIEHYKKLNRMLK
Ga0311022_13585448Ga0311022_135854481F011632ALEWAAQRGGGVTDPGGVQSAFGCCVKGHGLAVTIGEGRMVGLDDPVGLFQP
Ga0311022_13591364Ga0311022_135913641F083289VHGCRKIALECEEGDAAYVESVCATEEVKFYKDNVDPADMTSLKKPTTEHEPVLKFKSADDTKAVDFVPGDSSKQFIISANLDPK
Ga0311022_13593040Ga0311022_135930401F052316NQMAEVGHVGPDEKEIPVSLVYGQVELAAKYSQQDCMLDRLLDGIEEEFSQST
Ga0311022_13600242Ga0311022_136002421F068298GGGVTDPGGVQGTFGCCAEGHGLARTIGEGQTNGWTG
Ga0311022_13603147Ga0311022_136031472F035108MLTGSPEEEMPVSAGDLLQDLSQLHERAWQVMQGIAQALWPSSLLPNGMAELVNMLQGARRRFRLWKVSACRQGAREAWAMVKMRYTKLDPNHMAEVGPAGPDGQEIPVSLVYDQVALAAKYSQQDFKLDSLLDGIEEEYSQSK
Ga0311022_13605919Ga0311022_136059191F099347MNLGDFIENFEAFITYIEEAWEQKDLEILKAIVSDCEDFINAHGYQFKCYSMDSKSWKELYKKNREKRKKIADGMCEFCGRNKGVHCHHLIKRGKLNLYNDIRLLRMLCADCHQLFH
Ga0311022_13629695Ga0311022_136296951F093911MRLYDAYKNSEITRTEYLAYLDFGYKPNDSVFLTQNRSTEMVTISYLSMGSNYNWSIDDGESMMAYVGPINDLSNAGSLNNAGSILFLYKDGKIV
Ga0311022_13632071Ga0311022_136320711F081962VLTKLKAVYTLVEQLYTGSQRALAVVALSNEVPTHLAEVLHRLAVLPQRVQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQKDFAACVKIVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEAISLVPPTRKHTFAPEIDPAGLIDEEA
Ga0311022_13634641Ga0311022_136346412F068298VIPEALQWAAQRGGGVTDPAGVQRAFGCCVKGHGLAGTID
Ga0311022_13640737Ga0311022_136407371F076748RFIKLPVDSPPFYVSKSRFLQSDSSWFDWNDEEAVLFPNWETGIT
Ga0311022_13643072Ga0311022_136430722F027437MTRQISTLEEKHSRDQAELVQRCSDFEEKYSQSQIELAQVSAALDDANALSSSLHAQLNSEKVTYETVPCLVVLLLLA
Ga0311022_13645250Ga0311022_136452502F034384VVLPRSCFLCLKVNLYARQTFPIVVFPFDHPLDLVIILAEFCQNFEEETSRLEPNLDPVNSPVNDEVAMDVFRLESRVAAVVDYLARLKAATSRIDSTLWPEETLQSDLESLMARLNTIPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKK
Ga0311022_13646870Ga0311022_136468706F055476MKFRKYVEKLVGTVGELTADDVTYVFTVRPGAEPKSPAKLVKVDEDFVIFEVKFRRLKVHRVIPLAVFSLCLSEE
Ga0311022_13647148Ga0311022_136471481F038084VVWYSHLFQNFPQFIVIHTVRGFCIVNKAEIDVFLELSCFFDDPEDVGNLISGSSAFSKNSLNIRKLMVHVLLNPGLENFELYFASM
Ga0311022_13647679Ga0311022_136476791F096317VLNVNKQAVLLAVAARTAEIAGMTQDLEHAQGELGLARRQLEE
Ga0311022_13648991Ga0311022_136489911F001813GGVQRAFGCCVEGHGLARTIGEGRMVGLGDPVGLFQP
Ga0311022_13650196Ga0311022_136501961F096317VNKLALLLAAAARTAEVSKLKQDLRWAEEELGLVKRQLKENKGK
Ga0311022_13650779Ga0311022_136507791F094706VGLSHGGFKFLKGNCEGIKGNTMGRMTKSRRGKLYIDDAGWGPEAGSIEYGYRVPFGGIHVFIGKIGELGPEPDICTDIIETAQRARPARAQHAMKRAFVGFIHGSEFEEGSMSGGEMAICSDVELSSGKTISLYQLQDGVLGGCSDGSNIPDLS
Ga0311022_13650800Ga0311022_136508003F058971MTPNLLMTLDIEPITLMWNGQAISLPGTYELVPDNEIKHLHKRVVAVALHERKRIPFCGRLVGKARHGNGKGSVWLIEDDRGHLIKAQKPMTIE
Ga0311022_13652186Ga0311022_136521861F001813GVQGMFGRHVEGHGLMRTTGDGWMVGLSDPVGLFQPR
Ga0311022_13653017Ga0311022_136530171F081962TLVEQLYTGSQRAFAVVALSNEVPTHRADVLRRLPVLPQRFQELRRASARAGAIAALNRTKAFLPELDPAEIALGYPSLKEDGTPFDQKDFADCVKSVRPVATLIGNDTDLTKYQPGYDSENQRIPTPRYEAISLIPPTRKHTFAPEVDSAG
Ga0311022_13661273Ga0311022_136612731F079404IEDVPLPDPIRDGLPEFNSAPLKKCMSWRARSSQRESDRDVLYLMGRIRLLAHSGLTMIGVMAACIMRGVQPLQYRGHPMWDFNGEDDATRYGRKGPGSVADLIKILSALYKGEEEEFLRVNPQGRFSMYNPPSWVSGDFLSPIHVVFP
Ga0311022_13662168Ga0311022_136621681F094706MTKSRRGKLYIDNAGWGPEADSIEYGYQVPFGGIHVFIGKIDEPVPKPDICTDIIETAQRARPARVQPTVKCCFMGFIHGAEFEEGYVSGGETEIYSDGESSTGETTSLYQLQDGKLEGCSDGDSIPDPYEPPHRFTIFMAGTQPVQNSSTAAAMVSGSAAATAAGAGGPVR
Ga0311022_13664856Ga0311022_136648561F009131NKSMECVKKMKASFASVGAFSSEENFTRGNPEDPIEWINHEAEAFEEILISRGDICAFSGARGIATILEKKGCEHVKILAQSEATLSFEDAKDPSAEASMVGGKFFTDVWDNGGREMAREIIRKSEKGIHDAREVAEAAEKSAEPEGQIGIY
Ga0311022_13667288Ga0311022_136672881F102692LKAQRDKAMDEAIRAGRILMRRPGVVVPDDIVADFKATPDALSRPSSSIAPAKDIAK
Ga0311022_13669232Ga0311022_136692322F020828LVELHKAAKQARKGLIVRMWPGEPQSGSYFGLVRRLVEACPRLEVIKRSACIEGACRAFAWAKVHWAKLDAVKLVKEGPPEGKEHRHPEMYYESVLKGSRLVADECARNVIFE
Ga0311022_13671748Ga0311022_136717481F059631FYITEPRDPKWVASPEFRTGFPTWLTSWQEKGLSWGSSGELTGLQTCIHNMVNKKLKLVNVVQVMLICRILPCQQRAFNLWEFDPAQHRTLNRLFDTTHEDAWKVLFKGAEVPPPTTEDRGFCAKRQASTVSYFTSYRILVFHSLTLCGILSSRSFDRTCRRSPDSSTVRLLCPKAQQ
Ga0311022_13677287Ga0311022_136772871F072892MNINLLKTIVTRLFGLYSQFKSIVSDLETNNTLDNREWAGELLNNLATELYYEANCLTDVLYPPRKEEKDETMFKIDGIIDAERNPMSEDEFCELFLKWAEENK
Ga0311022_13678244Ga0311022_136782441F010678SSEKIEAPAPEASTKDIDYIIRHASRKDLSQEEMLEARHYAQKLKYPKGALVFNGSGKEDFLYRLPDNKKISVCREIGKSIGFPKVEDGLSILSKDELADSLTYNSIKV
Ga0311022_13679230Ga0311022_136792301F002471SIKDGLGFKREVKNLTSHKASISAKEKGKAPMASSVQKNHAFMYHDRRHSRNAFRSYDAFDSHAMTASSSHVVHDRNVARRNIVHVPRKIINELSTIFHTCNASFAICRKNKKVIARKLGARCKGDKTCIWVPKTIVTNLVGPNKSWVPKTQA
Ga0311022_13684863Ga0311022_136848631F027342IWRSPGAFADLPRSVSNATAFYRAEEGSSTEKVFWSQYVEAGHPVPLSDQLKQLVELHKVAEQAMKVFIVRLWPGGALAGSYFGLVRRLVEACARLEVLKRSVCIEGARFALARVKVHWGKLDGEKLVRNGPPPGKEHRKPENYYKDVLAGACLVADECTKDL
Ga0311022_13686792Ga0311022_136867921F067310VQEWKKSSARCGADVALLLVRVHCREAREEKLVVIKVANTKRHDFQSFMENFIAAATRIADGIDLDEFIEPASHPPAE
Ga0311022_13688131Ga0311022_136881312F079404LKKRLSWRPRNPQREADRDVLYLMSRIRLLAHSGLTMIKVMAICITRGVQPLQYRGHPMWDFNGEDDATRCDRKGPDSAASLTRILSALYKGEEEEFLRVNPEGRFSMYNPPSWVSKHFHLPIHLRNSRS
Ga0311022_13689128Ga0311022_136891281F035108SAGVLTGRPAGEMPSSTGDLLPELSQLHEQVWQVMHGVAQALWPSVSIPKGLGELAEKLKGARRRFRLWKISACCQGAREAWALVKPRYTKADPNHMGEVGPVGPDGKEIPVNLVYGQVELAAKYSQQDCRLDSLLDGIEDEFNQSN
Ga0311022_13690024Ga0311022_136900242F039980LQEEKRILAASRDNLDRLYRDSSSSLSILERSHRFTMEELDNQRCRLQESADEVTRLKQLISAKDATIKELRASKKSIAQELETARLAAKVAEETSVTLKAQRDKAMDKAIRAGRILMRRPGVVVPEDIRADVNAAPDSSSRPSSSVAPEKDIAK
Ga0311022_13692275Ga0311022_136922751F009131IKEDKDIFRGQAAAQKREIEDLRKQLASAKEECILEETRRELSDQWANHLEETVKELRSSKKKCYDKSMECVKKIKASFASVGAFSSEENFKRGNPEDPIEWINHEAEAFEELLNRRGDICAFSGARGIATILEGKGCEHVKILSQSEATLSVEDVKDPSAEASMVGGKIFTDIWDNGGREMAREIIQKSEKGIHEARKVAEAAEKNIEREGQIGIN
Ga0311022_13692842Ga0311022_136928421F042955MNRFVRTLPVVGAASVLAWLWYTAWPELFRDGMPSIARDAEFALMVRLSGFVVILAIAFYFAVRNLTRK
Ga0311022_13698229Ga0311022_136982293F033854MAAEGQADKMVSDMEGRMKQRCVTEFLCMEKMALTDIHXYLLGVCGDQTVDVS
Ga0311022_13700909Ga0311022_137009092F038489MAWVEKDHNDHRVSTPPCYVQGRQPPDQAAQSHIQPGLECL
Ga0311022_13703855Ga0311022_137038551F004815QAFKARLDVALGSLGCWLASLHIAGGWNGMSIVVLFNPGHPMIL
Ga0311022_13706348Ga0311022_137063481F007409MSQDKKVVVETKLSLSEEKNLGFLESIAKTNTEKITREILEGLSKDTGDSDSYDVKSGGEDSEDRPWRPSHAVFGKSAIKQSHLDNMGGRYFRDVSIVRADNGDRTPPAPEENEVVMFRSFFKAGLR
Ga0311022_13706804Ga0311022_137068042F038489MAWVEKDHSEHLVSTPCYVQGRQPPDQAAQSHIQPGLECL
Ga0311022_13714864Ga0311022_137148641F052316MVKTRYTGLDPNHMARVGPPGPDGQKIPVSLGYDQVKIAAKYLQQDCRLDNLLDGLEEEEVF
Ga0311022_13715054Ga0311022_137150542F020492MHMQASLLASAALTAEVDMLKQNLERLEQELGHAKKQLEDNDGEKY
Ga0311022_13720833Ga0311022_137208331F052316EVGPLGPAGQEIPVSLVYDQVALAAKYSQQHCKLDSLLEGIEEEIFESN
Ga0311022_13730442Ga0311022_137304421F021262MSKKYYIKFTTGKEFTGTAKEIVTQLRNESRLLAITPRKYAKLVAKSYEMSTGLKLRTWTYNSFVKSLGKSLMVMEFKEIG
Ga0311022_13736347Ga0311022_137363471F093003PSKSYPKCRLLPRLEEEAPKPTSPAYDAADRPPRGRDGETFQPKAQPAPRRHSNKKAWGNTPDLRDVLEDKAKHARSIYGSRGRDTMRDDKRHAGYSKSKSGRAEHSGQDPFELRRDIAQYRGAAHPLCFTDEVMDHQIPEGFKPVNIESYDDTTDPVVRIEDFLLHIHMARG
Ga0311022_13736798Ga0311022_137367981F083289MSGHKGSISVHGSWKIALECEEGDAAYAESACATEELMFYKDNIDLANMTPLKKPTTEHDPLLKFKSAHDTKQVDFVPGDTSKQFSINAN
Ga0311022_13737334Ga0311022_137373342F093003MARSLKKKQQQLRADQDLLADRWTEVLAAEEYELERPSESYPKRRLLPRLEEDALDVADRPPRGRDREASRPSTQAAPRTKAREYAPDLRDMLEDKARQTRSIYGSRGHPTARDGNRHAGHKFGRAEHSRQSSLELCHDIAQYRGAAHPPCFTDEIMDLQITEGFKPVNIESYDGTTDP
Ga0311022_13750165Ga0311022_137501651F004001SPSLEVFKKRIDVTLRDMVSEHGEDGLMDGLDDLSYLFQP
Ga0311022_13771153Ga0311022_137711531F035108MSLGVLTGRPAEEMPGSTGDQLPELVQLFERVRQAMSGVVQALWPSVSLPEGLGELAEKLQGARRCLRLWNISACRQGAREAWAMVKTRYKKADPNHMAEVGPVGPDGKEIPMSLVYGQVELAAKFSQQDCRLDSLLDGIEEEFNQSN
Ga0311022_13771232Ga0311022_137712321F027342QQELQDFIKKYESLEHDSKTQGSELAKALENAKNAKAEAHKALQELQAGQKIAAGKEFIMQSKHVKETFLLLTRVWSSPGAFPDLPRSISDAAEFYRAKEGSSTEKLFWSQYTGTEHPMPLSDQLKQLVKLHKAAELAMKDFIVRMWPGEPLPGRYFGLVRRLVNACPRLEVIKRFVCIEGACRDFARAK
Ga0311022_13773588Ga0311022_137735881F083289MARPRNVYLQLKMPGHNGTITVHGSRKIALECEEGDAAYAESVCATEELKFYKDNVDPADMTSLKKPTTEHEPVMKFKSADETKLIDFVPGDSSKQFSISGNL
Ga0311022_13776331Ga0311022_137763311F003406VEACQRAFSTVCSFIGTRDLIQEHIAFRVWPLVESWEMPKETTTNSSDGGLVRLKYTFRFREKFDEPNDDWLKCIEDTSDELLGAYSKAEDNALSAAFGGRGKKILNRVFDVIGFVYPDYHYPLRGQGKKRKTAASATPAEPKSKKVKVLTHRPRYIEPVVVPDFGVGSSSAVEAKQTALIVQSAKEPTVVSK
Ga0311022_13780404Ga0311022_137804042F045728LASAPRESSGQNERPSMAVQAAPAPAGDSLLVSRFLPTRE
Ga0311022_13784253Ga0311022_137842532F027437LFEYFLIGMTRQIIVLEEKHSQDKAEMTQRCADFEEKYSQSQIELSQVSAALDDANALSSSLHVQLNSE
Ga0311022_13787556Ga0311022_137875561F045728MQLASAPRESSGQNERTSMAVQAAPAAAGDSLLVSRFLPTRE
Ga0311022_13792652Ga0311022_137926521F020828LKQLVELHKAAEQAINGLLVRLWPGEALPGSYFGLVRRLVEACPRLEVIKRSACIEGARRALAPVRVHWGKLNGEKLVKDGPPVGKEHRKPKNYYKEVLAGARLVADECSRDVILE
Ga0311022_13795631Ga0311022_137956311F052316MVKTRYTKLDPNHMACVGPLWSNGEEIPVSLAYDQVELAAKYSQQDCKLDCLLQGVEEE
Ga0311022_13804104Ga0311022_138041041F059631IPPHFGLWMKTFNVKPKVVRGQQAECGGAMVGKMPNVTWPEGSFAETVKGWQSGWFYITEPRDADWVAAPEFRSGVPMRLTSWQEKGLTWGSLDEITGLQTCVQNMITKKIKLVNVIQVMLIRRILPCQSRTCYLWEYDPAKHQTC
Ga0311022_13824754Ga0311022_138247543F038084LLPEISQEAGQVVWYSHLLKNFPQFVVIHTVKGFRIVNKAEIDVFLELSCFFVGPTDVCNLISGFSAFSKTSLNIWKFMVHVL
Ga0311022_13834718Ga0311022_138347182F048829SKKGKEIADETSENKAFTFQNLIGEHLTKAEIEELKEYAQSCGYKPGALLFGGVDDEKLECIRDQTGAKVISTLSKSIGFPKLEADISRYRRQHVVGSLFYSNFKVNDLSLNLYCF
Ga0311022_13846270Ga0311022_138462701F034384VNAEFCQNFEEETGRIEPGLDPINSPVKDETAMNLLRLESRIDGAVDYLARLKVAMSRIDPALWPEATLQNDLESLMTRLNGIPDRVQEWKKSSARCGADVALSLVRVHCKEVRQDKLATIKVANTQKHDFRTFMETFIAAATRIADGVDLDEFVEPASPPPAE
Ga0311022_13854522Ga0311022_138545221F093003EEYKLECPSKSYPRRKLLPRLEEEEYIPPSPAHDMADRPPRGRDREASRPSTKTVPRHRSKSAKPRGNAPDLRDILEEKARQSRSIYGSRGRPMTHDEYRRAGYNNSGRAEHSRQRSLELCRDIAQYRGAAHPLCFTDEVMDHQIPEGFKPINIESYDGKTDPAVWIEDYLLHIHMARGDDLHAIKYLPLKLQGPARHWLNSLPVESVGCW
Ga0311022_13854954Ga0311022_138549541F004815PSLEAFKARLDVALGSLVCWLVTLHTAGGWNWMSIVVLCNPGHSVIL
Ga0311022_13856347Ga0311022_138563471F027342MQSKHVKETFLLLTRIRSSLGAFADLPSSVSAAAEFYRAEGGISTEKLFWSQYTGTEHPVSLSDQLKQLVELHKAAEQAMRGLIVRMWPGEPLSGSYFGLVRRLVEACPRLEVIKRSICIEGARRAFARAKVHWAKLDAMKLVKEGPPEGKEHRCLEMYYESVMKGSRLVA
Ga0311022_13860763Ga0311022_138607632F063479MSERNWAETHGVARATRGGGRPKSGEVDLGPPVKSGRGRGLGKLHGLLAELAEALARLEDGWSGLATVAEALAAMAGGIELAGAKGKWLAGEGECGAKWGAPGKAL
Ga0311022_13860807Ga0311022_138608071F105149MSRKIYQGGSSIKQAPRRAMREQDDEPPREADVRPCEWLSEEFMVQAGIMDKFDVHVHNADLEGFMSDKCPQYYYLTNSFVTRFKFTSSRNSHTVLFDLYDKSYTMDLEDFNISL
Ga0311022_13863797Ga0311022_138637973F011632ALEWAAQRGGGVTNPGGVQRAFGCCVEGHGLAGTIGEGRMVGLDDPVGLFQP
Ga0311022_13880215Ga0311022_138802151F076912RILGKSALLSNGKGSNADKVQNSDTSLLVSNKADKIAKEDYLEDNETTPKSCIGLVFELLATTACTSYSNSLSESVRFLESQLQAKRHRSAVLRQEAEGLRKSLEHSDAYFLVQQQALEDFSAKQDKANKLAKLIASMVDTQDNIS
Ga0311022_13892022Ga0311022_138920222F096317VNKQASLLAAAARTEQDLEQTEEELVDVKRQLEES
Ga0311022_13896373Ga0311022_138963732F088360VDVLVDEGKVVQIRPLAAQPMYVLGEETSPPFSWAPWFTSRPWVIAPLYVIAAAWIIGWAWRRSRAWNRRLPSMPRHDRQFILRLSVVVFLVAGIAWMGYESGVAARSPSVDIGGFAAGDLAALPSLLFPPALFFAALALEFSPGPHRVAWGLVAVLAGCGSVYFLAAATTGTAGNLNLSYYILLGVLALFTAPRAFSQGRMGWSRRGLPRYA
Ga0311022_13900746Ga0311022_139007462F058971PALRVDAGSQGDDMTPNLLMTLDIEPITLMRNGQAISLPGTYELVPDNEIKHLHKRVVAVALHERRRVPLYGRVVGKARYGKHSVWLIEDDNGNLVKAQKPMEI
Ga0311022_13901018Ga0311022_139010182F020492MGMQAALLTSAALTAEVNALKESLERSENELSRAKKQLEDKEGM
Ga0311022_13912810Ga0311022_139128101F034384VETGLDPINSPVKDEAAMNVLRLESRIAAMVDYLARLKVATSRIDTALWPGETLQNDLVSLMARLNEVPSRVPEWNKSSARCGADVALSLVRVHFKDAREDKLASLKVANTKKHDFRSFMETFIAAATRITDGIDLDEFVVPSSPPHEE
Ga0311022_13922254Ga0311022_139222541F034384YLARLKAATSRIDSTLWPEETLQNDLESLMARLNTIPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAATRIADGIDLDEFVAPSSPPQEG
Ga0311022_13922568Ga0311022_139225682F034384MNEEFCQDFEEETGRIEPGLDPINSPVKDETAMNLLRLESRIDGVVDYLARLKVAMSWIDPALWPEATLQNDLESLMTRLNEIPDRVQEWKKSSARCGADVALSLVRVHCKEVRQDKLAAIKVANTQKHDFRSFMETFIAAATRIADGVDLDEFVEPASPPP
Ga0311022_13924849Ga0311022_139248491F002002MAHQVKNLPAKQGIQETWVGSLGWGDPLEEGMGPHSSILAWRIPWTEEPGELQSMGSQRVRHN
Ga0311022_13928843Ga0311022_139288431F009131EIEDLRKQLARAKEERILEETKRELSDQWADHLEGTVEELRSSKKRCYNKSIECVKKLMASFAKVGAFSSEENFTRGNPEGPIEWIDHEAEAFEEILNSRGDICAFSGARGIATILEKKGCEHVKILAQSEGAFSFEDAKDPSAEASMVGGKFFTDIWDNGGREMAREIIQRSEKGIHEARKVAGAAEKSAGSEGQIGIN
Ga0311022_13930305Ga0311022_139303051F035626MAPSIVYSDAIQGEVFLPGQIFVFGGFVLRANSLGHLEQIESYAPGHQVRFGNLNYTADIRGDLIFDGFEPMSGAPHSHDEHDLAPSSDGVREITPVATLPLNPEQIATSEDGWVDPATEAAH
Ga0311022_13932155Ga0311022_139321552F021489PLVGFIGEQKGAKMSIERKIGSVQEYNLLKLLKANSDLKRFGVEWIKLDHNLCRAFATNAYALIIADLEPNQWHDIFDGLPEVIFIDKLKRDEVHYFEAKELEKFNYLSVFEAVGKEPNYQPVMHFDLELLRNLTDKFDDVYFVKQSGLALFMKLEGDKYPAGSYYGALMPKTISKEETAEIIDALSSLATDGEIRRKWVADLREFAQGDNA
Ga0311022_13932843Ga0311022_139328431F105149VRPCEWPSENFMIRAGIKEEFEAYVRNADFKSFMLDKCLQHYYLTDSLVRRFRFSSSRHSHTVLFDLYDKSYTMDLEDFSTACKLPQWGSPSEPRKYEFRDFLASITVGESRKITQATIGSIHFPAIHYFSFFIGGCINGKD
Ga0311022_13952260Ga0311022_139522601F103019QTRMLLFRHGGKTSSSSPPPGELTTVVVAVALRGEEYHVVAAVEGHELETPEAEHRPGLERLLKTPHLDLNGKMFVNTQQAPTWRANC
Ga0311022_13964470Ga0311022_139644702F001813VQCPAKHLLPGGVQRAFGCCVDGHGLAGTIGEGRMVGLDDPVGLLQP
Ga0311022_13975719Ga0311022_139757191F076912LGRSALLSNGKESNADKDQYSETSLLVCNKADKTAKENYLEDSETTPMSCLGLVCELLATTTCISYLNSLSKSVQFLESQLQAERHRSAVLRQEAKGLRKSLEHSDAYFLVQQQALEDFSAK
Ga0311022_13983327Ga0311022_139833273F041512VEKDYRLIRDLDAYVRVRAKKDTTITLKLKAKIAEMNSDELHIAEVYYHQLLASDIRTLGEIGCIELAIELAAWLYPRILREAYVERSKDYMLAS
Ga0311022_13999792Ga0311022_139997921F092835MNPVVRLRAGHQHSRFWPILARFMDYYSLFWGPVVISTIDDPRGAFTCPSSTLTVLDDSEPFRGLLLTVLGSR
Ga0311022_14001878Ga0311022_140018781F035108MSAGMLTGRPAEEMPWSSSDLLPELSRLHERIRQAMQGIAQALRPAHSMPEGLGALAKKLKGERRCFRLWKISACQQGAREAWAMVKTRYTKADPNHMAEVGPVGPDGNEIPMSLVYGQVELAAKYSQQDCRVDSLLDGIEEEFSQS
Ga0311022_14001907Ga0311022_140019071F103328MFKKDDGAIDMVSLILTVVIAAVTMMVGLVVVANMESSMPDISGSALSTSLTNVMENTGTAFNFLALCLFVLDAVFKIG
Ga0311022_14013661Ga0311022_140136611F068298ALEWAAQRGGGVTDPGGVQGTFGCCVEGHGLVRTIGGG
Ga0311022_14016023Ga0311022_140160231F004001EVVESPSLEVFMNCVDVTVRDVGSGHGGGGLVVERGDLRGLF
Ga0311022_14017175Ga0311022_140171752F094706GYAVGWMIKSRHGKFYFDAAGWGPEASSIENGYRVPVGGIHVFIGKIGEPGPEPDICTDIVETAQRARPAQVQPAVKRAFVGFIHGAEFEDGSVSSGETTIYSDGESSTGETTLLYQLQDGRLGGYSMAIVFRTPMSRQTGLRFSWPVHSQGRILRLQQQ
Ga0311022_14027711Ga0311022_140277112F096316MAWVEKDHNARPFPTPCYVRGRQPAAQAAQSHIQPGLECLQGWGIHSLLGQPVQCVTTLWGK
Ga0311022_14028938Ga0311022_140289381F035626INNDAVQGETFLPGQIFVFGGFAPRANSLGHLEQIESYAPGRQVRFGSLNYTTDIRGDLIFDGFEPQPSTPHCHDGHDLALQPDSTLEAALESAPIFNSEPAA
Ga0311022_14042430Ga0311022_140424301F094706MAPHLSPFTRASAVLSPQQLAPTMGPAHGGFEFLKGSFEGLKGYAVGRMTKSRRGMIYIDVEGWGPDAGSIEYGYRVPFGGIHIFIGRIGEPVPEPGICADLIESAQRARSARVKPAVRRAFVGVIHGGSYEGGSESRGETVVSSDDESSTGETESLYQLQDGQIGGCSDGDSIPDPSDLPNRVGIFMAGT
Ga0311022_14047035Ga0311022_140470352F026449VSSRFYSISKSMMISRRQGGGNEAYYTYVEEADDEANKDSA
Ga0311022_14048991Ga0311022_140489911F007558MQAIAELKALVLEMMESAFQGGEVQASQQMGVNMTHAVRREGVVIIQNQNVEVYARIMPSMVKMLKLCDALESRWRDQDAIELEPLPSRLPSAVEPEDVDPLEACCAWLYENHFNWQDMQGLMKARYLEYVSNRFRTRAEAAEWRGVGSTYLSKLSKTAMNN
Ga0311022_14059385Ga0311022_140593851F028669MYTWREIKKQQSRCWSDQFITNVSKGDGERGGWTLLWIGVTRKGRKAIEKTENRSKDYKL
Ga0311022_14060071Ga0311022_140600712F068986KAAQEVILPILLCWPTVSEAAAGGMAVEVDPSHQYSTPCCCHAKDGSRGAV
Ga0311022_14068682Ga0311022_140686821F043420MNRFICQIDGHKKTVMDAINAFCEEMFEDKREVDPASIAGNAFSSNGLSFSLKDGRKTYKVVYRNSMKVFEFFKESEI
Ga0311022_14072765Ga0311022_140727651F032472TPYARSAGFDTDIGAFIESSSVSSPIGSMAPSIINNAVVQRETLLPGQIFVFGGFALRANSLGHLEQIESYAPGRQVRFGSLNFTADIRGDSIFDGFEPQPSAPHCHDGHDVALQPDSALEAAHEPAPTLDSEPAAQIEDGWLETASGAATSTSIEPNSDLVPHEAHD
Ga0311022_14077443Ga0311022_140774431F002994DLITLLANLNMQQKEKLNELISAIHYKDELLNSQEDFLIKENKKHVKVKNAYAQEVEKCENLTSELSTCHDTISNLRNENAKLIAKVENLNVCDDSLVKLKNDNANLIAKIDKLNESIASLKIENDKLITKAKNLNVCNDIVSNLRNENVMLHAKIDELNVCKPSTSTIEHVTICTRCRDINVDAIHDHLA
Ga0311022_14078627Ga0311022_140786271F035626PLIINGDKVHGETFLLGQIFVFGGFALRANSLGHLEQIGSYTPVHQVRFGSLNYTADIRGDLIFDGFEPQPSVPHCLDGHDVALLPNSALEAARASVPTIDSEPTAPIEDQWLDAASGAAIS
Ga0311022_14085818Ga0311022_140858181F052316YTKLDPNHMAEVGPAGPDGQEIPVSLVYDQVALAGKYSQQDCKLDSLLDGIEEECNQSK
Ga0311022_14092967Ga0311022_140929671F020492MGLQAALLTSATLTAEVNTLKQSLERSESELGRAKKQLEDKEGE
Ga0311022_14092979Ga0311022_140929793F036769MKRICIVLFVVIAALFVLPPVPADISAAQPQDILTGNWVPKFEDGREGWASLAADNYPKTGFSSKGKAEVPGFKPVDLTSSVVPEYYREGQVILYNAQAQQKPFHFIRFFLGTKGAVTGYVATFDGKQYKFKAYRR
Ga0311022_14103706Ga0311022_141037061F027342SKHVNVNYVLLTRIRSSPGAFADLPRSVSDAAAFYRAEEGSSMEKVFWSQYAEAGHPVPPSDQLKQLVELHKVAEQAMKGLIVRLWPGEAMPGSYFGLVRWLVDACPWVEVIKRSACIEGARRALARAKVHWGKLDAEKLITDAPPAGKEYRTPEMYYKTVLKGARKIADECPRDVIIE
Ga0311022_14103989Ga0311022_141039891F052017MQRGVLTRDDVERFEGELGKLIVVKKALELALINPAIRDEQKRAYSRALVQCERTLRQFRRALIAMKVGLSRWAPHRRIEQAA
Ga0311022_14107965Ga0311022_141079652F103516MRTALILYLAALLAGCGAATNVQVMKPVNGEIQSFLTPELLKSRFYNFMSAGREGEMIAKKSNVLLNECNLTAKDAVNRVTYLTYTTKDAYVAESGENQVISKRVMGNKDIEIESRLFYEKEGGVRGIQVLINDFVDKNYVKGYEPEWVVRALYREVKLQDGKIVVVRDGMTRDEFMKEDEIEHYKKLNRMLK
Ga0311022_14107965Ga0311022_141079654F057477MKTPKLKDSSSTTLLALAVLCLTPGLIILSPDGRLFFLVLAGLISAVVAVAAPSGRKKLAAGLGLIVAVVMALQTWHDYTAHADAWKRHTSKQLESRGK
Ga0311022_14108218Ga0311022_141082181F035626MAPPIINNDVVQRETFLPEQIFVFGGFALRAYSLGHLEQIESYAPSHQVRFGSLNYAADIRGDLIFDGFGPTSGALNSHDEHDLNLLSDSIRDIAPAAALDLN
Ga0311022_14109699Ga0311022_141096991F052316MVKTWYTKLDPNHMARVGPVGSDGKEIPVSLVYDQVGFAAKYSQQDCRLDNL
Ga0311022_14111753Ga0311022_141117531F006329MILGLHVADVIYDHKIKMDAMLLKMRKIRKYAIHTEAWYHYAVGSIVTLVAITIAFVFALKCFT
Ga0311022_14118294Ga0311022_141182943F001445HAEEKDSATHSSDLPWRIPGTGEPGGLPSMGSHRVGHD
Ga0311022_14133922Ga0311022_141339221F094706VTNPRQLAPTVGLSHDGFEFLKGSFDGLKGYAMGRMTKSRRGKLYIDNAGWGPEADSIKYGYRVPFGGIHVFIGKIGRPAPEPDICTDIIETARRANSSPVQLEARHVFVGVVHGPRYEDGPVSDGETVVCSDDESYGETESLYQLQDGRIDGESKGHSNSDSPDLPNQDAIFMVGTQSVPHSSTAAAM
Ga0311022_14136717Ga0311022_141367171F059631IKGWQSGWFYITAPHDPKWLAAPEFQSSFPTRLTSWKEKGLSWGDSEELTGLQSCVKTLVNKKLKLINVVQVMLIRRILPCPPRAFNLGEFDPAQHQTLSRLFDTTYEDAWKVLFKGAEAPASATEDRGFSSQRQAGEVSYFIPYMTLVFHSLTLCGI
Ga0311022_14143375Ga0311022_1414337511F099497MARTKAILSAAAASILLLAGCGSSAVYLQLNPLPTGETLQSDLGAKTFNAVRFVTVGPSTSQNIGYFLHDDDVEVTLMPGAPLERMDRKMSLREAVDDYFALSQKLGNKRISPPIIREARRDGKGVGYSVADMNMGADVWDRTGSSGASKTMLELMFEPAESAKKSRAVFAPCR
Ga0311022_14143585Ga0311022_141435851F035626LDGSFNHHRQRYPGRGFPPGQIFVFRGFAMRANSLGHLEQIESYATGRQVRLGSLNFTADIRGDLIFDGFEPQPSAPHCHDGHDLALQPDVTLDAALESASIFNSELAA
Ga0311022_14156701Ga0311022_141567011F086390NSKDEACHMCVPDLSILRSAVLGDKSYNSGAIVARRLHHNRFNGDFFGGIYATRLANFLGIPIREYDIELPPVYIDYDAMVRHQFIERNDQFLQYRLIFDRRCAVHITLPAPTFFDFQAKGRYFITREEANEYERRTRAARLQAAAHDPIAAASQYDPNYNFGYPPGQPWQ
Ga0311022_14160744Ga0311022_141607441F104139PCQPLNEIRERVEPGSISSSHSDTLLAPEQPWAGLVFPPGAQSLVQAVT
Ga0311022_14161802Ga0311022_141618021F001813GGGVTDPGGVQGTFGCCVEGHGLVRAIGHGWMVGLGDPVGLFQTW
Ga0311022_14164859Ga0311022_141648592F010686VLDSCGQATKGTWGMSWCQETLKGVEDCDKPGGVVKRALIPGYLN
Ga0311022_14167169Ga0311022_141671691F093003KLLPRLEEDAYKPTSPAHNTAERPPRGRNREASRPSTQAAPQRRSKNTKARGNAPDLQDILEDNARQTRSIYGSRGRPTIRDDNRHAGYSNSGRAEHSRQSSFELRCDIAQYRGAAHPLCFTGEVMDHQIPEAFTPVNSESYDTTTDPTVGIEDYLLHIHMARGDDLHAIKYLP
Ga0311022_14169589Ga0311022_141695891F035626SSSVSLLRGLMASSIVNNAVQGENFLPGQIFVFGGFVLRANSLGHLEQINNYAPGHQVRIRNLNYTADVRGDLIFDGFGPISGAPNSHDEHDLNLLSDSIQDIAPAVAPDLNPGQIASSEDG
Ga0311022_14174610Ga0311022_141746101F105149MFRKMYQGGSSRKQGPRPAIRDADEEPPRDAQVRPCEWPSEEFMVQASIKDEFDAYVRNVGLEDFMSDKCLQYHYLTDSFVRRFKFTSSRNSHTVLFDLYDKSYTMDLEDFNTACKLP
Ga0311022_14175518Ga0311022_141755181F052316MMKTRYTGLDPNHMARVGPWGPDGQEIPVSLVYDQVKLAAKFSQQDCKLDSLIDGIDKE
Ga0311022_14192517Ga0311022_141925171F035626MAPSIISNDEVQGEVFLPGQIFMFGGFTLRANSFGHLEQIDSYTPGHQVRFGRLNYTADIRGDFIFNGFEPQPSVPRCHDGHDLALPPDSALEATHESAPTLDSEPAAQIKDGWLDTASGAATSTTIEPNTDFVPSEARDSKV
Ga0311022_14194438Ga0311022_141944381F045728SGGIGRIRKSKTARYLTGRYMQLASAPREASGQNESASMAAQAAPALGGDPHLVSRFLPTRE
Ga0311022_14196084Ga0311022_141960841F035626MASSSNNAIQGETFLPGQIFVFGGFARRANSLGHLEQIKSYAPGRQVRFGSLNCTVDIHGDLIFNGFEPLPSAPHYHDEHDLALPPNSTLEAA
Ga0311022_14198605Ga0311022_141986051F035626MAPSIIGNDVVQGEVFLPGQIFVFGGFVLWANSLGHLEQIESYAPSRQVRFGSLNYTADVRGDLIFDGFEPMSGALHSHDEHDLTLQPDNALEAAHESAATHSPEPIAQLEDGWLDTSSGAAISTAMEPNTDLVPYKTRDSEEP
Ga0311022_14203661Ga0311022_142036611F073390ILERKGCDHVKLLAQSEAALSSEDIKDPSAEASLVGGKFFTDIWDNGGREMAQEIIRKSEKGIHDARKVAEAAEKSADLEGQIGID
Ga0311022_14225087Ga0311022_142250871F045118TMRFEHRALKKEKVRTLYGFTRVNELFHGGYEVVKEKQVESWKNSLFSFSAEEVVVLGSKQLEQEMKAFQEKFGSNWFQYFLRSYGAYSLAKFAGKEVVRSALENLNSERTKVWRTMKLLEEAERELLVLKREEGSSKTLGELYEELRGKVCELAGRN
Ga0311022_14227185Ga0311022_142271851F094706VTNPRQLAPTVGLSHDGLTILEGKLKGLEDYVVGQMTKSRRGRIYIDDAGWGPEADSIEYGYRVPFGSIHVFIGKIGEPGPEPDIYTDPVETAQRARSTQVKPAMKRAFVGVIYGGEREDESEHDSETVVYSGDESSTGETESLYRMQDDQVRGCSDGDSISDPPGQINRVGIFMAGTQAVNYSSTTAAMLSGSAAAAGAGGLVRLPVQVLSDLFDALAALMAEDDPADQDAHNAE
Ga0311022_14227804Ga0311022_142278044F089982MKINFVFENELFHLFILNTVLLLHGLILSNALSAQKNIEDEGCTMALNNLRSEVIELRNEGLEKDKILISLVNKIKEGEASSKAQAEAQKNEIEDLRKQLAEVKVKCAVAEADRDASEYWKNYLEKTVAELRASKERCFEKSVGA
Ga0311022_14227804Ga0311022_142278045F010678AAQVQAEAEVGPSVPTETEPAVLEEKVTEQVASEKVKTPAPEASKESTEYIIRHASGKELSQEEMLEARHYAQKLKYPKGALVFNGSNEDDFLYCLPDNKEISVCREMSRSFGFPKLEEGLLVLSKDELADSLAYNSIKV
Ga0311022_14228731Ga0311022_142287311F013401NVGHKCLMAKDGKKKKVKSNSSTKYESSSDDNASGEEDNLRTLFANLNMEQKEKLNELISAIHEKDDLLDSQEDFLIKENKKHVKVKNAYALEVEKCEKLSSELSTCHDTIANLRNENAKLIAKVDSHVCIDSTSNPRNDNVDLLARIDELNVSIASLRNENEKLIAKAKELDVCNVTISNLRDNND
Ga0311022_14228807Ga0311022_142288072F035626MAPSIIYNDAVQGEVFLLGEIFVFGGFALRATSLVHLEQIECYAPGHQVRFGHLNYTTDIHGDLIFDGFKPMPDTPHSRDEQDVTLPSDSVRELASAATSAVNPGQIAPSESRAIDPAMEAAL
Ga0311022_14229391Ga0311022_142293911F067310PERVQAWKKSSARCGADVALSLVRVHCKEVKEEKLVVLKVANTKKLQFQSFMETFINAATRIADGIDLDSFIKPASPTHTE
Ga0311022_14235693Ga0311022_142356931F020828MKGLIARLWPGQAMPGSYFGLVRRLVDACPWVDVIKRSACIEGARRALARTKVQWGRLDAEKLLTDPPPPGKEYRTPEMYYKTVLKGARDIADECPRDVIFE
Ga0311022_14236154Ga0311022_142361541F083289YVYLQLKMSGYKGTITVHGSRKVALECEEGDAAYAETAYAAEELKFYQDNVDPADMTSLKKPTTEHDLALKFKSAAETKLVDFTPGDASKQFSISANLDPK
Ga0311022_14243372Ga0311022_142433721F028669MYARREIKKQRFKCWSDQFITNVNKGDEERGGQTLLRIGVMGKGRRAIEKIERGKNCVKR
Ga0311022_14265908Ga0311022_142659082F059631MAGKMADVLWLEGSFVETLKGWQSWWFYITEPRDPKWIAAPEFRSGPPTRLMSWKETGLSWGDEKEVTGLQTCIQSLVSKPIKLVNVVQVMLVRRILPCQQRDFNLWEFDPAQHQTLNRLFDTTYEDVWKVLTKGAEAPTSASEDRGYSSQRHASEVSYFHLLQDVKFFHSLTLCGI
Ga0311022_14269987Ga0311022_142699871F012765MEELDNHHCKLHESLDDVIRLRQSISAKDAVIKELRASKKSIAQELETAQLAVKVAEETSVTLRVQRDRAMDKAIRVGRILMMRPGVIVTDDIRANVNVAPDSSSRLSS
Ga0311022_14271229Ga0311022_142712291F035626MASPIFNNAVLGETFLPRQIFVFGGFALWANSLGHLEKIESYAPGRQVRFGSLNHMADIRGDLIFDGFETMSGAPDDHDMHDLDLPSESIRNITLATAPD
Ga0311022_14274586Ga0311022_142745861F020289MTEDEMVGWHHQLDGLEFEQAPEAGDGQGSLVRPSPWGHKELDMTEQLSRLPKWSEW
Ga0311022_14294689Ga0311022_142946891F028765KINELIDALNEKNILLEKQEDLLYEEHDKFVEAQKSYALEVKRNEMLSFELSTCHETISTLKGVNNDLNAKLEVANKSNSCVEHVEICTRCKDFDINACSEHLVSISKLNDELASLNAQLKTSKNDFDKLKFARDAYTIGRHPSIKDGLGFKREAKNLTSHKAPIPAKEKGKAPMAGTAKKNHAFMYHDRRQTRNAYRSYNAYDAFDSHAMFASSSTHMHGRDMSRRNIFHVPRKNIVHA
Ga0311022_14299673Ga0311022_142996731F020828KGLIGRLWPKEAMPGSHFGLVRRLVDACPWIKVIKRSVCIEGARRALARAKVHLGKMDAEKLVMDRPPPGKEYGKPEMYYEGVLKGARHIAGECSKDVIFE
Ga0311022_14300692Ga0311022_143006922F027342RSSPGAFTDLPRSVSDGAQFYQAEEGSSTEKLFWSHYTGTEHPMPMSDQLKQLVELHKAVEQAMKGFIVRPWPGDALPNSYFGLVRRLVHACPRLEVIKRSVCIEGARRAFAHVKVQWAKLDAVKLIKEGPPQGKEHHTPEIFYEGVLKGACLVADECAKDVIFE
Ga0311022_14305975Ga0311022_143059751F069772RDLVQEHIAFRVWPLAEKWEMPQETVKETDEGGLIRLKYTFKFGDKFVEPDDDWLKSIENLSDELLGAYSKAEDTAMSAAFGGRKKKRLNRVFDAIGFVYPDYCYPIRRQKRKNTISAKEEAAAAPSEPEPKRKKIKVLTQRPRYIEPASVPEFTGKTSSATEAEKLIEPALLPEIAETAEVPPKIESEQSNILLSETKEKTEAPLTEKIEEVREATEGSKTSEVLSPTAIIGTAKNQKGPSVTPKRKRMVNVLDVLETIKSSSTIPKKSVEV
Ga0311022_14308326Ga0311022_143083261F004815AFKARLDVALGSLVCWLVTLHIAGGWNWMSTVLLFNPGHSMIL
Ga0311022_14309815Ga0311022_143098152F096529VKRRDFIEGFEPQIVRIGGKPKVIGYIKGDAFRSVGKYSKHVLYKREGRPPAIAKEAWVYRNLIKPRCRSWEVFDEERNLILRPTIVNFDTHCEEWRHDDLVQLLLEEPFWQVERLGPPKLTQGKLF
Ga0311022_14335646Ga0311022_143356461F067310RCGADVALSLVRVHCKEVQEDKLAAIKVAITKKLQFQSFMETFIDAATRIADGIDLDSFVEPASPPHEE
Ga0311022_14352727Ga0311022_143527271F032472TSRLDAQFGTPYPRSAGFDPAIGAFIESSSVSSLIGPMAPSIINNNAVQGETFLPGQIFVFGGFAVRANSLGHLEQIESYAPGRQVRFGSLNYTADIRRDLIFDGFEPQPSVPHCHDGHDLALLPDNTLEAAQESALTLSSEPTAPIEDGWLDTASGAAVSTVIEPNTSFILCEARDSKVPDPAPDSKPSAPLPIESDWAPIMEFTAADIIQHSPFGDILNSLRSLSFSGEPWPDYGQQDFSSHHPLRSHCRRFNGHA
Ga0311022_14354837Ga0311022_143548371F069772MKEWFYVKNDLKAREDIKDIIMRPIWQRFGLRKPKVKIDDAAEECQKAFGIVCSFIGTRDLVQEHIAFRVWPLVEQWEMPKETISKPDEGGLVRLKYTFRYEGKFIEPDDDWLKCIEATSDELLGPYSKAEDNALSATFESRKKKRLNRVFDAIGFMYPDYRYPLKGQKRKSATSGNGDASVALSEAAPKRKRVKVLTHRPCFIEPASVPEFGGETSTATEAKGPALTQKNEEPTMMPKADNIEEIEAEKTIEVISPSAGMTVPKAQKDLTATPKRKRMVNVLDVLETIKSSSTTPKKTAEAPKTQIETKPSEDEA
Ga0311022_14356184Ga0311022_143561841F067310GADVALSLVRIHCKDAREDKLASFRVANTKKHDFQSFMETSIVAATRTADGIDLDQFVTPSSPPPEE
Ga0311022_14362723Ga0311022_143627231F081962VEQLYTGSQRALAIVALSNEVSTHLADVLRRLAVLPQRFQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQKDFAACVKSVRPVATLIGNDTDLTKYQPGYDAENQRIATPCYEAISLIPPTRKHTFAPEVDPAGLI
Ga0311022_14362903Ga0311022_143629031F105149MLRKMFQGGSSRKQGPRLAMRDADDEPPRDAPVRPCEWPLEDFMDQAGIKEEFNAYLHNADLVSFEAEKCRQYHYLTSSFVRRFEYSSSRNSQTVLFDLYEKSYTMDLEDFTNACKLPQWGSTSEPRRSEFREFLASITVGESRDIAQAT
Ga0311022_14375300Ga0311022_143753001F081962LSNDVPYLLQDVLKRLAVLPQRIQELRQASARAGAIAALSRAKAWLLELDPTNIALGYPSLKEDGTVFNDKDFTACVKDIRPVATLIGNDTDLSKCQPGYDKENRRIPTPHYDDVSLIPPTRKHTFAPEVDPAGLIDDEAEFEALSGIDWASSTFQDRATDGEAEKDNPDSSSQPTE
Ga0311022_14376211Ga0311022_143762111F020492MQAALLTSAALTAEVDALKQSLKQSENELGLAKKQLEDKE
Ga0311022_14386867Ga0311022_143868672F034384MNVLRLESRITGVVDYLARLKVAMSQTDTALWPMATLQNDLESMMARLNEVPSRIQEWKKSSARCGADVALSLVRVHCREAREEKLTAIKVANTKRHDFQSFMETFIAAATRIADGIDLDEFVEPASPPPAE
Ga0311022_14412240Ga0311022_144122401F052316YTKAGLNHMAEVGPVGPDGKEIPVSLVYGQVEMAAKYSQQDCKLDSLLDGIEQEYT
Ga0311022_14416169Ga0311022_144161691F096316MAWVEKDDDAHPVPTPCYVQGRQPAAPAAQSHIQPGLECLQGWGIHSLLGQPV
Ga0311022_14416682Ga0311022_144166821F093003EDEAGLDDDEFVMPEDPVEQERFKRRLVATASSLKKKQQQLRAGQDLLADRWTEVLVAEEYELERPSKSYPKRRLLPRLEEEAPKLTSPAHDAADRPPRGHDREASRPSTQAAPRRRSKNTKARGNALDLRDMLEDKAMQTRSIYGSRGHPTTRDDNRHAGYNKSKSGRAKHNRQNSFELRRDIAQYRGAAHPLCFTDEVMDHQIPEDFKPVNIESYDGTTDPAVWIEDFLLHIHMARGYDLHAIKYLPLKLKG
Ga0311022_14416717Ga0311022_144167171F052316MVKIRYAKLDPNHMARVGPVGLDGKEILVSLVYDQVELAAKYSQQDCKLDDLLDGIEEEIFKSK
Ga0311022_14417615Ga0311022_144176151F093003PERATDGESEEDNYMPLSEDEVSLGGEEFIVPKEPVEQERFKLRLIATANSLKKKQQQLQADQDLLADRWTKVLAAEEYELERPTKSYPKRKLLPHLEEEALKLASPAYDAADGPPPGQDRKAFQPEVKPAPRHQSNKNTKAWGNTRDLRDVLESRAKHARSIYGSRGHAPTRDDDRHAGHTKSKSDQAEYSRQDSYELRRDIARHRGAAHPYA
Ga0311022_14432396Ga0311022_144323961F020828LFWSQYIGAEHPMTLSDRLRQQVELHKAVELAMKDLIVRMWPAEPLPRSYFGLVKRLVSACPRLEVIKQSVCIQGPRSAFARAKVHWAKMDAEKLVTEGPPKGKEHRRPENYYDSVLKGARLVAEECAKDVIFE
Ga0311022_14438290Ga0311022_144382901F003406LKTREDIKDIIMRPIWQRFGLRRPKVEMNEAAEECQRAFGVVCSFIGTRDLVQEHIAFRIWPLVEKWEMPKETVRETDEGGLVRLKYTFQYGDKFVEPDDDWLKSIEAISDELLGLYSKAEDTALSAAFGGRKKKRLNRVFDAIGFVYPDYRYPTRGQKRKNTSSAKEVASATPSEPAPKKKRVKVLTHRPRYIEPAT
Ga0311022_14439220Ga0311022_144392201F032472TIRLDAQFGTPYPRSAGFDTDIGAFIESSSVSSPIGSMAPSIINNDVVQGETFLPGQIFVFGGFALRANSFGHLEQIESYAPGRQVIGSLNFTTDIHGDLIFDGFEPQTSAPHCNDGHDLALLPDSALEAAHESAPILDSEPAAQIEDGWLDTASGAATSTAIEPNTDLVPHKARDSEV
Ga0311022_14462051Ga0311022_144620511F030981MGKVRRCDKRCHTAKGIRCKCWCGGFFHGSAGAANRTALAQGATELLEEHGFKKDETAYI
Ga0311022_14462803Ga0311022_144628033F076748MRFIKLPGDSPPLYVSKSSFSQSDSSWFDWNDEEAVLFPNLKTGIT
Ga0311022_14464043Ga0311022_144640431F103019MLFFRHVGKTLSIPPPAGGLMAAIVVVVQRRKEYHVVAVVEGHELKTPKTKHRPGLKWLLETTHVELDGKLFVNTQQAPTWRANCRRFDPGGSL
Ga0311022_14472113Ga0311022_144721131F037787MKIYSDDPNIPYKTTKLRALYTKSEIDGLFAKWGVKDVFWHWDPEHNDVFVLFKIVEEIESMPLQVSAKVEAPAIWDHKTRSKAESVNWDISMRVMYWFIKSHLEAAYLLQSSKTAAFIPYIASKDGEKTLKDVIIPRINELQRLDALESKVLEKKEKIIDISEVKD
Ga0311022_14477739Ga0311022_144777391F027342KTLQELDEVKKIAAGKAFFMQSKHISVSYLLLTRIRSSPGAFTDLPRSVADAAAFYQAEEGSSMEKVFWSQYAEAGHPVPLSDQLKQLVELHKAAEQAMKGLLVRLWPGEALPGSYFGLVRRLVEACPRLEDIKRSVCIEGARRALARAKVHWGKLDAEKLVKDGPPPGKEHRKPENYYKDVLKGACLVADECSRDVIFE
Ga0311022_14480746Ga0311022_144807461F052316VKTRYTKLDPNHMARIGPLGSDGEEIPVSLVYDQVEVAAKYSQQDCKLDRLLDGIEEEVFESK
Ga0311022_14481383Ga0311022_144813832F061390MVIISKNEAKRLDRLVSQYGQRIVMEALEAQMLGNWSVIYFPDVDSWEVSDYGDQNFIIKDGEKCNCKKGKNGSCFHQVLVELKKWDLEDELNETD
Ga0311022_14481419Ga0311022_144814191F103019MLLFRHVGKTSSIPPPTGGLTVAIVVVARRRKEYHVVAAVEGHELQTPETKHRPGLKRLLETTHLELDGKLFVNTQQAPTWRAN
Ga0311022_14486142Ga0311022_144861421F011632SIEFTVQQGKGGQALEWAAQRGGGVTEPGGIQRAFGCCVEGHGLVGTIGEERTVGLDDPLGLFQP
Ga0311022_14491535Ga0311022_144915351F020492MHMQASMLASATLIAEVDTLKQNLERSEQELGRAKKQLEANEGKKYLVKIYIKRCNCKE
Ga0311022_14492293Ga0311022_144922931F032472APSIVNNTVQGETFLPRQIFVFGGFALRANSLSHLEQIDSYAPGHQVRFGGLNYTVDIRGDLIFDGFEPLPSAPHCHDGHDLALPPESVQEIAPATAPTFNSEPIAPSVDGWLDPAMEVAASTAIEPNTSLTLREACDSKFPDSSPDSEPPGPLPIESDWAPIMEFT
Ga0311022_14496567Ga0311022_144965672F027437MTRQISTLEEKHSRDQAELAQRCADFEEKYSQSQTELTQVSVALDDANALSSSLHAQLNSEKVIYETVLCLVVLLLLAWFLR
Ga0311022_14498025Ga0311022_144980251F082256FANVGAYSNEDNFIRGDPEGVIEWITGEVEAFEEILSDRGDVCAFSGARGVSAILEKVGCNHVKTLAQAEAALSVDDTKDPSAEASLMGENFFTDIWENGGREMAHEIMKKSEKDIHDAREAAKKAEEAAERERWIGIV
Ga0311022_14506787Ga0311022_145067871F068986MNTTLKVIPPILSCWLTTSGADVGGMAVEVEASHQYSATFHCHVTDGSR
Ga0311022_14507316Ga0311022_145073161F007510VHGVAKSWTRLSDFTFHFHFPALEKERAIHYSTLAWRTPGALEPGGLPTLGSHRVRHD
Ga0311022_14510224Ga0311022_145102246F055836MESCEGEVVAIYRKKWSRQFLGFVAVTLRWPMLLLLTLGRFLKINCIFTVYPGSQRDVDGYFPKGLKWFLKPAASGKPFVAGVITTGNGLGRGLVLAVPNTVDQFKTDRDLVGTIMKNLKLTRTLTGAKTIAVAGQGPRFFKSHFPYEQPFVYGLKGRVFSVVETVEQVAATNGLTRSETTVAILGVGEIGAAIIANLKEKGYRAVGIDIRIAEGRVEIGREGMETLRKADLIVVQTPRGDDVVPYYENLKKTAILIDDAHPRITVRPGEVKFYKVAIGRSGVEFKPPLPGYEKYWIPGCVQESMVVAESGKVDMSQEDFNKRSKELGFFAHLVDDR
Ga0311022_14518152Ga0311022_145181521F026180MPCAPNRRHRALECREIIKLAKRVSGQCEQTSKDGSPPHRRPGKERVDDGDVATGERELGYQSPEGVLKDVFTGDSDSGDDGDRRKKLHVMYGGSWELTSHRNVKSLRREVLSVVLGVPKATPHQ
Ga0311022_14524561Ga0311022_145245611F034384VNAEFCQNFEEETRRIELGLDPINSPMKDETAMNLLRLESRIDSAVDYLARLKVTMSRIDPALWPEAVLQNDLESLMTRLNEIPDRVQEWKKSAARCGADVALSLVHVHCKEVRQDKLAAIKVANTQKHDFRTFMETFIAAATRIADGVDLDEFVEPASPPPAE
Ga0311022_14526209Ga0311022_145262091F020492MGLQVVLLTSAALTAEVNTLKQSLERSENELGRAKKQLEDKEGE
Ga0311022_14527943Ga0311022_145279431F007409MSKEKKVAAKMKLSLSEEKNLGFIESIAKTNTEKITREILEGLSEDTGESDSYDADSGGEDSEDRPWRPSHSVFGKSTIGQSHLENMRGRYFRDMSIVRADAGERTVPTPEDDEVVIFRSFLKAGLRFPPKQLCH
Ga0311022_14528990Ga0311022_145289902F072892MDINSLKNISTRLFGLYSQFKSVVSDLETNNTLDNREWAKGLLSNLSTELYYEANCLTDVLYPPRKEEKDETMFKIDGIIDAGRNPMSEDEFCELFLKWAEENKLQFGGGLGTYREEEENELLAEK
Ga0311022_14528990Ga0311022_145289903F076577MNFWPKSKVIALMEIAFHFGAISYAPSNGKKRREMWKEFKENCIDKRLKYINPDPRCTHPVNLDAIDYCWGYADKIDKGEEINMNELCEGCEFFKKEANNENPTQSN
Ga0311022_14528990Ga0311022_145289904F071725MKTLLNQTESEYLNLGSLDQELSWVLKIYSSGKINDLIYDGLLLFATDEEIKAIREKWQRKEINEVGLFHELEKLSKVESLPR
Ga0311022_14529855Ga0311022_145298553F092835QQQSQFWPILARFVDYYSLFWGPGVMSTIDESRGAFMCRSATLLVFVNSDPFRGLLLTVLGPQSDFHGC
Ga0311022_14532603Ga0311022_145326031F032472QFGTPYPRSASFDTDIGAFIESSSVWSPLGPMASSIIAHDAVQGETLLPGQSFVFGGFALRANSLGHLEQIESYAPGRQVRFGSLNFTADVREDLILDGLEPQPSAPHCDDGHDLTLPLNSALVTAHGFASAISPEPIAQIEGRWIAAALGASTSTAMEPNTNLIPRETRD
Ga0311022_14541053Ga0311022_145410532F020492MGLQAALLTSAALTAEVNTLKENLERSENELGRAKRQLEDKEGE
Ga0311022_14546869Ga0311022_145468691F014592NSRGDICAFSGAREIATILEKKGCEHVKTLAQSEAALSFEDARDPSAEASIIGGKFFTDIWENGGREMAGEIIRKSEKGIHDAREVADAAEKSVEAEGQLGIN
Ga0311022_14546869Ga0311022_145468692F099086VSCPTSDPAEASSGPQPKGDDEIKKMAEDILDKVVNRLLNEAAE
Ga0311022_14554591Ga0311022_145545911F002471DAYTIGRHPSIKDGLGFKREAKDLTSHKAPISAKEKGKAPMASSAKKNHAFMYHDRRQSRNAYRSCNAYDAFDSHAMFASSSSYMHGRDMSRRNVIHHVPRKNIVHAPRKVMNEPSTIYYACNASFAICRKDKKVFARKLGVKCKGDKTCIWVPKTIVTNLVGPNMSLVPKTQA
Ga0311022_14554644Ga0311022_145546442F073228MLTIGDIMNANSSKYGEFLHRIVMVFPHNMEVDRTELARLIKISNNTLTFERKNGEKFRIDERDIEHMELFKSPNYRGGK
Ga0311022_14562721Ga0311022_145627211F096317VNKQASLLAAAAATAEVFGLRHSLGRAEEELSLVKRQLKENKGK
Ga0311022_14563705Ga0311022_145637051F020828SSDLAMKGLIARLWPGEVMPGSYFGSVRRLVDTCPWIEVIKRSVCIEGARRALARAKVHWGKLDAEKLLTDAPPPGKEYHTPEMYYNGILKGARRIADECSKDVIFE
Ga0311022_14564937Ga0311022_145649371F027342PPSRVATARRSPARTAVDLVAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKAAEQAMKGLIGRLWPGEVMPLSYFGLVRRLVDACPWLGVIKRSVCIEGARRAFARAKVHWGKLDAEKLVKDGPPEGKEHRRPEMYYEGVLKGARLVANECTGDVIFE
Ga0311022_14565531Ga0311022_145655311F027342FTDLPCSVSDATKFYQAEEGSLMEKLFWSQYTEAEHPVPMSDQLKQMVELHKAAAQAMKGLIVRLWPKEAIPGSYFGPVRRLVDACPWVEVIKHSACIEGARRALARANVHWGKMDAEKLVKDAPPPGKEYHTPEMYYKVVLKGARIIAGECSKDVIFE
Ga0311022_14580704Ga0311022_145807041F035785NALKMTETEMLDVVFEASENSVIELNVVDPDSQAGDNDGVYLEIVKLDDEESVVRDRWPNQDNHRVLVRTKDIYSIYRALVDQVEEVA
Ga0311022_14586108Ga0311022_145861081F086390SIHFPAIHYFALFIGRCINGKDEACHMCVPDLSVLKSAVLGDKQYNLGAIVARRLHHNSISGDLFGGIYATRLANFLEVPIRENDMELPPAYLDFNAMVCHQFVERNEQSLQYRLILDRHRAVHITVPASTFFDFQAKARYFITREEVEEYKRRAEIAHLQAATHNAMTAA
Ga0311022_14600161Ga0311022_146001613F005658MAWVEKDHNDRQVPTPCCVQGRQPADQAAQSHIQPGPECLQGWGI
Ga0311022_14602926Ga0311022_146029261F039980LITCLVSEGVDFCLQEEKRILAASRDNLDRLYRDSSNSLTILERSHRFTMEELDNQRCRLQESVDEVTRLKQLISAKDATIKELRASKKSIAQELEAARLATKVAEETAATLKAQRDKAMDKAIRARQILMRRPGVVVPEDIKADVNAALDSSNRPSSSVVPEKDIGK
Ga0311022_14604227Ga0311022_146042271F035426MLAPDVNCFWALEQDQESYNREVYLPDAYIEVIINVGAPLVLESEHGMLELPRAFVNPLQNKPLRIRATGFCQMISMQLYPWAVKPIMNIDADPSTVHVIGLDADWQRFADDLTQIVAHRCYGEAIDCYQEYGCKTAYRHKHDVTLIRTAGHLLHRSHGQIRMTDLATQIHLSSSQLERQ
Ga0311022_14606075Ga0311022_146060752F020492MGLQAALLTSAALTAEVGALKQDLERSEQELGLAKKQLEDKEGE
Ga0311022_14606591Ga0311022_146065911F032472MSSPLGLMASSIVNHDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTTDIRGDLIFDGFEPRPSTPHCHNGHDLALPPDNAQSVAQVPAPTISSEPTAPVGAGRLAAAPGAAISTAIEPNTGLVLCEASDSKVPDSCPDSEPS
Ga0311022_14622474Ga0311022_146224741F105149MSRKMYQGGSSSKQAPRLAIREPDLEPPREAQVHPCEWLSDEFMVHAGFKDEFDAYVQNASLEDFVSDKCRQYYHLTDSFVRRFEFSSKRNTHTVLFDLYDESYTMDLEDFNTACKIPQWGIHSEPRKTEYNDSLARIAVGETRNITQATIGSIHFPAIHYFALVIGRCIDGKHDHSHVCASVLVS
Ga0311022_14654377Ga0311022_146543772F004001EVCRNDVDVAPRDVVSGHGGCGLVVGDLRGLFQPK
Ga0311022_14656384Ga0311022_146563841F038003TAQAAPDVTSSPPIDQKVPTDPHPTSFGFSLNPPSDFALVGALVEASPNPLGFRTRSPWDRLTNVSTYGPSRSEEEDDPSICWDFSRLGDPSAMRDFMTACDYCLSDCSDGSRSFGDEGCGPSRECFHVDLGGPGEGNHLGIPENGDPPRPAHRVDILRELAEVPVPAGGQDAHLEQIG
Ga0311022_14656974Ga0311022_146569741F063479MGQRASRVAREDVGARNWSEAPWIARSMRGGGRPKSGEVDLGPPVKSVRVRGLGKLHGLLAELAEALARLEDGWSGLATMAEALAAMAGGIELAGAKERGLAGEGECGAK
Ga0311022_14657462Ga0311022_146574621F020376MDGTNKARRKRWRKRAEAAFERMFEGKSEEELVTLTQREDMAVLIGRELAAFLLEEHVARDPAAQPEEASTACCPKCGQPGVPSPKEGEELGERAGTTRVGRIRMRRQRWECPKCR
Ga0311022_14665380Ga0311022_146653802F004454VDRRRRVVVEVSEPVHRELRKLALLNDLRIYELTDAILEEYLSDNEKLKALIKRLTLQGT
Ga0311022_14668858Ga0311022_146688581F081962KLKAVYTLVEQLYTGSQRALAVVALSNEVPTLLSDVLKRLVVLPQRFNELRRSSARAGAVTALSRAKAWLPELDPADIAIGYPSLKEDGTPFGQEDFTTCVKEIRPVATLIANDTDLTKYHPGYDAENRRIPTPHYEVTSLIPPIRKHTFAPEVDPDGLIDDEAEFEALSGIDWSSSTFQDREQ
Ga0311022_14668976Ga0311022_146689761F021262MSKKYYIKFTTGKELTGTAKEIVTQLRNESRLLAITPRKYAKLVAKSYEMSTGLKLHTWTYNSFVKSLGKSLMVMEFKEVK
Ga0311022_14669329Ga0311022_146693292F081962MQIKLKVVYTLVEQLYTGSQCALAVVALSTPHPRLLQEVLKSLAFLPQRIQDLRRASSRAGAVTALSRAKAWLLELDPVDLALGYPSLKEDGTAFDDHDFTACVKAIRLVETLIGNDTDLSKYAPAYDSENRRIPNTAYDQISLIPPIR
Ga0311022_14670255Ga0311022_146702551F020492MGLLAALLTSTALTAEVEALKKDLERSEQELGHAKRQLKEKEGE
Ga0311022_14677133Ga0311022_146771331F020828SQYAEAEHLVPMSEQLKQMVELHKAADQGMKSFIVRLWPSDALPNSFFILVRRLVDACPWLEVVKRSVWIEGAHRAFACVKLQWVKLDAMKLIKEGPPEGKEHCHPEMYYEGVLSGARLMADECSKDVIFE
Ga0311022_14681666Ga0311022_146816661F020492MGMQATLLTSAALTAEVKLLKENFERSENELGRAKEKLKDKEGMKYRM
Ga0311022_14683595Ga0311022_146835951F068298GQALEWAAQGVGGVTDPGGVQGAFGRCVEGHGLVRTIGEG
Ga0311022_14697135Ga0311022_146971352F052316MVKTRYTKIDPNHMARVGPVGSNGEEIPVSLVYGHVQVAAKYLQQDCRLDSLLDGIEEEVFESK
Ga0311022_14707395Ga0311022_147073951F001813VERGSQGGAGVTNPGGVQGMFGHCVEGHGLIRTIGDGWMVGLGDPVGL
Ga0311022_14721034Ga0311022_147210345F045728MQLASAPRESSGQNERPLMAVQAAPAPAGVPLVVSRFLPTRV
Ga0311022_14721513Ga0311022_147215131F093003LLVNRWTEVLAAEDHKLERPSKSYPKRRVLPQLEEEALDAAERPPRGRDREASRPSTQAAPRTKAQEYAPDLQDMLEDKARQTRSIYGSRGHPTARDGNRHAGHTFGGAAHSRQGSLELHHDIAQYRGAEHPLCFIGEIMDHQIPEGFKPVNIESYDGTIDPAVWIEDYLLHIHMARGADLHATKYLPLQLKVPARYWLNILPENSIGSWEDLEDAF
Ga0311022_14723198Ga0311022_147231981F038012MIIEFQPLYYVQGHQSLDQAAQSHIQPGLECLQGWGIHNLL
Ga0311022_14728853Ga0311022_147288533F069913LKFFAMTLEEYIQLERDFSTSETDIKAFLGIKGISIHQYYYWKRKSRDLQEASSSTEGQFLPLNVISGGSINPGKRGKNLKHPLITQAEIEIELRTPSGSELRIRGVMDSIMVSTIIASSSVRRNV
Ga0311022_14731413Ga0311022_147314131F089495LLMGRPYLRKKHVTIELFDGTATTPFTETITGYADVPELPEPVIDAPAEGYAPQGVFNSIEEGDDTINLPEFSITVDINDADVTSNKYALNEWFNNHKDSTGSTSLKSTNDGSAYLKRSIDGTTVSANLATDWFTIGMKVLFNNSGSAKAFGKQYKYVRPISATFSTSNKAQVTLRMQIVGAPTDITS
Ga0311022_14740492Ga0311022_147404922F001813RRGGGATDPGGVQGTYGHCVEGRGLMTTIGDGWMVELGDAVGLFQPW
Ga0311022_14746357Ga0311022_147463571F035108GDLLPELLQLHERVRQAMQGVVQAMWPSLSMPEGLGELVEKLKGVRQRFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPMGPDGKEIPVSLVYGQVELAAKYSQQDCKLDRLLDGIEEEYTESD
Ga0311022_14762714Ga0311022_147627141F076912LLVSNKADKTAKEDYLEDSETTPKSCLGLVFELLDTTACTSYSNSLSESVWFLESQLQAERHRSAVLRQEAEGLRKSLEHSDAYFLVQQQVLEDFSAKQDKANQLAKLIASMVDTQDNVS
Ga0311022_14771662Ga0311022_147716621F035626MAPSIINNDAVQGETFFPGQIFVFGSFTPRANSLGHLEQIESYAPGHQVRLGSLDYAADIHGDLIFDGFEPQPSAPHYLDGHDIALPPNSALEAAHALVLTIDSESTAPIEDQRLDVA
Ga0311022_14789959Ga0311022_147899592F020492MKYVNTGWQAVLLTSAALTAEVDAFKRNLELSESELGRAKKQLEDKEGE
Ga0311022_14792465Ga0311022_147924651F081962LNQSVVPKLKAVYTLVEQLSTGAQRALAVVALTNEVPTHLAEVLRRLAVLPQRIQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTAFDQKDFAACVKAVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEALNLIPPARQHTFAPEIDPAGLID
Ga0311022_14794263Ga0311022_147942631F068298LELNFKKLEWAAQRGGGVTDPGGVQRAFGCCVEGRGLAGTI
Ga0311022_14799756Ga0311022_147997561F005744MDEVFEIIKAGPGDTPPEQALYRIQQTYPDGSGGRLNIDWDGLLRVHELIHARIALEGYVCETCDTEGCHRPATWEIECRGVGVSGRLIYSCDEHCPDPA
Ga0311022_14799816Ga0311022_147998161F076748MPNPMRFIQLPGDSPPLYVSKSSFLQSDSSWFDWNDEEAVLFPNW
Ga0311022_14809368Ga0311022_148093681F076748MRFIQLPGDSPPLYVSKSSFLQSDSSWFDWNDEEAVLFPNWETGI
Ga0311022_14815651Ga0311022_148156511F086390HYFALFIGRCINAKDEACHMCALDLSILRSDVLGDQSYHMGAIVARRLHLNRRNGDFFGGIYATRLANFLEVDIREGDMELPPTYLDFDSMVSHQFVERTELPLQYQLIVNKRHVVRITLPAPAFFDSQTKGRYIITREEADEYDRRAEAARRHATAQAAIAAASQYDPSFTYGYPPGYP
Ga0311022_14816610Ga0311022_148166101F032472SPVTIRLDAQFGTPYPRSAGFDTDIGAFIESSSVSSPIGLMASSIDNDTILGQTFLPGQIFVFGGFALRANSLGHLEQIESYAPGRHVRFGSLNFTANIRGDLIFDGSEPQPSVPHCHDGHDLTLPPDSTLEAAHESAPTHSPEPIAQIEDGWLDTASGAATSTAMEPNTDLVPYKAHDSEVPASLPDSTPPAPLPIEP
Ga0311022_14821264Ga0311022_148212642F052316MVKPRYTKLDPHHMAEVGPSRPDGQEIPVSLVYDQVALAAKYSQQDCRLDSLLDG
Ga0311022_14828826Ga0311022_148288261F096317MSLTISLNLNKQAVLLAAAARTAEIAGLKQDLERAQGELGLMRRQLEESKGE
Ga0311022_14850008Ga0311022_148500081F020828MPLSDQLKQLVELQKAAEQAMRGFIVRMWPGDSLPNSYFGLVRWLVDACPRLEVIKRSVRIEGARRAFARAKVHWAKMDAVKLVKEVPPQGKEHRHPEMYYEGVLKGARLVAGECAKDVIFE
Ga0311022_14852915Ga0311022_148529151F032472TIRLDAQFGTPYPRSAGFDTDIGAFIESSSVSSPIGSMASSIINNDAVQGEIFLPGQIFVFGGFALRANSLGQLEQIERYTPGRQVRFGSLNFTADIRGDLILDGFEPQPSVPYCHDGHDLALQPDSTLEAALEPAPIFDSEPAAQTKDGWLDTTSGAATSTAIEPNTDLVPHEARDSEVPDSGPPAPPPAESDWA
Ga0311022_14854902Ga0311022_148549021F028669MYTQCEIKKQRFKCWSNQFIANVNKGDEERGGWTLLRIGVMGKGRRVIEKIGSRSKKSL
Ga0311022_14862858Ga0311022_148628581F096761LICSPYQALVDGMASQLRLQGASVPEGVLSLARWNPVLLQHRVSDFEATSVG
Ga0311022_14862858Ga0311022_148628582F027437MARQIFVLGEKHSQGQAELVRRCSDFEERYSQSQTELGRVSAALTDANTLNSTLRTQLDSEKVTHETVPCIVVFLLPA
Ga0311022_14879139Ga0311022_148791391F020828STKKLFSSQYTGTKHLMPLNDQLKQLVELHKADEEAMRGFIVRMWPGDSLPNGYFGLVRQLVNACPWLEVIKRSVYIEGARRDFARPKVHWAKMDAEKLVKEGPPQGKEHRHPEMYYEGVLKGASLVVDECAKDVIFE
Ga0311022_14886627Ga0311022_148866272F096317MNKQAVLVAAAARTAEIAGLTQDLERAQGELALARKQLEENKGK
Ga0311022_14898689Ga0311022_148986895F105435LWFWKGRPTWHESVFDTLELLSFGRSFEGNGVDDVARVFGLPPKLGRGGDFPLLWRADREAALAYNRRDVEIEIEIARICGCI
Ga0311022_14919112Ga0311022_149191122F095123MNALSREWCRHYEVFDQADEDFERDIYKVEDPVVKESAGALYDRMWGPHGREVVRERSETARGQVMFDFCLVLLNVGCIWFC
Ga0311022_14923723Ga0311022_149237231F003406SHPVPTFRKRWPETWIEEWFYVKNDLKAREDIKKIIQRPIWSRFGLQRPKVEIDDAVEACQRAFNTVCSFIGTRDLIQEHIAFRVWPLVKSWEMPKETTVNSREGGLVRLKYTFRFREKFDEPNDDWLKCIEATSDELLGAYSKAEDNALSAAFGGRGKKRLNRVFDAIGFVYPDYRYPLRGQGKKRKTAASATPVEPMPKGKKMKVLTHRPRYIEPAVVPELDAGSSSAVKTIQAASTAHGAEEPAVMPKTHIVESTE
Ga0311022_14925252Ga0311022_149252521F011632QALEWAAQRGGGATEPGGVQSTFGCCVEGHGLARTIDEGRMVGLDDPVGLFQP
Ga0311022_14930901Ga0311022_149309011F027342MQSKHVEENFLFLTRVQSSPGAFADLPRSGSDAAEFYRAEEGSSTEKLFWSQYTGTEHPMPLSDQLKQLVELHKAAEQAMRGLIVRMWPGEPLPGSYFGLVRRLVNACPRFEVIKRSICIEGARRAFARAKVHWAKMDAEKLVKEGPPKGKEHCHPEKYYDSVLKGARLVAEECAKDVIFERMY
Ga0311022_14941878Ga0311022_149418781F032472GQIFVFDGFVLRANSLGHLEQIKSYAPGHQVRFGSLNYTADIRGDLIFDGFEPRPSTPHCHDGHDLALPPDNAQSVAQVPALTISSEPTAPIGDGRLDATPGAAIPTVIEPNTSPVLGEAYASRVPDSVPNSESSAPLPIEPDWAPIMEFTTVDVFQHSPFGDILNSLKSLSL
Ga0311022_14946312Ga0311022_149463121F059998MDDLEFISDLALLELDKLNPTLSGQPLTEKTKKYFLSEIRSRRWELGRGRQVTPLTETGAIVSDAHGWPVSFQDVIRAIASELFDNVPAKESAPEKMTEQEYISAMQKAETPEQRIKLMQEWQRQQYGK
Ga0311022_14950354Ga0311022_149503541F096316MDVNLSSHNPRMAWVEKDRNAHPVPPPCYVQGRQPADQAAQSHIQPGLECLQGWGIHSLL
Ga0311022_14954902Ga0311022_149549021F067310MALSLVCVHCKEVREEKLAALKVANTKKLQFQSFMETFTEAATRIADGIHLDEFAEPASPPPVQ
Ga0311022_14956742Ga0311022_149567422F028765LIDALNEKNRLLEKQEDLLYEEHDKFISVQKSLALETKRNEILSSEISTCHESISSLKSVNDELNATLEVANKSSSSVEHVVICNRCKDFDVNACNEHLASITKLNDEVTSLNAQLKTCKVDFDKLKFVRDAYTVGRHPSIKDGLGFRKEAKNLTSQRAPISAKEKGKAPMANSAQRNHAFIYSDRKFSRNAHRSYAYDSHAMIASSSSFVHGRNMPRKNVARVPRKVCNEPSTIYHACNTSFA
Ga0311022_14973377Ga0311022_149733771F052316MVKRRYTKVDRNHMAKVGPVGSDGKEIPVSLVYDWVALAVKYSQQDYRLDNLLDSIEEEFSQSK
Ga0311022_14982813Ga0311022_149828131F051165MNLNLQKALAVLASVASVLAGVVTIASFLSGEDGALPPSLTAPSSSHQPIIIHARAVFIEKNMTYAIDYDKNLIMLNESTIVL
Ga0311022_14984124Ga0311022_149841241F035626MSSLQGLMAPSINNNLVRGETFLPGQIFVFGGFVLWANSLGHLEQIDSYAPGRQVRFGSLNYIADIRGDLIFDGFEPATAAPHSYNEHSLNLSSDYAQETAP
Ga0311022_14988104Ga0311022_149881041F032486VQKVLEQMQRLSRQVLFETLPHPERRKRLGKKVLGLV
Ga0311022_14990411Ga0311022_149904112F076912MLVSKKGDKNDLVDSEKTPQSCVDVVFELLASTAGTSSSNSLPESLRLLQSQLPAERHQSAMLWQEAEGLRKSLRNSDAYFLVQQQALEDLSAKQEKVNKLAKHLASIMGTQDIVS
Ga0311022_14999019Ga0311022_149990191F051243MSTMLEAGFQSQGGTPLQYSCLENPMDRGAWYAAVYGVAESRTRLSDFTFTFHFHTLEKEMATHSSVLAWRIPGMGEPGGLPSMGSHRVGYD
Ga0311022_14999216Ga0311022_149992161F103019MLFFRHMGKTSLIPPPAGGLSAVIVAVARRRKEYLVVAAVEGHELKILETEHRPGPERLLETAHLDLDGNLFVNPQHAPTSRAN
Ga0311022_15001433Ga0311022_150014331F039980PLVAARDNLDRVYRDASTSLTILERSHRFTMSDLDHHRHELQVSQDEVQRFGQLLSAKDLTIKDLRASKKLVAQGLETARLAVKASEDNCVVLKAQRDKAMDKAIRVGRILMRRPGVIVPDDIVADVNAAPDSSSRPSSSVAPEKNFTK
Ga0311022_15007820Ga0311022_150078201F051165MTTSFQKILTVLASIASVLAGVVTIASFLSGGDVALPPSLTTPPSDSQPIIIHARAVFIDGNSTYTIDYDKNLILLNESIIVLQ
Ga0311022_15022440Ga0311022_150224401F052316MVKTRCTGLDPNHIARVGPQGLDGREILVNLVYNQVMIAAKYSQEDRKLDSLIDGIEKE
Ga0311022_15027977Ga0311022_150279771F032472VAGLGVTLLLGLIFVFGCCALRAKSVVDLVQIESYAPGLQVRFGSLNYTADIHGDLIFDGFEPRPSVPHCLDGHDIAVLLNSTLEAAHAPVPTIDSEPTAPIEDQRLDAALGAAISEAIEPTSSPALCTTRDSEDPDSSPDSEPPAPLPIQSDWAPIMEFIAADIFQHSPFGDILNSLKSLSLS
Ga0311022_15040032Ga0311022_150400322F088355MKNIKNKLRVFAGQKGQFVLAILTIALFVLAAGAPNATIGIGR
Ga0311022_15044630Ga0311022_150446301F038012MIIRFQPPCYVQGHQALDQAAQSHIQPGLECLQGWGIHSLLGQPV
Ga0311022_15046682Ga0311022_150466821F038084THLFQNFPQFIVIHTVKGFGIVNKAEVDVFLELSCFFDDPTDIGNLISRSTDVSKTSLNIWKFTVYILIKSGLENFEHYIASM
Ga0311022_15057144Ga0311022_150571442F052316MVKTRFKKADPNHMAEVGPVGPDGKEIPVSLMYGQVELAAKYSQRDCKLDILLDGIEEEYNQSI
Ga0311022_15058643Ga0311022_150586431F096317VNKQALLLAAAARTAEVARLQWDLGQVEEELSLTKRQLEENKGK
Ga0311022_15058923Ga0311022_150589231F020363RRVAVARVFALVVRCRVMRLLLYSRVGKNRDTRRESPAGAGAGRTADHLTVLFSQKVLAVRKANDIYRPVVPSSVILYCPVSMAEYSYMWGRL
Ga0311022_15059177Ga0311022_150591771F027342GKAFIMQSKHVKETFLFLTRVRSSPGAFADLPRSALDAVEFYRVAEGSSTEKLFWSQYTGAEHPMPLSDQLKQLVELHKEAEQAMRGLIVRMWPGEPLSGSYFGLVRRLVEACPWLEVIKRSVCIEGARRAFARAKVRWAKLDALKLVKEGTPEGKEHRCPENYYESVLKGSRLVA
Ga0311022_15060581Ga0311022_150605811F014346VLEKTLESPLDCKEIQPVPSEGDQPWDFFGRNGAKAEIPVLWPPHVKC
Ga0311022_15061438Ga0311022_150614382F020492MHMQASLLASAALTAEVDTLKQNLTRSENKLGHAKRQFEEKEGK
Ga0311022_15062205Ga0311022_150622051F006329KMRLELHAADVVDDHKVKMDAMCLKIGKIRKYAIHTEAWYHYAVGSVVTLIAIMIVFVFALKYFT
Ga0311022_15087145Ga0311022_150871451F032472SMASSINNNTVQGETFLPGQIFVFGGFALRDNSLGHLEQIESYAPGRQVRFGSLNFTADIRGDLIFDGSDPQPSVPHYRDGHDLALPPDSALEAAHESAPTHSSEPIAQIEDEWLDTASGATTSAAMEPNIDLVPYKTRDSEVLDSLLDSEPPAPPPIESDWAPIMECTAADIFQHSPFGNILNLLKHLSLSGEPWPNCGQDGWDADDEGIQSPP
Ga0311022_15106300Ga0311022_151063001F038012MIIEFQPPCDVQGRQPPDQAAQRHIQPGLECLQGWGIH
Ga0311022_15112125Ga0311022_151121252F019989MKQIMNTTDIHKNLTVPSVTIAPRNPRRGVLTFVVTLTTFKDVRSYPCRSLESATKLVERFIAGVTKPRPAAQPAETTPAPHLQPVAAKVRHPRPRPGILFA
Ga0311022_15115379Ga0311022_151153792F101218MSKRGPKPDLPRVKEPPPLPSLDELIAESRALGWDDLADSMEKLRHLETPEGQKALERREKRRSRL
Ga0311022_15125243Ga0311022_151252431F020862RLKQVFNSVGASSEKFEPSVEDLSSTFKHIESEVEALDEVIAGHGDFCALLASRGIAVAFMKAGCTHGKIVNRPNFSLSPADLTDIPSLARSIGNRFITQIWTKGGRNLAGGEAQSHLKPVFKLVPVTYLLLRLLFTLYCFVLYRMTMSKVNNPKIDGD
Ga0311022_15127215Ga0311022_151272151F038084VVWYSHLFKNVSQFVVIHPVKGFGIVNKAEIDVFLELSCFFENPSDVGNLISGSSTFSKSSMSMWKSMVHILLKPGLENFEHYFASV
Ga0311022_15134422Ga0311022_151344222F073228VMVFPHNLEVDKTELARLIKINNNTLTFERKNGEKFRIDERDIEHMELFRSPNYRGGK
Ga0311022_15136080Ga0311022_151360801F035626MESSIVNNTVQGETFFPGQIFVFGGFALRANSLGQLEQIDSFAPGHQIRFGNLNYTADIRGDLIFDGFEPAPGAPDSHDEHGLDLLLDSARDILPEAAPDLNPGRVALPTDGGMDPA
Ga0311022_15154680Ga0311022_151546801F067310MTRLNEVPGRVAEWKKSSARCGADVALSLVRIHCKEAREEKLAATQVANTRKHHFQDFMETFIAAATRIADGIDLDEFVAPSSPPPPEE
Ga0311022_15160873Ga0311022_151608731F067453MITRSLGIAPGVPWGGPLPGGGYEGKTKRLDRAVQRFAEWLHRRIAGPVQVRFNSHRLSGGAYVYPDAAPDARIILDSPEIGLGARIGTPASVQRRRDRAWNKGEGSSLPALEWEDCWTESTPLSYNVLIYPQYLR
Ga0311022_15162037Ga0311022_151620371F035626PTRDPPVLTPTLVLSLRVPLCHPQKVFMAPSIVNNDAVQGETFLPGQIFVLGGFALRANSLGHLEQIASYAPGHQVRFGSLKYVADARGDLIFHGFETTAVAPHRHDEHDLDLSSGHAQEIAPITALALDPEQTAPFEDGKLNPPRKP
Ga0311022_15162295Ga0311022_151622951F006329LELHVADFVDDHKIKMDAMRLKIRKIRKYAIHTETWYHYAVGSIVTLVAIMIAFVFALKCFT
Ga0311022_15166581Ga0311022_151665812F052316MVKTRYTGLDLNHMARVRPQGPDGQEIPVSLVYDQVKTAAKFSQQDCKLDSLTDGIDEE
Ga0311022_15171938Ga0311022_151719383F101439MPFYICEHCAFETQDPAKRFCEYCKSELLLKCPFGGRGIEKERTIYCGHCGEKLKISIVPIQ
Ga0311022_15173741Ga0311022_151737411F104139IPSPLLPCQPLHEGWEGVEPASIPSSHSGALHVPEFPWIGPAFPPGTQSLLQAMT
Ga0311022_15176375Ga0311022_151763751F020492MEIQAALLTSAALTVEVDALKQSLERSENELGLAKNQLEDKEGK
Ga0311022_15183548Ga0311022_151835481F073390FLAQSEAALSSEDIKDPSAEASLIGGKIFTDIWDNGGREMAQEIIRKSEKGIHDARKVAEATKKSADPEEQLCID
Ga0311022_15185534Ga0311022_151855342F083289MAGRKGTITVHGDRKVALECEEGDVAYAESACATKELKFYKDNVDPTDMTSLKKPTTENEPAMKFKSADETKLVDFVPGDSSQQFSISANLDPK
Ga0311022_15196025Ga0311022_151960251F002471LKFARDAYTIGRHPSIKDGLGFKREAKDLTCHKAPISTKEKGKAPMAGSAKKNHAFMYHDRRQSRNAYNDRDYDHAMIASSSTYDCSRNRPRRNHVVSHASRRNNVVSHVPRKMCNEPTTVFHTCNTSFILSCKNAKVVARKLGSKCKGDKTCIWVPKTILTNLVGPNKSWVPKTQA
Ga0311022_15206324Ga0311022_152063241F105149MFRKMHQGGSSRKQGPRPAIRDADEEPPRDTQVRPCEWPSEDFMVRAGIKEEFDVYLHNADLESFEADKCHQYLYLTDSYMRRFKFSSSRNSQNVLFDLYDKSYTMDLEDFNIACKLPQWGNVSEPRKSEYRDFLASITVGGSREITQATIGSIHFPAIHYFALFIGRCINGKDEA
Ga0311022_15221462Ga0311022_152214622F096294MSEEIPGKIGEYEDNYIVEMSNSIESLKTKHYRLITQEQYEAELKKAYFAGWEDRNDNELMEIFHKRSRTKEEYFKLFMEELRKKRDNVQVIFTMVYVLWQEK
Ga0311022_15224849Ga0311022_152248492F020828VPLSDQLKQLVELHKVAEQAMKGLIARLWPGEAMPGSYFGLVQRLVDACPWIEVVKRSVCIEGARRALARAKVHWGKLDAEKLLTDAPPPGKEYRMPENYYKGVLKGARR
Ga0311022_15228222Ga0311022_152282223F056463MKTLTMRDLNRKTATVLDALERGETFELRRNGRAIGYLTHTAPEPERKPDWRAHFDWLRKQKGKGGGFVEELNEDRRRRRACEATMEESA
Ga0311022_15236429Ga0311022_152364291F002471ESISSLNSINDDLNTKLEIANKSSSLVEHVVICNRCKDFNIDACVEHLTSIAKLNGEVASLNAQLKTSKNEFDKQKFARDAYTIGRHPSINDWLCFKREAKNLTSQRAPIFNKEKGKAPMANSSQKNHAFIYDRKFSRNAYHNRSCNAYDSNAMIASSSSFVHGRDMPRKNVIHVPRKASNEPSTIYHACNASFAICRKNKKVIARKLGAKCKGDKTCIWVPKTIVTNLVGPNKSWVPKTQA
Ga0311022_15236939Ga0311022_152369391F081962MLTKLKAVYTLVEQLYTGSQRALSVVALSNEVPTHLADVLRRLAVLPQRFQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQKDFAACVKSVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEAVSLIPPTRKHTFAPEVDPAGLIDDEAQFEALSGIDWKSSTFQVMGTAGGAERDEPGASTQQAP
Ga0311022_15239557Ga0311022_152395571F005658MAWGEKEHSAHPVPTPCYVQGRQPAAQAAQSHIQPGLECL
Ga0311022_15242127Ga0311022_152421271F035626MASSIVNNTVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTSDIRGYLIFDGFEPLPCAPRGRDEYDLALPSNRI
Ga0311022_15245008Ga0311022_152450081F035108MSAGMLTGHPAEEMPGSAGDLLPELSQLHEQVRQVMQGIAQALWPSASPPGGMGELIEKLKGARRRFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPVGPDGKEIPTSLVYDQVKLASKYSQQDCRLDSTLDGIEEEFSQSK
Ga0311022_15259528Ga0311022_152595281F054980PRSGGHRCFHHPVGRCFIMAEAKKKKTSKGPAKKTGTTRKEKEPAITRQEAEQIARAYLADKGVFSISGVADGAPVGFEAYFAANETLAAALRDCWVVECGLDPFLVVDGGTMLIGVSKATGDVVYAGILQVA
Ga0311022_15271842Ga0311022_152718421F079404VWRVAGTGYLSGTPKKTSEDWPSEWFYTEDVPLPDPIRIGLPEFDNAPLKKRRSWRPRSPQEEDDRDVLYLMSRIGFLARSGLTMIEVMATCIMRGVRPLQYRGHPMWDFNGEDDATRHGRKGPGSAADLIKIVSTLYKGEEDEFLRVNPQGGFSMYNPPSWVSGDFFSPSRFIFL
Ga0311022_15273075Ga0311022_152730751F007510NPRDGGAGRAAVHGVTKRWTRLSNFSFPFHFHALEKEMATHSSVLAWRIPGTGEPAGQLSMGLHRV
Ga0311022_15287658Ga0311022_152876581F038012MIIEFQLPCYVQGRQPPDQAAQSHIQPGLECIQGWDIHSVLGQPVPV
Ga0311022_15291694Ga0311022_152916942F028541MDEKERLNLVNRLKTVKTSEERDQILWYLAGQDKAARGKAQRAEPTGTGKPAPGKTEEKPRVSLPVGKLGGVGSFTALLFLFYGLVSIVTAVMKILQGQMEGDEIKQLIMGGLFLLFGVVIYVRARRAQRKTAEET
Ga0311022_15301223Ga0311022_153012231F035626MAPSIIYNDAVQGEVFLPGQIFVFGSFALRANSLGHLEQIESYAPSHQVRFGSLNYATDIRGDLIFDGFETTAAAACHHDEHDVKCHQSIR
Ga0311022_15315213Ga0311022_153152132F023356MSENSLKKAVLESRASAAEAEAMSTELKKSKVITLRVEEPLFKAIEAQAELWKVKPAETIRRVLWFYFLPAALEMQVSGESEKFWKGELTPEAAGEYMVFTLEAVEKLRSSAMFLSREALRLREAMEGKLSEAVEMVRKALEHNE
Ga0311022_15316945Ga0311022_153169452F096317VNKQASLLAAAARTAEVSGLKRDLERTEGELGLVKRQLEENKGT
Ga0311022_15324171Ga0311022_153241711F028669MYARREIKKQQVKWWSDQFITNVNKRDEERGGWTLLRIGVMGKGRRAIEKIGRSKN
Ga0311022_15324947Ga0311022_153249471F105149MFQGGPSRKQGSRLAIRDADDEPPREAQVRACEWPLEDFMDRAGIKEEFTAYVRNADLVSFEADKCRQDHYLTNSFVRRFEFSSSRNSQTVLFDLYENSYTMDLEDFTTACKLPQWGSTSEPRKSEFRNFLASITVGESRDMAQATIGSINFPAIHYFDLLIGRCINGK
Ga0311022_15329932Ga0311022_153299321F105149RWSFKVQGPRLAMRDADDVPPRDAQVRPCEWPSEDFMDRAGIKEEFNAYLCNADLVSFEEEKCRQYHYLTSSFVRRFEFSSSRNSPTVMFDLYEKSYTMDSEDFTTICKLPQWGSIREPRNSEFRDFLASITVGESRDITQATIGSIHFSAIHYFALFIGRCINGK
Ga0311022_15331824Ga0311022_153318241F062643PSCTSMDVHVGSPPHSGGMMVARTPDQGVALEGSIPTDLELNSAECTELVPAGLLQAASGGGLIPDYQLISPDLGIPSFFSNLQVLCRALI
Ga0311022_15338260Ga0311022_153382601F105149MFRRMFQGGSSRKQGPRLAIRDADEEPPRDAPVRPCEWPSENFMNQAGIKEEFSAYLRNAGLEDFEADKCPQYHDLTSSFLRRFEFSSSRNSPSVMFDLYDKSYTMDLEDFTSACKLPSWGN
Ga0311022_15338769Ga0311022_153387691F032472IESSSVSSPLGLMSPTIIDSDAVQGETFLPGQIFVFGGFAPLANSLGHLEQIESYSPGHQVRFGSLNYTTDIRGDLIFDGFEPQPSAPHYRDGHDLALPPDSAQSAAQVSALTLSSEPTAPVKDGWLDAASGAAISMVIEPNTNLVLHGARDSKVPDSFPDSEYSAPLPIEPHWAPIMDFTTADVFQHLPFGDILNS
Ga0311022_15339923Ga0311022_153399231F002471DAYTIGRHPSIKDGLGFKREAKDLTSHKAPISAKEKGKAPMASSTKKNHAFMYNDRRQSYRSCNAYDAFDSHAMFASSSSYMHGRNVFRRNVVHHMPRRNVVNIPRKVNEPSTIYHACDASFAICRKNRKVIARKLGAKCKGDKTCIWFPKEIVTNLVGPKKSWCHTRVWS
Ga0311022_15346808Ga0311022_153468082F038084VVWYSHLFKNFPQFVVIHTVKDFGIFNKKVDVFLELSCFLDDPTAFGSLISGSSAFSKPSLNIWKFMVHVLLKPGLENFEHYFASM
Ga0311022_15356247Ga0311022_153562471F033383QQSEVLPIWGVVKDTQIQSIHSQLHPKAYHDSKPKVMWMHGEPLSSVGNGISMKAIVDLAPLCDAFICMRKEEYPIWNTIKRTFVVPKGNDLEVYKPIEGPLEKLSGEPAVLYIENWRGQRNPLYLCVAMQMVHEKLPNARLHLYNCQDKKMMETFQALIKNNKWWTFIRSIQGPVEDVNKLYNQVDIIVSGLYPLYARGIEAFGAGKAFIGPGYRENGYPYQCELDPRSMADAIIKCWENYRDIDYRAWAVAHHDVNETVRQSVEVYSRYI
Ga0311022_15359129Ga0311022_153591292F005658VSTPCYVQGLQPPDQAAQSHIQPGLECLQGWGIHNILGKPVPSVVPVLC
Ga0311022_15364066Ga0311022_153640661F028765VSTQDSTYASSSDSESSDDDIDYTCLFKGLDRSKIDKINELIDALNEKDRLLEKQEDLLYDEHDKFVEAQKSYALEVKRNEMLSYELSTCHETISTLQGVNNDLNAKLEVANKSNSCVEHVKICTRCKDFDVDACSEHLVLISKLNKEVASLNAQLKTSKNEVDKIKFARDAYTVGRHPSIKDGLGFKREAKNLTSHKAPIFVKEKGKAPMASNAKKNHAFMYYDRRNARNAYNDFDSHVYDSHAMFASSSSYKHDRDMPRRNIAHVPRKNVIHAPRKVVNEPSIIYCALNTSFAICRKDRKIVARKLGAKCKGDRTCIWVPKDICANLAGPNMSWVPKTQA
Ga0311022_15373277Ga0311022_153732773F090057MAVFTHLETDTGTNVDISSATAVGAYTAKGDKLVMCDVSIDAVAGNGDYVMYVTRQIGGSGSAYRILPQTTMAAASGLTAISGQSGWITVRNGDVLTVYVDGLAGDTSTPDWSTRWFELAGVTAAAVADAVWDEATADHTTASSFGSLDANVDSILADT
Ga0311022_15377205Ga0311022_153772051F057793MAKKSITPSIRMNEEEYQKLKALKEEYGISWNKLIKYVNELLEKDMKDNGY
Ga0311022_15378453Ga0311022_153784532F034976GVLVINVSDAQPVRCQKCGNPVGYITVLAKGLMGLQQPVPNVKVVAICMECAQKRK
Ga0311022_15386367Ga0311022_153863671F096317VNKQASLLAAAAATVEVSRLRQSLGWAEEELSLVKR
Ga0311022_15387672Ga0311022_153876721F076748MRFIQLPGDSPTLYVSKLSFLQSVSSWFDWNDEEAVLFPNWETGIVEKNAL
Ga0311022_15401539Ga0311022_154015391F032472QFGTPYPRSAGFDTDIGAFIESSSVSSPSGLMAPTIIIGDAVQGETFLPGQIFAFGGFALRANSLGRLEQIKSYAPGRQVRFGSLNYTADIRGDLIFDGFEPLLNAPHCHDEHDLALPPNSALEAAPASTSTLNSEPTAPIEDGWLDAAWGAAIPTAIEPNTSPALCETH
Ga0311022_15402435Ga0311022_154024352F020492NKYVNMGLQAALLTSAALSAEVNVLKESLERSENELGQAKKQLEDKEGKKYLIEN
Ga0311022_15405875Ga0311022_154058751F059631PKIVSGQQAECGGAIVGKMPNVTWPDGSFAETVKGWQSGWVYITEPRGADWAPAPEFRSGAPMRLTSWEKKGLSWGDSTELARLQTCVKSMKDQNIKLVNVIQVMLVHRILPCQRQAVNLWEFVPTEHQTLQRLYDMTHKGTWKVLFKASEVPPPTSNDRGLHAARAPRPV
Ga0311022_15408447Ga0311022_154084471F032472VFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTANIRRDLIFDGFEPWRSVPLCPDGHNLTLPPDGAQSAAQESAPIISSEPTVLVGDGRLDAAPGSAISTAIEQNTSLALCKARDSKVPDSVPDSESSTPLPIEPNWAPIIEFTDADVFQHSPFGDFLNSLKSLSL
Ga0311022_15408575Ga0311022_154085751F033854MAAEGQCDKIMSDMEVCMKQRCVSPFLHMEKMAPTDIHRCLLKVYRDQAVELSTAGVMRFSDGNSGS
Ga0311022_15413256Ga0311022_154132562F006329PTDPIVERLNLVEEENNLLKEKIRKIEEEKMILKLHVADVVDDHKIKMDAMRLKIKKIRKYVIHTEAWYHYAGGSVVTLVAVMIAFVFALKCFT
Ga0311022_15416098Ga0311022_154160981F002994SQEDLLIKENKKHVKVKNAYALEVEKCEKLTSELNTCHEIVANLRNENARLIAKVDANVCDDSISNLRNDNASLLAKIEKLNTSLASLRIENEKLITKAKDLDVCNASISDLRSENDILHAKIVELKTCKPSTSTVEHVSICTRCRDINVDAIHDHLALIKKQNDHIAQLNA
Ga0311022_15422090Ga0311022_154220901F032472LPGQIFVFGGFALQANSLGHLEQIEGYTPGHQVRCGSLNYTADIRGDLIFDGFEPWPSTPHYHNGHDLALPPDNAQSVAQVPAPTISSEPTAPVGAGRLDAAPGAAISTVIEPNTSLVLCEAYDSRVSDSVPNPEPPAPLPIKPDWAPIKEFTATDVFQHSPFGDILNSQS
Ga0311022_15436933Ga0311022_154369331F079778EANYKTQSEIQRNEIENLQKQLAEAKLKYAIAEADRDASDYWKNYWEKIVAELRSSKERCFEKSAECVKKIKTSFANVGAYSSEDNFIRGDPEGPIEWISSEAKAFEEILSDRGDVCAFSGARGIAAILEKSGCEHVKTLAQAEVALCIDDTKDPSVEASLIGGKFFTDIWENGG
Ga0311022_15444507Ga0311022_154445072F003406MTEWFYVKNDLSVREDIKGIIMRPIWQSFGLRRPKVEMNEAAEECQRAFGVICSFIGTRDLVQEHIAFRVWPLAEKWEMPQETIKEADEGGLIRLKYTFKFGDKFVEPDDDWLKSIENLSDELLGAYSKAEDTAMSAAFGGRKKKRLNRVFDAIGFVYPDYCYPIRRQKRKNTSAK
Ga0311022_15444905Ga0311022_154449051F020492MGMQAALLTSAALTAEVNMLKENLERSENELGHAKKQLEEKEGE
Ga0311022_15452518Ga0311022_154525182F060564MALSAFKITPQELILFHHCLCSKICIRIFKTLQLSKNLNVSAIARKAGCNNDRCIEHLKQMENLVIVEEEFYAGRHTFSLRKGEFTDLMAQAISLLEMEEIDGKKNKEDFGPHPR
Ga0311022_15461219Ga0311022_154612192F025938MVVIPDKIVDWFLSAFEDVRDKQFLIGDQLIEIVNATGDKGGTIAYLAGKLGVSASTLYDYYRIAKLWTPEYRAMYQALDWTIYRNADPNDPEDRALLDRCIDEQWSSATFKENKYPALKDPRVIVGRMIALGKRIYEQDTLEIEQREAILLAIRILQEIVHALENPEYLDVKI
Ga0311022_15480760Ga0311022_154807601F027342LTRIRSSLGAFADLPRSVSDAALFYQAEDGSSMEQLFWSQYANAEHPVPMSDQLKQMAELHKAADQAMKGFIVRLWPGDALPNSFFGLVRRLVDACPRLEVVKRSVCIEGARRAFARVKTQWVKLDVVKLIKEGPPEGMEHRHPEMYYEGVLSGAHLIADECSQNVIFE
Ga0311022_15483503Ga0311022_154835033F072819KAQEVSFRIARLEGENAVSELVNWCRNNLDELTVQCFTHKRFMSVQALVDVLCEIYRDLGVEGDKGNVSAFVLFLAGKHRDKIYASHVVELNDTHRQILRDKLGLDIEEIEPGLSKLDWRTDVGI
Ga0311022_15486521Ga0311022_154865211F053764MVNTEIRLIILFAAKDGEALYNQQKQDQGLTVTQIMNSLLSN
Ga0311022_15496929Ga0311022_154969292F067310SLVRVHCKEACEDKMAAIKVANTKRHDFQSFMETFIAAATRIADGIDLDEFIDPASPPPA
Ga0311022_15497026Ga0311022_154970261F032472MASSIINNTVQGETFLPGQIFIFGGFALRANSLGHLEQIESYAPDHQVRFGSLNYTANIHGDLIFDGFEPRPGAPHCLDGHDLALPPDSDQSAVQVFTPTISSEPTVLARDGRLDAAPGAAISAAIEPNTSQVLCKAGNSKVPGSVSDSEYSAPLSIEPDRAPITEFTAADVFQHSPFGDILNSLKSLSLSKEPRPDYGRG
Ga0311022_15500201Ga0311022_155002012F065522MHVGALLLLPCLYSWIVLPSDLISFDYLLIGMTRQIAVLEEKHSRDQAEMAQRCADFEEKYSQSQTELNQVSAALDDANALSSSLHARLDSEKVTYKTVLRLIMLLLLAWILKELIFVCRKKNVSLLLLATIWIDCIEILATR
Ga0311022_15501608Ga0311022_155016081F034384MNMLRLESRVANVTSYLARLKVAVSRIDTSLWPRATFQNDLESLMTRLNEVLGRVQEWKKSFARCAADVALSLVRVHCKEAGEEKLAAIKVANTRRHDFQSFMETFIAAATRIADGIDLDEFVEPASPPPAE
Ga0311022_15501876Ga0311022_155018762F086390LHHNSVSGDLLGGIYATRVANYLNIPIHGNDIELPPSYLDYDAMVCHQFVERNEQFLQYLLIFDRRRTVHVALPAPTFFDFQAKGRYFITREEATEYERRADSARLQAAAHQAIATASLYDPSYNFGYPPGQPWP
Ga0311022_15503447Ga0311022_155034471F076748IPTPMRFIQLPGYFSPLYVSKSSFLQSDSSWFIWNDEEAVLFPNWETGIT
Ga0311022_15509042Ga0311022_155090421F002002PPAMQETQIQSLGQEDLLEEGMATHSCTLAWRIPLIEEPGGLQSKGSQRAEHDQVT
Ga0311022_15509542Ga0311022_155095422F038084VIHTVKAFSVVNKREIDVFLELSCFFDDLMDVGNLISGSSAFSKTSLNIWKYTVHILLKPGLETAEHYFASVSDECNCAVV
Ga0311022_15513364Ga0311022_155133646F066219MKKVFLVLLILCIGCLIHANIVEVFEAIPPVLRYAVGTVITVYALSWAYSWFFDPIIVVADTKYGAFNFGPFIVVEPCIWYSNDVEWRNTVLNHEYTHYVQHAVYGPILSVTYPILALYSNIKSGNQWDDNYWEIQAMQAPDTAPSWKPLAVWVW
Ga0311022_15514412Ga0311022_155144122F020492MRMQAYLLASAVLTAEVDTLKQNLKQSEQELGRAKK
Ga0311022_15515976Ga0311022_155159762F005658MAWVEKDHNAHPVPTPCYVQGHQPADQAAQSHIQPGLE
Ga0311022_15518617Ga0311022_155186171F032472NSLGHLEQIESYAPGCQVRFGSLNYTADIRGDLIFDGFEPLPSAPHYRDEHDLALPPNSALEAAPASASTLNSEPTAPIEDGWLDAASGAAIPTAIEPNTSPALCETRDSKEPDSSPDSEPSAPLPIESDWAPIMEFTAADIFHHSPFGDIMKSLKSLSLSGETWPDYGQRDW
Ga0311022_15518661Ga0311022_155186612F052316EAWAMVKTQYTKADPNHMAQVGPMGPDGKEIPVSLMYGQVELAAKYSQQDSKLDSLLDGIEEEYAESD
Ga0311022_15528842Ga0311022_155288421F035626MPSPQGLMAPSIIGNDVIQGEVFLPGQIFVFGGFVLRANSLGHLEQIESYAPGRQVRFGSLNFTADIRGDLIFDGFEPQPSAPHCHDGHDLALQPDSGL
Ga0311022_15530657Ga0311022_155306571F002471DVANKSNSCIEHIVICNRCKDYNVDACSEHLVSIAKLKDEVANINAQLKTSKNEFDKLKFARDAYTVGRHPSIKDGLGFKREAKNLTSHKAPISAKEKGKAPMANSVQKNHAFIYSDRKFSRNAYRNYSYDSYAMPASSSSIVHDMPKKNVIHHMPRRNVVHVPRKASNEPSTIYHACNASFAICRKDKKVIARKLGAKCKGDKTCIWVPKAIVTNLAGPNKSWVPKTQA
Ga0311022_15536573Ga0311022_155365731F020828VPLSDQLKQLVELHKVAEQAMKGLIVRLWPKEAVPGSYFGLVRRLVDACPWVEVIKHSACIEGACRALARAKVHWGKMDAEKLVTDAPPLGKEYRTPEMYYKTVLKGARTIAGECSKDVIFE
Ga0311022_15541299Ga0311022_155412991F039981GALIFNGSGEEDFLYCLPDSKEFSGCREMGRSFGFPTLEDGLSVLSKDELADSLAYNSLKVRK
Ga0311022_15545075Ga0311022_155450751F027342KKCFMQSKHVEEAFLLLTRIRSSPEAFADLPCSVSDAAKFYRAQEGSSTEKLFSSQYAGAEHPMPLSDQLKQLVELPRAAEVAMKYFIVWMWLGEPLHASYFGLIKQMVNAYPRLEVIKRSICIEGARRAFARTKVHWGKMDAEKLVKDGPPEGKPHRIPKKYMMAL
Ga0311022_15559220Ga0311022_155592202F083289MPGHKGTITVHGSLKIALECEEGDAAYAESVCAAEELKFDKDRVDPADMTSLKKPTTEHGPALKFKSADETKLVDFVPGDSS
Ga0311022_15561660Ga0311022_155616601F054063MAEDMKLRFTQIIMNAWLYGVESTANIFFERPKLFYRRWGSIAIRPFIEAWGELGMEFVKGLSPYETVKMFIDALVKAQFFNQNDFEFGGDDRKFIFKAISCPYKSHCKTLKTENKEIACLRAITLLGALDYNVEGESSKYTYNFEFNIDAPCIVSFERFKD
Ga0311022_15568024Ga0311022_155680241F020828AAEKAMRGLIIRMWPGDSLPNSYFGLVRQLVDSCPRLEVIKRSVCIEGARRAFARAKVHWAKMDTEKLVKEGPLQGKAHPHPKMYYEGVLEGARLVADECAKDVIFE
Ga0311022_15574925Ga0311022_155749251F027437LFEYFLIGMTRQITVLEEKHSQDQAEMTRRCADFEEKYSQSQIELSQVSAALDDANALSSSLHVQLNSEKVAYEPVLRLIMLLDSE
Ga0311022_15579466Ga0311022_155794662F052316MVKTRYTKANPNHMAEVGPVGSDGKDIPVSLVYDQVALAAKYSQQDCKLDSLLDGI
Ga0311022_15581074Ga0311022_155810741F094706VTKPRQLAPTVGRSLDGFEFLNGNFEGLKGYAVGQMTKTRRGKLYIDDAGWGPESGSIEYGYRVPFGGIHVFIGKIGEPGPEPDISTDLVETAQRASPGWVQPAIKRAFVGFIHGVEHEPVSDGETAIYSNGESSTGETESLYQLQDGRIGGYSDGNSIMDPFEPPNRVAIFMAGTQSTLQS
Ga0311022_15589236Ga0311022_155892361F020828WPKEAMPGSYFGLVRRLVDAFPLVEVIKHSSYIEGARRALARAKVHWGKLDAEKLVKDGPPPGKEHRKPELYFDSVLEGSRIVVDQCAKDIIFE
Ga0311022_15596703Ga0311022_155967031F012765YRDSSNSLTILERSHRFTMEELDNQRCELQESANAVTRLMQLISAKDATIKELRASKKSIAQELETARLAAKVAEETAVTLKTQRDKAMDKAIRAGRILMRRPGVVVPEDIRADVIAAPDSSSRPSSSVAPEKDIAK
Ga0311022_15597723Ga0311022_155977231F105149SRKQAPRLAIREPDLEPQREAQVRPCEWLCEEFMLQAGFKDEFDAYVCNADLEDFVLDKCRQYYYLTDSFVRRFNFSSKCNTHTVIFDLYDKSYTMDLEDFNTACKIP
Ga0311022_15597789Ga0311022_155977892F009686MTEREMFEQSFKRPSNYFKLSSRQQWNIDSELGILDWQGDDLSKEDMKRFKEHYN
Ga0311022_15604638Ga0311022_156046381F081962LVEQLYTGSQRALAVVALSNEVPTHLADVLRRLAVLPQRFQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGTPFDQKDFAACVKSVRPVATLIGNDTDLTKYQPGYDAENQRIPTPRYEAVSLIPPTRKHTFAPEVDPAGLIDDEAQFEALSGIDWKSSTFQVMETAGGAERDEPGASTQQAP
Ga0311022_15618197Ga0311022_156181971F034384MFGKYFQLWLFPFDYLLDLVTTLAEFCQNFEEETSRLEPNLDPVNSPVNDEVAMDVFRLESRVAAVVDYLAWLKAATSRIDSTLWPEETLQNDLESLMARLNTIPGRVQEWKKSSARCGADVALCLARVHCKDAREEKLAALRVANTKKHDFRSFMETFLAAAT
Ga0311022_15619986Ga0311022_156199861F020862MKQVFNSVGSSSEKFEPLVEDLPGTFEHIEGEVYALDEVIAGHGDFYALLASRGTAVAFMKTGCTHGKIVNRPNFSLSPADLTDIPSLARSIGNRFITQIWTKGGRNLAGDELEVTSSR
Ga0311022_15637806Ga0311022_156378062F076748NFFLPTPMIFIQLPGDFTPLYVFISSFSQSDSSWFDWNDEEAVLFPNWETGIT
Ga0311022_15638145Ga0311022_156381451F007510MDRGAWRATVHGVAKSRTRLGDFTFTFHFHALEKEVATHSSVLAWRIPGPGEPGGLPSMRSHRVGHDRSDLAAAAAAADGE
Ga0311022_15638649Ga0311022_156386491F063479MGQGGPRDAREDMSERNWAETHWIARSTRGGGRPKSGEVDLGPPVKSGRVRGLGELHGLLAELAEAQVGLEGGWSGLATAAVALAAMAGGNSLAGAKERWLADEGECGAKWSAPGEAL
Ga0311022_15658242Ga0311022_156582421F035626AFIESSTMPSSRGLMAPSTNLNDVFQGEVFLPGQIFIFGGFTLRANSLGHLEQIDSYALGHEVRFGSMNFVADIRGDLIFDRFEPMTAVPGHHNEHDLNQSSGHA
Ga0311022_15660923Ga0311022_156609231F034384VEPGLDPANSLVKDEAAMNVLRLESRVTSVVDYLARLKVAMSRIDTSLWPGTTLQNDLESLMARLNEVPGRVAEWKKSSARCGADVALSLVRVHCKEAREEKLAAIQVAITRKPSFQDFIETFIAAATRIADGIDLDEFVAPTSPPPEE
Ga0311022_15674746Ga0311022_156747461F012765QLLSAKDATIKGLRASKKSIAQELETSQPAVKVAEEAAVTFKAQRDKALDKAIRAGRILMRRPGVAVPEDIKADVNAAPDSSNCPSSSVVPEEDIGK
Ga0311022_15682720Ga0311022_156827201F079778KLRNEALEKDKILLTLVDKVKKDEANFKTQSEAQKIEIEDLRKQLAEAKEKCAVAEAKRGISEQWTNHLEKNIEELRISKERCFEKSMDCVKKIKTSFANVGAYSSEDNFIRGDPEGPIEWISSEAEALEEVLSGRGDVCAFSGARGVAAILEKAWCEHVKTLAQAEASFSIDDTKDPSAEASLIGGKFFTDIWEN
Ga0311022_15686646Ga0311022_156866461F005658MAWVEKDHNDQFQPPCYVQGHQPLDQAAQSHIQPGLECLQGWGIH
Ga0311022_15687857Ga0311022_156878571F005658MAWVEKDHNDHLVPTPCYVQGRQPADQAAQSHIQPGLECLQGWG
Ga0311022_15713750Ga0311022_157137501F007510LLQYSCLENSMDRGAWWAAVDGVAKSRTRLSGLTFTFHFHALEKEMATHSSVLAWRIPGTGEPGGLPSMGLHRVGHN
Ga0311022_15716851Ga0311022_157168511F091813RPSRTSQPEPSADEQKKKRRRLRRVSSFDEDASTLAPAAEEVTATGLADIDPNGCAPPAADPNEDAVCAVAVEDEEEENETPLTRKNSRQFVASGGSSGVPSPALSALIGLQELSMANFDQALEDMVSENLLLEPADVDATEICAAVPDAGLRSSRASSTLEHDLEGRDDDLDRPDPTEVAEGPSTLEV
Ga0311022_15720505Ga0311022_157205051F009131KGQAEAQKREIEDLRKQLARAKEERILEETKRELSDQWADHLEGTVEELRSSKKRCYNKSIECVKKLKASFAKVGAFSSEENLTRGNPEGPIEWIDHEAEAFEEILNSRGDICAFSGARGIATILEKKGCEHVKILAQSEAALSFEDARDPSAEASMIGGKFFTDIWDNGGREMAGEIIQKSEKGIHDAREVAEAAEKSAEPEGQLG
Ga0311022_15721111Ga0311022_157211111F048829LVGQELTKAEKEELKEYAISCGYRPGALHFGGVDDEKLGCIRDQTGAKVIGTLSKSIGFPKLEADISRYRRQHIVGSLFYSNFKVNNLPLTFYFHKKCFVTKVIRVQSMLLSKALR
Ga0311022_15721527Ga0311022_157215271F067310DLESLMTRLNEVPSRVQEWKKSSARCGADVALSLVRVHCKDAREDKLVALRVANTKKHDFRSFMETFIAAATRIADGIDLDEFVAPSSPPQEG
Ga0311022_15721685Ga0311022_157216851F034384MDYLAQLKVAVSRIDTALSPRATFQNDLESLMTRLNEIPGRVREWKKSSARCGADVALSLVRVHCKEAKEEKLAVLKIANTKKLHFESFMETFLEAATRMADGI
Ga0311022_15725613Ga0311022_157256131F105265KALADPVTDALSQHGITLDELARRLRRDLDRKETKILKVKGAVFNWAEYLEREAARLNGQDLPAPAGEKAYRILASSSDETVIAIDVDAISTQVEAREDAQKLLGLYKERLELSGPGGGPLSYDDIPAEERELLLAVARDYERRLNEKNAKRGKPAGKKGRGTRQDRSRAVNGR
Ga0311022_15728633Ga0311022_157286331F059631LEGAFVEIIKGWQSGWFYITESRDPEWATVPEFRSGIPMRLTSWKEKGLLWGSSEELTGLQSCLQTLVNKRLKLVNVIQVMLVRRILPCQQRAFNLWEFDPAQHRTLSGLFDTTYEAVWRVLFKSGEAPASATEDRGFSTQRRPAR
Ga0311022_15734139Ga0311022_157341391F059631KGWQSGWFYITEPRDPKWAAAPEFRSGIPMQLTSWKEKGLLWGSSEELTRLQSCLQTLVNKKLKLVNVIQVMLVRRILPCQQRDFNLWEFDLAQHRTLSGLFDTTYEDAWRVLFKGAEAPASASEDRRFHSQRPADEVSDSTPLWYPHRCPRAR
Ga0311022_15734344Ga0311022_157343441F037171MYVCNRIENDPVEEPEEFAGEAPEQQSVGGGKCPLTYLCPIHYLIHL
Ga0311022_15790828Ga0311022_1579082812F067453MTITRSTGISPGVPWAGPLPGGGYNGKTKRLDRAVARFAEWLGRHFACDVQVRFNSHRLSGGAFIYPGTKGRTTFDTPEIGLGAGLIIPPAVKRRRDRAWRDGTWRRLPNLESEDCWTEQTPLDYNVLAYPEFLRDPSDLGEYTGKRNATFGYWTVPTAQEAYRLLRKLIREEMIKGERNGTCPTPPDRHRKRSANGGLTGKGHAPTCCT
Ga0311022_15809133Ga0311022_158091331F048829FMFQNLVGQELSKTEIEELKEYAKSCGYKPGALLFGGIDDEKLDCIRDQTGAKVIGTLSKSIGFPKLETDISRYRRQHIVGSLFYSNFKVNYFSLDFYCF
Ga0311022_15809233Ga0311022_158092331F063479HQLALSTRGGERPKSGEVDFGPPVKSGLVRGLGKLHGPLAELAEALARLGGGWSGLATVAEALAAMAGGIELAGAKERWLAGEGEPGVK
Ga0311022_15825072Ga0311022_158250722F083289EEGDAAYAESVCATEELTFYKEQVEPSDMTSLKKPTTEHDPALKFKSAIDTKMVDFVPGDSSKQFSISANLDPK
Ga0311022_15825800Ga0311022_158258001F004815FKARLDVALGSLGCWLVTLHIAGGWNCMSIVVLFKPGHSMI
Ga0311022_15831973Ga0311022_158319732F020492MQAVLLTSATLTAEVDALKQNLERSESELGRAKKQLEDKEDD
Ga0311022_15835800Ga0311022_158358001F033754LKDSIKGWRLEWFIVENHGSSLPPRSGRQPDVRTPSWTESPTDQEVAEAGALLAEVGLLKERGLTVEAVVADFVFKNIQPLKDRAYPAYLYRGLADPTRVTNRRILAVDLVSRLEMILRGKVSNVGAPIAYLAWNLPPSKAFTHFVSNPPVADGSLGLRVRPSAEEVSALVASIGEIPDDERQVHFEVPLDPNDAEINAMLDMLAEDSSDATPAGTMAVVPLPEAGTT
Ga0311022_15850790Ga0311022_158507901F052316MVKTRYAKADPNHMAKVGPAGPDGQEIPVSLVYDQVALAAKYSQQDCKLDSLLDGIEEEYDQSI
Ga0311022_15852152Ga0311022_158521522F027342KKIAAGKAFFMQSRNIKVNYLLLTRIRSSPGAFADLPRSVSDAAAFYRAEEGSSTEKVFWSQYSEAGHPVPLSDQLKQLVELHKAAEQAMKGFIVRLWPGEALPGSYFGLVRRLVEACPRLEVIKRSICIEGARRALARAKVHWGKLDGEKLVKDGPPPGKEHRKPENYYKDVLAGARLVADECTKDVIFE
Ga0311022_15860819Ga0311022_158608191F004001VGYWHRLPGEVVESPSLEVSKKRVDVALRDVVSGHGGDVMMIGLDDLSGLFQP
Ga0311022_15863917Ga0311022_158639171F012765MSRLRQLVSSKDSIIKDLCASKRSVIQELEAARLAVKAAEDTSATLKAQRDKAMDKAIRAERILMRRPSVVVPDDIVADMNAAPDSSSRPSSSVALEKNITK
Ga0311022_15866195Ga0311022_158661951F032472VTIRLDAQFGTPYPRSTGFDTDIGAFIESSSVSSPLGPMASSLVNHDAVRDEIFLPGQIFVFGGFALRADSFGHLEQIECYAPGHQVRFESLNYTADIRGDMIFDGFGPQPSAPHRLDGHDLALQPNSALEAAPVSAPTLNPEPDSPIEDEWLDTASGALISTAIEPNSIPVLCEDLDSRVPDSCPDSEPSAPLPIESDWAPVMEFTAADIFQHSALATS
Ga0311022_15867138Ga0311022_158671381F083289VHGDRKVALECEGGDAAYTESACATEELKFYKDNVDPADMNHLKKPSTEQDPLLKFKSADDNKQVDFGPSD
Ga0311022_15867747Ga0311022_158677472F062643HSGCMVVAQALDQGVALEGSVPADRVLGSVDGTELIPAGSLQAASGSGLTPGYQLISPDLGIPSFFSNLQVL
Ga0311022_15872706Ga0311022_158727061F079404AHFGLWKRLFCLVPRSKEGSVYQVGVAEVWRIAGTGYLSGTPKKASEDWPSEWFYIEDVPLPDPIRISLPELNDAPLKKRLSWRPWSPQKENDRDVLYLMSRIRLLAHSGLTMIGVMATCIMRGVQPLQYRGRPMWDFNGEDDATRHGRKGPDSAAALIKTLSALYKGEEEEFLRVNPQGGFSMYNPPSWVSGHFYLSIHFIFPLLNF
Ga0311022_15874073Ga0311022_158740731F079404SGTPKKTSEDCPSEWFYMEDVPLADPVRIGLPEFDNAPLKKHLSWRPRSPQEEDHRDVLYLIGRIKVLAQSGLAITEVMSICIMRGVQPLQYRGHPMWHFNGEDDATLYGCKGPDSVAIQAKILSDLYKGEEQDFLLNKPRDGFSMYNPPSWVSYHFLYPPLLHFCHKYFILPFHRRNCVKR
Ga0311022_15879136Ga0311022_158791361F035108MLTGRPVEEMPVSTGDQLPELLQLIERVRQAMSGVIQALWPAFSLPEGLGELAEKLQGVRQRFHLWKISACRQGAREAWAMVKTRYKKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKFSQQDCKLDNLLDGIEEEYNQSI
Ga0311022_15883657Ga0311022_158836571F034384LDPINSPVKDEVAMNMLRLESRVAVVVDYLARLKVATSRIDKTLWPRETLQNDLESLMTRLNEVPSRVQEWKKSSARCGADVALSLVRVHCKDAREDKLVALRVANTKKHDFRSFMETFIAAATRIADGIDLDEFVAPSSPPQEG
Ga0311022_15900039Ga0311022_159000391F076748MPTPMRSIQLPGDSPPLYVSKSSFLQSDSSWFDWNDEEAVLFPNWETGI
Ga0311022_15915063Ga0311022_159150631F020828MKGLIVRLWPGEAMPGSYFGLVRRLVEACPRLEVIKRSVCIEGARRALARAKVHWGKLDAEKLVKDGPPPGKEHRKPEMYYEGVLKGARLVVDECSMDVIFQ
Ga0311022_15920299Ga0311022_159202992F052316MVKTRYTKLDPNHMAEVGPAGADGQEIPVSLVYDQVALAAKYSQQDCKLDSLLDGIEEEYSQSK
Ga0311022_15920757Ga0311022_159207571F035626MAPSIIGNEAVQGELFLPGQIFVFGGFVLRANSLGHLEQIDSYAPGHQVRFGSLNYTADIRGDLIFDGFGPMSGAPHSHDEHDLALPSDGVREITPVATPALNP
Ga0311022_15921623Ga0311022_159216231F011632QALEWAAQRGGGVTKPGGVQRVFGCCVEGHGLARTTGEGXMFGVDDPVGLFQP
Ga0311022_15922378Ga0311022_159223781F005658MSWVEKDHSDHPVPTPCYVQGRQPADQAAQSHIQPGLLV
Ga0311022_15925727Ga0311022_159257271F088079MLTEKTIWLENVPFRSIDEAIGGQNCSVYFVESMIVGQSCTFCTSILGNLAPNPYRMLTRLGIFIHICEIYKVDITFFKSNVVSTK
Ga0311022_15939760Ga0311022_159397603F011632SVQALEWAAQRVGGVTDSGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFQP
Ga0311022_15946300Ga0311022_159463001F075851MARVRSTARVTRDGEEAKAAETASISEVMKRSGLVVPEDVSDEGAPATEVEQVGAEEGESEDDYSALPSKPSHLEFGRSTVTEDDMPKLIKLGYFSEAKM
Ga0311022_15946819Ga0311022_159468191F020492MGMQAALLTSAALTAEVDALKKSLERSENELGLAKKQLEDKEGK
Ga0311022_15947171Ga0311022_159471711F028669MYARREIKKQRFKCWSDQFITNVNKGNEERGGRTLLRIGVMGKGRRAIEKIGRSKNCVKW
Ga0311022_15947780Ga0311022_159477801F004001GVIVLEVFKKHTDVALMDMVSRHGGVGLTAGLGDLRGLFQR
Ga0311022_15949428Ga0311022_159494282F052316MGKTRYTKVDPNQMALVGPVGSDGKEIPVSLVYDQVGLAAKYSQKDCRLDSLLDGIEEEAFEFK
Ga0311022_15957362Ga0311022_159573621F067310AEWKKSSARCGADVALSLVRVHCKEAREEKLAAIQVANTRKHSFQDFMETFIAAATRIADGIDLDEFVAPSSPPPEE
Ga0311022_15973047Ga0311022_159730472F076748MRFIQLSGDSQPLYVSKSSFLQSDLSWFDWNDEEAVLFPNFETGIT
Ga0311022_15978340Ga0311022_159783401F003406MEEWFYVKNDLIKREDIKEIIQRPIWSRFGLRRLKVEIDGDVEACQKAFSTICAFIGTRDLIQEHIAFRVWPLVENWEMSKDTVAESSEGGLVRLKYTFRFREKFDEPNDDWLKCIEATRDELLGTYSKAKDDALSAAFGGR
Ga0311022_15978751Ga0311022_159787511F034384VETGLDPINSPVKDETAMNVLRLESCVAGVVDYLARLKVAALRINTTLWPGATLQNDLESLMTRLNEVPGQVQEWKKSSARCSADVALLLVRVHCKEAREEKLAAIKVANTKRHDFQSFMETFIVAATRIPEGIDLDEFVEPAS
Ga0311022_15984808Ga0311022_159848081F011632GQALEWAAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGDGQMVGLDDPVGLFQPY
Ga0311022_15987123Ga0311022_159871231F001813VESVQGVFGCCVEGYGLMRAIGDGGMVGLGDSVGLFQP
Ga0311022_15987280Ga0311022_159872801F092835MNPGVRLRVGHQHSQIWPILARFMYYYSLYWGSRMISTIEESRVSFMYRSSIILGLSDSGLFHGLLLTVLGSQNAFHGCRTPRSAMC
Ga0311022_15996246Ga0311022_159962461F076748FMPTPMRFIQLPGDSPPLYVSKSSFLQSDSSWFDWNDEEDVLFPNWETGIT
Ga0311022_16023488Ga0311022_160234882F096317MLLAAAARTAEVAELKRDLEQAQGELDLAKRQLEENKGK
Ga0311022_16023806Ga0311022_160238062F014346VVLEKTLESPLDCKEIQPVHSEGDPPWEFFGRTDAKAATPELSPPEAKS
Ga0311022_16026516Ga0311022_160265162F076128MFIEILVLLFFLAASLYLAYQFRLCGQQMEIMQGSNLALTMDLDETRDCLKDTRGENLKLMNELEKTRSDLALTRGELEKTRAALNSC
Ga0311022_16030541Ga0311022_160305412F105149MHRKMYQGDSSRKQGPRLAIREPDDEPPREAQVRPCEWPLEEFMVQAGIKDEFDAYVRNAELEGFVSNKCPQHYYLSDSFVRRFKFTSTQNSHTVLFDIYDKSYTMDLEDFNTACKLPQWGSATEPRKSEYKDFLASITVGDSMEITQATIGS
Ga0311022_16048530Ga0311022_160485301F028669MYARREIKKQRFKCWSDQFITNVNKGDEERGGRTLLWIGVMGKGRRAIEKIERSKNCVKQ
Ga0311022_16053448Ga0311022_160534481F093003LDDDEFVVPEDPVEQERFKRRLNATASSLKKKQQHLRAAQDLLADRWTEVLAAEEYELEHPSKSYPKRRLLPRLEEEAPTSPAHDMADRPPRGCDREASWPSTQAAPHTKAQDYAPDLRDMLEYKARQTRSIYGSRGRPTARDGNRHASHKFGRAEHSRQSSLELRHDIAQYRGAAHPLCFTDEIMDHQIPEGFKPVNIESYDGTTDPAVWIEDYLLHIHMARGDDFDAIKYLPLKLKG
Ga0311022_16066065Ga0311022_160660652F027342VRQELQALMEKHESLERDSKTRESELASALESAKAAKAEAQKALQEIEAMKKIAAGKAFFMQSKHVKVNYLLLTRIRSSPGAFADLPRSVSDAAAFYRAEEGSSTEKVFWSQYAEAGHPVPLSDQLKQLVELHKVAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWIEVVKRSVCIEGARRALARAKVHWGKMDAEKLVTDRPPPGKEYRKPEMYYEGVLKGARLIAGECSKDVIF
Ga0311022_16067294Ga0311022_160672941F105149FMKMYQGGSSRKQAPRLAIRELDLEPPREAQVRPCEWPSDEFIVHAGFKDEFDAYVHNADLEDFVSDKCRQYYYLTDSFVRRFKFSSTRNTHTVLFDLYDKSYTMDLEDSNTACKIPQWGNFSEPRKSEYNDFLAGITARETRNITQPTLGSIHFPAIHYFALL
Ga0311022_16071946Ga0311022_160719463F057793MAKKSVTPSIRMDEDEYQKLKALKEKYNISWNELIKYANKLISEKMNKHES
Ga0311022_16075800Ga0311022_160758001F094706LAPTGGLSHDGFEFLEGSFEGLKGYSVGRMTKSRRGKLYIDNTGWGPEAGSIEYGDRVPFGGIHVFIGKIREPGPEPHMCTDIVKTAQCARPARAQPAMKRAFVGCIHGGEFYEGSVDGGETAVYSDGESSTGETDSLYQLQDGGLGDYSYGSSIPDCLEPSC
Ga0311022_16086428Ga0311022_160864282F089079MAGTSENGDSTPKDFKECASQEQLQATVEKVQDGMNEAIKKAVTDALIELNVSNSIE
Ga0311022_16086809Ga0311022_160868092F039694MKALLAATGRQRETRAGRQADMESNIVDTMRRYFQNDTGKTKGDLEYTILNSVKRYFEGK
Ga0311022_16087303Ga0311022_160873031F076748MRLIQLPCDSPPLYVSKSSFLQSDSSWFDWNDEEAVLFPNWETGIT
Ga0311022_16089243Ga0311022_160892431F014346VLEKTLESPLDCKEIEPVHSEGDQLWVFFGRNDAKAETPVLWPPYVKR
Ga0311022_16099736Ga0311022_160997362F069772MPQETIKEADEGGLVRLKYTFKFGDKFVEPDDDWLKSIETVSDELLGVYSKAEDTALSAAFGGRKKKRLNRVFDAIGFVYPDYHYPVRGQKRKGTVSVKETASAAPSEPAPKRKRVKVLTHRPRYIELATVPEFGNETSSGPEAKESTPLPVATELAEVPTTKELEEPKTLLPETKELAEAPSTEKMEEAKASTEGAKISEILSPSVEIEASKIKKGPTVTPKRKRMVNVLDVLETIKLSSTTPKKTTK
Ga0311022_16117878Ga0311022_161178781F002471LGFKREAKNLTSHKAPIFVKEKGKAPMASNAKRNHAFMYNDKRQSHRSCNAFDSHAYDSYAMFAPSSSYMHGRDMPRKNVHHVPRKNIVHVPRKVMNGPSTIYHALNASFAICRKDRKIVARKLGAKCKGDKTCIWVPKEILTNLVGPNKSWVPKTQA
Ga0311022_16127268Ga0311022_161272681F006329MKLELHVVDVVDDHKIKMDAMHLKIRNVRKYAIHTEAWYQYAIGSIVILVTILIAFVVAFKCFT
Ga0311022_16131090Ga0311022_161310901F005658MAWVEKEHNAHPVPTPCYVQGRQPAAQAAQSHIQPGLECLQGWGIHN
Ga0311022_16131580Ga0311022_161315801F034384VEPSLDPVNSLVKDEAAMNVLRLECRVASVVDYLARLKVAKSRIDTSLCPGTTLQNDLESLMARLNEVPSRVAEWKKSSARCGADVALSLVRVHCKEAREEKLTAIQVANTRKHSFQDFMETFIGAATRIANGINLD
Ga0311022_16140103Ga0311022_161401032F029075VDDGNKSDESASKLSEFGDSGSSVEWTEESSDEDLDYFAALDVAAAEASPHAADAEVVPGPSAGRRRRRAVAKRRVSEVDGGRLRVGRAGKQELLSSPAVASVGEGELRSLFEGEELRIMLFNYREMGIIPKVEPM
Ga0311022_16141722Ga0311022_161417228F004454VVEFREDLHRAIRKQAILNDIKIYQLTNAIVEDFLKDEERVKALIKKLKI
Ga0311022_16143651Ga0311022_161436511F072820MKPLHQVTDDAVTIRGIIDYLEKSVEPVSLHEIAMTQHISNTTALRLCRILEKASIIEHPTVTRIVMGVSQEVPQLAWQLTKPFFLGGCVYNAQELAGGI
Ga0311022_16170555Ga0311022_161705552F038084FVIHTVKGFGPVNKADIDVFLECSCFFDDPVDAGNLISGSSAFSKTCLNIWKFLVNILLKAGLENFEHY
Ga0311022_16172524Ga0311022_161725241F018007MFNGWKITNILDVGLCELDTADGPYNKTGYRLEHREDGFAITVGLMEYISGWSALEILYWLNEKQAIPRRYDNENRRTKRTQ
Ga0311022_16198294Ga0311022_161982942F072820MKPLHQVIDDAVTIRGIIDYLEKSVEPVSLHELAMTQHISNATALRLCRILEKATIIEHPVVTRIVMGVSQEVPQLAWRLTKSFWLGGCVYNAEDLARG
Ga0311022_16213188Ga0311022_162131882F072820MKPLHQVIDDAVTIRGIIDYLEKSVEPATLHELAMTQHISNGTALRLCRILEKASVIEHPTVTRIVMGASQEVPQLAWQLTKSFWLG
Ga0311022_16215215Ga0311022_162152151F007510MAPHSSDGGSWKAAVHGVAEGLKGLNDFTFTFHFHALEREMATHSSVLAWRIPGTGEPGGLLSMGSHRVGHG
Ga0311022_16216581Ga0311022_162165811F068298MLEWAAQESGGVTVPEGVQETFRCDTKGHGLPHLASG
Ga0311022_16220207Ga0311022_162202071F020828EEGSSTEKGFWSQYAEAEHLEPLSDQLTQLVELHKVAEQAMKGLIVRLWPKEAMPGSYFGLVRRLVDACPWVEVLKHSAYIEGARRALARAKVQWGRMDAEKLVTDAPPPGKEYRMPEMYYKGVL
Ga0311022_16224852Ga0311022_162248521F007510MDGEAPKAAVHGVAEGWTQLSDFTFTFHSHALEKEIATHSSVLAWRIPGTGEPGGLPSMGSHRVGHD
Ga0311022_16236579Ga0311022_162365794F084191DEYFRDIGLLKMDERRLRQKRNFELWCEGRDNEIEEVR
Ga0311022_16242106Ga0311022_162421061F002002LGLIWLKNPPAMQETWVQFLGQEDPLKEGMATYSSALAWRIAWTEEPGGLQSMGSQRVRH
Ga0311022_16246197Ga0311022_162461971F076748MRFIKRTGDSQQLYVSNSIFLQSYLSWFVWNDEESV
Ga0311022_16249048Ga0311022_162490481F086390ESREIAQATIGSIHFPAIHYFALFIGRCINGKDEACHMCVPDLCVLKSAVLGDKQYNLGAIVARRLHNNGLVGDLFGGIYATRVANYLGIHVHENDRELPPAYLDYNAMVNHHFLERNEQFLQYRLIFNRRRVVHITLLAPAFFDYQARGGYTIIREKADEYERRAEAACLHTAA
Ga0311022_16249714Ga0311022_162497142F094706GPSHDGFEFLRGSFDGLKGYVVGRMTRRRRGKRYIDPAGWGPEADSIEYGYRVPFGGIHVVIGKIGDPGPEPDTCTDIIETAQRASPSPVQPMAKHVFVGVIHGAEYEDGPASDGETVVCSDDKSSGETELLYQLQDGRIS
Ga0311022_16258009Ga0311022_162580091F059631WFYITESRDPDWAAASEFRSGIPTWLTSWKESGRIWGDSEELTGLQTCIQPLVDKKLKLVNVVQVMLIRRILPCQRRGFNMWEFDPAQHQTLNRLFDSMYEDAWRVLFKGAEAPTSVDEDRGFSTKHHAHAVSCFSPFTGYQFFIV
Ga0311022_16259356Ga0311022_162593561F000459MHVDNVKRGLDRPNLTWEESIKRDLENWSITRELAMDSGAWKLAIYSLHS
Ga0311022_16264015Ga0311022_162640151F027342AFIMQSKHVEETFLLLTRICCSPGVFTDLPHIILDATEFYRAKEGSSTEKLFWSQYAGAEHPMPLSDQLKQLVELHRAAEVAMKDFIVRMWPGEPLPASYFGLIKRMVNACPRLEVIKRSVCIEGARRAFARVKVHWGKLDAEKLVKDGPPEGKVHRYPEKYYDGVMKGACLVAD
Ga0311022_16275414Ga0311022_162754141F052316MVKTRYKKADPNHMAEVGPVGPDGKEIPVSLVYSQVELAAKFSQRDCKLDSLLDGIEEEYNQ
Ga0311022_16275581Ga0311022_162755812F076748FFIPTPMRFIQLPGDSPPLYVSKSSFSQSDSSWFDWNDEEAVQFPNWKTGIT
Ga0311022_16292179Ga0311022_162921791F038003TSSSPVDQEEQTASHPTPFGFSLDPPSGSALADAFVEANPNPLGSRMRSWDQLTDVSTYGPSGSEEDDDPIICRDFSGFGNPSAMRDFMTACDYCLSDCSDGSRSLDDEDGGPSRECFHVELGDPSEGNHLGMPEDGDLPRPEPRADIPWELAVVPVPAGGHDPQLEQVRGA
Ga0311022_16307728Ga0311022_163077282F064744MEVIDGAYQLLLARLMAIEADMADLRERVQELEEALHETWMGGNE
Ga0311022_16308857Ga0311022_163088571F004815AFKARLDVALGSLVCWLVTLHIAGGWNWMSIVVLFNPGRSVIL
Ga0311022_16310190Ga0311022_163101901F039980LQEEKHALVVSRDNLDRLYRDSSNSLTILERSHRFTMEELDNLRCRLQESTDDVIRLRQSISAKDAAIKELRASKKSIAQELEATQLAVKVAEETSITLRAQCDRAMDKAIRAGRILMRRPSVVIPDDIRADVNAAPDSSSRPSSSVAPEK
Ga0311022_16310604Ga0311022_163106042F005658MAWVEKDHNDHPVPTPCCVQGHQPADQAAQSHIQPGLEC
Ga0311022_16310890Ga0311022_163108901F035108VLERTLKKSSARKLADRVMSVGMLTGRPAEEMPGSTGDLLPELSQLHERVRQVMQGVAQALWPSVSIPEGLGELAEKLKGARRRFRLWKISACRQGAREAWAMVKTRYTKADPNHMAEVGPVGPDGKEIPVSLVYGQVELAAKYSQ
Ga0311022_16313360Ga0311022_163133601F086390SRDITQATIGSIHFPAIHYFSLFIARCINAKDEACHMCVPDLSILKSAVLGDQSYHMGAIVARGLHHNRHNGDFFGGIYAARLAHFLEIDIREGDMELPPAYLDYDSMASHQFVERPESPLLYCLIFDKRRVFRITLPSPAFLDSQTKGRYVITREEAEEYERRAEAARLHAAAQQAITTAHQYDPNYSSSSQYDPNNYYYGYPPGQPWP
Ga0311022_16315727Ga0311022_163157272F038084VVIHTVKGFGVVNKAEVDVFLELSCFFDDPVDVGNLISGSSAFSKTSLNVWNFTVHVLLKPGLEKFEHYFASV
Ga0311022_16318737Ga0311022_163187378F021528YLNVPKWNLTLKPLAGGGAVGAFLQLSIPKNYYGNNFYSVGEQGTEAVLSKVEGELKERGVHTNLKEADISRVDTFKNIEPEEPFSCYYSLFSLLKARKAIQRGYGTTFLLSNTQQEFCVYDKLAEMRERQLETGNLPPTMRFEHRLLNKQKVQSVYGLSRVEDIFRGGYQVIREKQVESWKNSLFNFTAEEVVLLGSRQLEQEMRVFKEKFPSNWFSKFLKAYGAYYLASYAGKEVVIEALQAFEADRMKLWRAVQVFEEAEKELLVLKQEEGSSKTLGVLYEELRRKVCLN
Ga0311022_16328614Ga0311022_163286141F067310LVRVYYKEAREEKLVAIKVGNTKRHELQSFMETFIAAATRIADGIDLDEFVEPASPPLVE
Ga0311022_16329505Ga0311022_163295051F001813VTNPRGVQGTFGHYVEGHGLVRSIGDGWMVGLGDPVDLFQP
Ga0311022_16345461Ga0311022_163454612F004001VVESPSMEVFMKRADVALRVVVSGQSGDGLTGGLCVLSGLFQP
Ga0311022_16348209Ga0311022_163482092F102692MDKAIHAGQILMRRPGVIVPDDIRADVNAAPDSSSRPSSSVAPEKNVAK
Ga0311022_16365273Ga0311022_163652732F033854MAAEGQSDKLASDVEVWMKKRCVIEFLHAEKMTLIVIHQHLLNIYGDQRVDVSTVRYGEGTFEQ
Ga0311022_16370866Ga0311022_163708661F002471DHLVSISKLNDELASLNAQLKTSKNEFDKLKFARDAYTIGRIPSIKDGLGYKRETKNLTSHKAPISPMASSVQKNHAFMYYDRIQPRNAYRSCNAYNAFDSHAMFASSSSYVHDRNVGRRNIVHNMPRRNVVNVPRKVNEPSTIYHALNASFAICRKDRKIVARKLGAKCKGDKTCIWVPKDICTNLVGPNMSWVPKTQ
Ga0311022_16382202Ga0311022_163822021F036769MKRICVLLFVAIAALFVLTPVPADISAAQPQDILTGNWVLKFEDGREGWASLAADNYPKTGFSSKGKAGGPGFKPGDLTSSVVPEHYREGQVILYNAQAQQRPFHFIRFFLETKCAVE
Ga0311022_16383662Ga0311022_163836622F020492MGLQAALLTSAALTADVGALKQDLERSEQELGLAKKQLEDKEGE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.