Basic Information | |
---|---|
Family ID | F036104 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 170 |
Average Sequence Length | 35 residues |
Representative Sequence | MGQDGIPLSIGIIIAAAILGATFIAGMVLLAILFA |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 170 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 94.12 % |
% of genes near scaffold ends (potentially truncated) | 4.71 % |
% of genes from short scaffolds (< 2000 bps) | 64.71 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.57 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (89.412 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface (23.529 % of family members) |
Environment Ontology (ENVO) | Unclassified (27.059 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (28.235 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.86% β-sheet: 0.00% Coil/Unstructured: 57.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 170 Family Scaffolds |
---|---|---|
PF00137 | ATP-synt_C | 33.53 |
PF00430 | ATP-synt_B | 21.18 |
PF00213 | OSCP | 11.18 |
PF00119 | ATP-synt_A | 11.18 |
PF02577 | BFN_dom | 3.53 |
PF09527 | ATPase_gene1 | 2.94 |
PF02874 | ATP-synt_ab_N | 2.94 |
PF00231 | ATP-synt | 1.76 |
PF05239 | PRC | 1.18 |
PF13286 | HD_assoc | 1.18 |
PF13247 | Fer4_11 | 1.18 |
PF02896 | PEP-utilizers_C | 1.18 |
PF02823 | ATP-synt_DE_N | 1.18 |
PF13662 | Toprim_4 | 0.59 |
PF16177 | ACAS_N | 0.59 |
PF01326 | PPDK_N | 0.59 |
PF00027 | cNMP_binding | 0.59 |
PF00886 | Ribosomal_S16 | 0.59 |
PF04023 | FeoA | 0.59 |
PF00076 | RRM_1 | 0.59 |
PF12675 | DUF3795 | 0.59 |
PF13404 | HTH_AsnC-type | 0.59 |
COG ID | Name | Functional Category | % Frequency in 170 Family Scaffolds |
---|---|---|---|
COG0636 | FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit K | Energy production and conversion [C] | 33.53 |
COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 21.18 |
COG0356 | FoF1-type ATP synthase, membrane subunit a | Energy production and conversion [C] | 11.18 |
COG0712 | FoF1-type ATP synthase, delta subunit | Energy production and conversion [C] | 11.18 |
COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 3.53 |
COG0224 | FoF1-type ATP synthase, gamma subunit | Energy production and conversion [C] | 1.76 |
COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 1.18 |
COG0228 | Ribosomal protein S16 | Translation, ribosomal structure and biogenesis [J] | 0.59 |
COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.59 |
COG1918 | Fe2+ transport protein FeoA | Inorganic ion transport and metabolism [P] | 0.59 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 89.41 % |
Unclassified | root | N/A | 10.59 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001687|WOR8_10011666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 8836 | Open in IMG/M |
3300001751|JGI2172J19969_10034858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1774 | Open in IMG/M |
3300001751|JGI2172J19969_10053421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1318 | Open in IMG/M |
3300001782|WOR52_10024713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 6281 | Open in IMG/M |
3300002052|SMTZ1_10009759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 13951 | Open in IMG/M |
3300002053|SMTZ23_10034087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 6990 | Open in IMG/M |
3300002481|JGI24020J35080_1016178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1595 | Open in IMG/M |
3300005645|Ga0077109_1000701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 18992 | Open in IMG/M |
3300005645|Ga0077109_1063347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1140 | Open in IMG/M |
3300005782|Ga0079367_1039350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 2071 | Open in IMG/M |
3300005822|Ga0078744_1032674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1158 | Open in IMG/M |
3300007351|Ga0104751_1223779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 649 | Open in IMG/M |
3300008516|Ga0111033_1100528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 5330 | Open in IMG/M |
3300008516|Ga0111033_1233029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 9485 | Open in IMG/M |
3300009009|Ga0105105_10324023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 839 | Open in IMG/M |
3300009034|Ga0115863_1004915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 20372 | Open in IMG/M |
3300009034|Ga0115863_1032709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 6895 | Open in IMG/M |
3300009034|Ga0115863_1034636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 6664 | Open in IMG/M |
3300009034|Ga0115863_1037638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 6343 | Open in IMG/M |
3300009034|Ga0115863_1535519 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1335 | Open in IMG/M |
3300009034|Ga0115863_1609344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1235 | Open in IMG/M |
3300009034|Ga0115863_1641457 | Not Available | 1197 | Open in IMG/M |
3300009034|Ga0115863_1683875 | Not Available | 1152 | Open in IMG/M |
3300009127|Ga0118724_1000719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 47445 | Open in IMG/M |
3300009127|Ga0118724_1026412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 5144 | Open in IMG/M |
3300009127|Ga0118724_1086875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1919 | Open in IMG/M |
3300009127|Ga0118724_1133325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1352 | Open in IMG/M |
3300009127|Ga0118724_1278297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 708 | Open in IMG/M |
3300009127|Ga0118724_1294294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 641 | Open in IMG/M |
3300009136|Ga0118735_10001869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 7349 | Open in IMG/M |
3300009136|Ga0118735_10167589 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300009136|Ga0118735_10338647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 524 | Open in IMG/M |
3300009150|Ga0114921_10003476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 7740 | Open in IMG/M |
3300009150|Ga0114921_10004610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 6914 | Open in IMG/M |
3300009150|Ga0114921_10022623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 3645 | Open in IMG/M |
3300009150|Ga0114921_10041137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2841 | Open in IMG/M |
3300009150|Ga0114921_10097933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1943 | Open in IMG/M |
3300009150|Ga0114921_10204238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1380 | Open in IMG/M |
3300009150|Ga0114921_10216041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1344 | Open in IMG/M |
3300009150|Ga0114921_10413914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 977 | Open in IMG/M |
3300009150|Ga0114921_10423522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 966 | Open in IMG/M |
3300009150|Ga0114921_10970920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 633 | Open in IMG/M |
3300009311|Ga0117906_1105062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 978 | Open in IMG/M |
3300009488|Ga0114925_10057538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 2364 | Open in IMG/M |
3300009488|Ga0114925_11155645 | Not Available | 567 | Open in IMG/M |
3300009499|Ga0114930_10034088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 3296 | Open in IMG/M |
3300009528|Ga0114920_10050140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2522 | Open in IMG/M |
3300009528|Ga0114920_10081904 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
3300009528|Ga0114920_10139244 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
3300009528|Ga0114920_10372515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 968 | Open in IMG/M |
3300009528|Ga0114920_10644881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 724 | Open in IMG/M |
3300009528|Ga0114920_10814487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 639 | Open in IMG/M |
3300009528|Ga0114920_10879262 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 614 | Open in IMG/M |
3300009528|Ga0114920_11056671 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300009529|Ga0114919_10044753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 3294 | Open in IMG/M |
3300009529|Ga0114919_10212056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1377 | Open in IMG/M |
3300009529|Ga0114919_10266621 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
3300009538|Ga0129287_10501043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 546 | Open in IMG/M |
3300009538|Ga0129287_10527572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 531 | Open in IMG/M |
3300009874|Ga0131789_10057347 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
3300010284|Ga0129301_1000838 | All Organisms → cellular organisms → Bacteria | 16205 | Open in IMG/M |
3300010324|Ga0129297_10182518 | Not Available | 968 | Open in IMG/M |
3300010324|Ga0129297_10541929 | Not Available | 508 | Open in IMG/M |
3300010328|Ga0129298_10036591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 2345 | Open in IMG/M |
3300010413|Ga0136851_10185457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2153 | Open in IMG/M |
3300010995|Ga0139323_146515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 711 | Open in IMG/M |
3300010996|Ga0139308_116424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1010 | Open in IMG/M |
3300011340|Ga0151652_11218612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1052 | Open in IMG/M |
3300011340|Ga0151652_12856919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1031 | Open in IMG/M |
3300012931|Ga0153915_13184858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 533 | Open in IMG/M |
3300012964|Ga0153916_11253709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 819 | Open in IMG/M |
3300012964|Ga0153916_11668471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 711 | Open in IMG/M |
3300012964|Ga0153916_11956716 | Not Available | 657 | Open in IMG/M |
3300013086|Ga0163202_1004132 | All Organisms → cellular organisms → Bacteria | 2732 | Open in IMG/M |
3300013089|Ga0163203_1001920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 5856 | Open in IMG/M |
(restricted) 3300013127|Ga0172365_10072565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 2232 | Open in IMG/M |
(restricted) 3300013128|Ga0172366_10531855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 702 | Open in IMG/M |
(restricted) 3300013128|Ga0172366_10693407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 598 | Open in IMG/M |
3300015370|Ga0180009_10171667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1012 | Open in IMG/M |
3300015370|Ga0180009_10323814 | Not Available | 634 | Open in IMG/M |
3300017963|Ga0180437_10007831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 13782 | Open in IMG/M |
3300017963|Ga0180437_10453298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 951 | Open in IMG/M |
3300017963|Ga0180437_10732927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 715 | Open in IMG/M |
3300017963|Ga0180437_10746887 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300017971|Ga0180438_10413014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1020 | Open in IMG/M |
3300017989|Ga0180432_10224073 | All Organisms → cellular organisms → Bacteria | 1484 | Open in IMG/M |
3300020074|Ga0194113_10113435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 2337 | Open in IMG/M |
3300020083|Ga0194111_10898993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 526 | Open in IMG/M |
3300020814|Ga0214088_1388637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1865 | Open in IMG/M |
3300020814|Ga0214088_1431030 | Not Available | 862 | Open in IMG/M |
3300021603|Ga0226659_10327629 | Not Available | 682 | Open in IMG/M |
3300022221|Ga0224506_10028855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 2906 | Open in IMG/M |
3300022221|Ga0224506_10381841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 623 | Open in IMG/M |
3300022223|Ga0224501_10148247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1348 | Open in IMG/M |
3300022551|Ga0212089_10235488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 885 | Open in IMG/M |
3300022553|Ga0212124_10002096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 16318 | Open in IMG/M |
3300022553|Ga0212124_10030218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 3359 | Open in IMG/M |
3300022553|Ga0212124_10049544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2489 | Open in IMG/M |
3300024263|Ga0209978_10001511 | All Organisms → cellular organisms → Bacteria | 9941 | Open in IMG/M |
3300024263|Ga0209978_10003318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 7232 | Open in IMG/M |
3300024263|Ga0209978_10004026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 6661 | Open in IMG/M |
3300024263|Ga0209978_10015631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 3670 | Open in IMG/M |
3300024263|Ga0209978_10017234 | All Organisms → cellular organisms → Bacteria | 3502 | Open in IMG/M |
3300024263|Ga0209978_10328733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 757 | Open in IMG/M |
3300024263|Ga0209978_10459021 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 614 | Open in IMG/M |
3300024353|Ga0209979_1079033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1422 | Open in IMG/M |
3300024353|Ga0209979_1091579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1273 | Open in IMG/M |
3300024353|Ga0209979_1170246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 793 | Open in IMG/M |
3300024429|Ga0209991_10130200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1255 | Open in IMG/M |
3300024429|Ga0209991_10242760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 878 | Open in IMG/M |
3300024429|Ga0209991_10481325 | Not Available | 567 | Open in IMG/M |
3300024433|Ga0209986_10000066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 87830 | Open in IMG/M |
3300024433|Ga0209986_10157769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1168 | Open in IMG/M |
3300024433|Ga0209986_10541226 | Not Available | 506 | Open in IMG/M |
3300025309|Ga0209212_1210464 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
3300025313|Ga0209431_11253585 | Not Available | 503 | Open in IMG/M |
3300025326|Ga0209342_10355235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1256 | Open in IMG/M |
3300025824|Ga0208325_1153656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 522 | Open in IMG/M |
3300027051|Ga0209269_1000098 | All Organisms → cellular organisms → Bacteria | 146121 | Open in IMG/M |
3300027323|Ga0209426_1003248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides | 6425 | Open in IMG/M |
3300027690|Ga0209164_1169289 | Not Available | 763 | Open in IMG/M |
3300027740|Ga0214474_1245383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 644 | Open in IMG/M |
3300027888|Ga0209635_10150516 | Not Available | 1905 | Open in IMG/M |
3300027888|Ga0209635_10163010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides | 1822 | Open in IMG/M |
3300027888|Ga0209635_10865132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 641 | Open in IMG/M |
3300027893|Ga0209636_10299136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1418 | Open in IMG/M |
3300027893|Ga0209636_10426930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1119 | Open in IMG/M |
3300027893|Ga0209636_11229354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 525 | Open in IMG/M |
3300027893|Ga0209636_11251051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 518 | Open in IMG/M |
3300027901|Ga0209427_10006569 | All Organisms → cellular organisms → Bacteria | 13250 | Open in IMG/M |
3300027917|Ga0209536_101741768 | Not Available | 753 | Open in IMG/M |
3300028156|Ga0268281_1111682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 617 | Open in IMG/M |
3300028161|Ga0265596_1030034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1644 | Open in IMG/M |
3300029693|Ga0257137_1039189 | Not Available | 796 | Open in IMG/M |
3300029799|Ga0311022_12665047 | Not Available | 1093 | Open in IMG/M |
3300030714|Ga0307925_130762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 579 | Open in IMG/M |
3300031257|Ga0315555_1014376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalogenimonas → Dehalogenimonas formicexedens | 4796 | Open in IMG/M |
3300031257|Ga0315555_1108362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1258 | Open in IMG/M |
3300031365|Ga0307443_1009624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 4274 | Open in IMG/M |
3300031539|Ga0307380_10204971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1901 | Open in IMG/M |
3300031551|Ga0315548_1045271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2094 | Open in IMG/M |
3300031566|Ga0307378_10602213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 964 | Open in IMG/M |
3300031566|Ga0307378_11083061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalogenimonas | 645 | Open in IMG/M |
(restricted) 3300031587|Ga0315308_1080074 | Not Available | 1382 | Open in IMG/M |
(restricted) 3300031593|Ga0315307_1025137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2406 | Open in IMG/M |
(restricted) 3300031604|Ga0315309_1089649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1335 | Open in IMG/M |
3300031624|Ga0315545_1071669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1694 | Open in IMG/M |
3300031707|Ga0315291_11096292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 661 | Open in IMG/M |
3300031862|Ga0315280_10004985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 19256 | Open in IMG/M |
3300031862|Ga0315280_10010283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 11773 | Open in IMG/M |
3300031862|Ga0315280_10014316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 9272 | Open in IMG/M |
3300031862|Ga0315280_10028760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 5511 | Open in IMG/M |
3300031862|Ga0315280_10211489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1086 | Open in IMG/M |
3300031862|Ga0315280_10408370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 623 | Open in IMG/M |
(restricted) 3300031876|Ga0315310_10246575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 776 | Open in IMG/M |
(restricted) 3300031877|Ga0315314_1075575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1500 | Open in IMG/M |
(restricted) 3300031898|Ga0315312_1020784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 3033 | Open in IMG/M |
3300031999|Ga0315274_10004942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 19558 | Open in IMG/M |
3300031999|Ga0315274_10332787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1795 | Open in IMG/M |
3300032020|Ga0315296_10000215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 54588 | Open in IMG/M |
3300032020|Ga0315296_10002711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 14968 | Open in IMG/M |
3300032020|Ga0315296_10013991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 5938 | Open in IMG/M |
3300032020|Ga0315296_10014186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi | 5890 | Open in IMG/M |
3300032020|Ga0315296_10171042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1322 | Open in IMG/M |
3300032046|Ga0315289_10352918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1490 | Open in IMG/M |
3300032118|Ga0315277_11276255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 646 | Open in IMG/M |
3300033486|Ga0316624_10427705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 1115 | Open in IMG/M |
3300033487|Ga0316630_10479035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1014 | Open in IMG/M |
3300033513|Ga0316628_101081949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 1066 | Open in IMG/M |
3300033991|Ga0334965_0005086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia | 8171 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 23.53% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 15.29% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 7.65% |
Sediment, Intertidal | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal | 4.71% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 4.12% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.53% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 3.53% |
Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment | 2.35% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.35% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 2.35% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 2.35% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.35% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.76% |
Marine Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment | 1.76% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.76% |
Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 1.76% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.18% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 1.18% |
Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 1.18% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.18% |
Marine Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment | 1.18% |
Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal Fluid | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal Fluid | 1.18% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.18% |
Brackish Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water | 1.18% |
Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 1.18% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.18% |
Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 1.18% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.59% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.59% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.59% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.59% |
Hot Spring Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat | 0.59% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.59% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.59% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.59% |
Deep Subsurface Aquifer | Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer | 0.59% |
Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 0.59% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001687 | Deep Marine Sediments WOR-3-8_10 | Environmental | Open in IMG/M |
3300001751 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 | Environmental | Open in IMG/M |
3300001782 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_deep_samples | Environmental | Open in IMG/M |
3300002052 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 | Environmental | Open in IMG/M |
3300002053 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZ | Environmental | Open in IMG/M |
3300002481 | Deep oceanic, basalt-hosted subsurface ecosystem from Juan de Fuca Ridge flank, Pacific Ocean, CORK Borehole 1362A_J2.573 | Environmental | Open in IMG/M |
3300005645 | Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m) | Environmental | Open in IMG/M |
3300005782 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf, PM3 | Environmental | Open in IMG/M |
3300005822 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, MM1 | Environmental | Open in IMG/M |
3300007351 | Combined Assembly of Gp0115775, Gp0115815 | Environmental | Open in IMG/M |
3300008516 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf. Combined Assembly of MM3PM3 | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009034 | Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, Korea | Environmental | Open in IMG/M |
3300009127 | Combined Assembly of Gp0137036, Gp0137038 | Environmental | Open in IMG/M |
3300009136 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsf | Environmental | Open in IMG/M |
3300009150 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG | Environmental | Open in IMG/M |
3300009311 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
3300009499 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG | Environmental | Open in IMG/M |
3300009528 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG | Environmental | Open in IMG/M |
3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
3300009538 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2W | Environmental | Open in IMG/M |
3300009874 | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC1T | Environmental | Open in IMG/M |
3300010284 | Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer H metaG | Environmental | Open in IMG/M |
3300010324 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaG | Environmental | Open in IMG/M |
3300010328 | Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG | Environmental | Open in IMG/M |
3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
3300010995 | ECM14MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
3300010996 | ELM11109_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300013086 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_300m | Environmental | Open in IMG/M |
3300013089 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m | Environmental | Open in IMG/M |
3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
3300015370 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaG | Environmental | Open in IMG/M |
3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
3300017989 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaG | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
3300021603 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spades | Engineered | Open in IMG/M |
3300022221 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1 | Environmental | Open in IMG/M |
3300022223 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1 | Environmental | Open in IMG/M |
3300022551 | Boni_combined assembly | Environmental | Open in IMG/M |
3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
3300024263 | Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024353 | Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024429 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025309 | Soil microbial communities from Rifle, Colorado, USA - Groundwater C2 | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025824 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m (SPAdes) | Environmental | Open in IMG/M |
3300027051 | Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes) | Engineered | Open in IMG/M |
3300027323 | Deep oceanic, basalt-hosted subsurface ecosystem from Juan de Fuca Ridge flank, Pacific Ocean, CORK Borehole 1362B_J2.571 (SPAdes) | Environmental | Open in IMG/M |
3300027690 | Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG (SPAdes) | Engineered | Open in IMG/M |
3300027740 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeq | Environmental | Open in IMG/M |
3300027888 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes) | Environmental | Open in IMG/M |
3300027893 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes) | Environmental | Open in IMG/M |
3300027901 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300028156 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_50m | Environmental | Open in IMG/M |
3300028161 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_60m | Environmental | Open in IMG/M |
3300029693 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_50m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029799 | Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119 | Engineered | Open in IMG/M |
3300030714 | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - UN-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031257 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-80 | Environmental | Open in IMG/M |
3300031365 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1601-220 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031551 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-110 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031587 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3 | Environmental | Open in IMG/M |
3300031593 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP2 | Environmental | Open in IMG/M |
3300031604 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP4 | Environmental | Open in IMG/M |
3300031624 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-10 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
3300031876 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5 | Environmental | Open in IMG/M |
3300031877 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9 | Environmental | Open in IMG/M |
3300031898 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP7 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032020 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033991 | Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bact | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
WOR8_1001166610 | 3300001687 | Marine Sediment | MGQDGIPISIGIIIAAAILGACFVLGMVLTAILFA* |
JGI2172J19969_100348583 | 3300001751 | Marine Sediment | MGQDGIPISIGIIIAAAILGACFVLGMVLMAILFA* |
JGI2172J19969_100534213 | 3300001751 | Marine Sediment | MEQQGIPLSISIIIAAAVLGATFIIGMVLFAVLSAM* |
WOR52_100247134 | 3300001782 | Marine Sediment | MGDNGIPLSIGIIIAAAVLGAAFIAGMVLLAILFA* |
SMTZ1_1000975915 | 3300002052 | Marine Sediment | MGEEGIPLSISIIISASVLGATFVSGMVLLAILFG* |
SMTZ23_100340878 | 3300002053 | Marine Sediment | MGDNGIPLSIGIIIAAAVLGAAFIAGMVLLAVLFA* |
JGI24020J35080_10161784 | 3300002481 | Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal Fluid | MGQDGIPVSIGMIIAAAILGACFVLGMVLMAVLFASGGNLG |
Ga0077109_10007019 | 3300005645 | Brackish Water | MGQEGIPLSIGIIIAAAILGATFIAGMVLLAILFV* |
Ga0077109_10633472 | 3300005645 | Brackish Water | MGQDGFPLAIGIIIAAAVLGAAFIAGLVLLAVLAI* |
Ga0079367_10393503 | 3300005782 | Marine Sediment | MGQDGIPLSIGIIIAAAILGATFIAGMVLLAILFV* |
Ga0078744_10326743 | 3300005822 | Marine Sediment | MGQDGIPISIGIIIAAAILGACFVLGMVLMAVLSA* |
Ga0104751_12237791 | 3300007351 | Deep Subsurface Aquifer | MQDGIPLSLGIIIAAAILGTTFVLGMVLLAILGA* |
Ga0111033_11005284 | 3300008516 | Marine Sediment | MGQEGIPLSIGIIIAAAILGVAFVAGMVLSAVLAAI* |
Ga0111033_12330295 | 3300008516 | Marine Sediment | LKEVIMGENGIPLSIGIIIAAAVLGAAFIAGMVLLAVLFA* |
Ga0105105_103240233 | 3300009009 | Freshwater Sediment | MGENGLPLSVGIIIAAAVLGVLLIAGLVLLAILGA* |
Ga0115863_100491512 | 3300009034 | Sediment, Intertidal | MGQDGIPLSIGIIIAAGILGATFIAGMVLLAILLSVV* |
Ga0115863_10327097 | 3300009034 | Sediment, Intertidal | MQQQQDGIPLSIGIIIAAVVLGAAFIAGMVLLAILLV* |
Ga0115863_10346367 | 3300009034 | Sediment, Intertidal | MGQDEIPISIGIIIAAAILGATFILGMVLMAVLSA* |
Ga0115863_10376382 | 3300009034 | Sediment, Intertidal | MGQDGIPLSIGIIVAAAILGATFVAGMVLVAVLSI* |
Ga0115863_15355193 | 3300009034 | Sediment, Intertidal | MGQEGIPLSIGIIIAAGILGATFIAGMVLLAILFST* |
Ga0115863_16093441 | 3300009034 | Sediment, Intertidal | MEQDGIPLSIGIIIAAAVLGATFIAGMVLFAVLSAM* |
Ga0115863_16414573 | 3300009034 | Sediment, Intertidal | MGQDGIPLSIGIIIAAAILGATFIAGMVLLAILFA* |
Ga0115863_16838752 | 3300009034 | Sediment, Intertidal | MGQDGIPISIGIIIAAAILGATFIAGVVLMAILFV* |
Ga0118724_100071931 | 3300009127 | Marine | MGQDGIPLSIGVIIAAAILGATFIMGMVLSAVLGA* |
Ga0118724_10264126 | 3300009127 | Marine | MGQDGIPLSIGIIIAAAILGATFIVGMVLLAVLIA* |
Ga0118724_10868753 | 3300009127 | Marine | MGQDGIPLSIGIIIAAAILGATFIAGMVLMAVLSNT* |
Ga0118724_11333253 | 3300009127 | Marine | MGQDGIPLSIGIIIAAAVLGATFIAGMVLLAVLSA* |
Ga0118724_12782972 | 3300009127 | Marine | MGQDGDGIPLSIGIIIAAAILGATFIVGMVLMAVLSV* |
Ga0118724_12942942 | 3300009127 | Marine | MEQQGIPLSIGIIIAAAVLGATFIAGVVLMAILSV* |
Ga0118735_100018699 | 3300009136 | Marine Sediment | MQQQQNGIPLSIGIIIAAAILGATFISGMVLLAILLAW* |
Ga0118735_101675892 | 3300009136 | Marine Sediment | MEQNGIPLSLGIIIAAAILGATFITGMVLLAILFG* |
Ga0118735_103386472 | 3300009136 | Marine Sediment | MEQDGIPISIGIIIAAAILGATFVAGMVLMAILFV* |
Ga0114921_100034767 | 3300009150 | Deep Subsurface | MEQDGIPLSIGIIIAAGILGATFIAGMVLLAILLSVV* |
Ga0114921_100046104 | 3300009150 | Deep Subsurface | MGQDGIPISIGIIIAATILGATFIIGMILLAVLSA* |
Ga0114921_100226232 | 3300009150 | Deep Subsurface | MGQEGIPLSLGIIIGTAILGATFIMGMVLMAVLGA* |
Ga0114921_100411375 | 3300009150 | Deep Subsurface | MEQNGIPLSIGIIIGAAVLGVTFIAGMVLMAILFA* |
Ga0114921_100979334 | 3300009150 | Deep Subsurface | MGQNGIPLSIGIIIASAILGVMFVGGMVLLAVLST* |
Ga0114921_102042382 | 3300009150 | Deep Subsurface | MEQNGIPLSIGIVIGAAILGVMFVCGMVLMAVLSA* |
Ga0114921_102160412 | 3300009150 | Deep Subsurface | MGQDGIPLSIGIIIAAAILGATFVAGMVLMAILSA* |
Ga0114921_104139143 | 3300009150 | Deep Subsurface | MGEDGIPISIGIIIAAAILGATFVAGVVLMAILFA* |
Ga0114921_104235222 | 3300009150 | Deep Subsurface | MEQNGIPLSIGIVIGAAILGVMFVCGMVLMAVLFT* |
Ga0114921_109709202 | 3300009150 | Deep Subsurface | MEQNGIPLSIGIIIAAAILGVTFVAGVVVMAILLA* |
Ga0117906_11050623 | 3300009311 | Marine | MGQEGIPLSIGLIIGAAILGAALVAGLVIMAVVGAFS* |
Ga0114925_100575385 | 3300009488 | Deep Subsurface | MEQDGIPLSIGIIIAAAILGATFIAGMVLLAILLSA* |
Ga0114925_111556452 | 3300009488 | Deep Subsurface | MEQDGIPLSIGIIIAAVILGAAFVVGMVLMAVLSA* |
Ga0114930_100340884 | 3300009499 | Deep Subsurface | MQQQQDGIPLSIGIIIAAAVLGAAFIAGMVLLAILLA* |
Ga0114920_100501403 | 3300009528 | Deep Subsurface | MGQDGIPISIGIIIAATILGATFIIGMILLAILSA* |
Ga0114920_100819041 | 3300009528 | Deep Subsurface | MTQNGIPLSIGIIIAAVILGATFIAGVVLMAILFAQV* |
Ga0114920_101392443 | 3300009528 | Deep Subsurface | MGQNGIPLSIGIIIASAILGVMFVGGMVPLAVLST* |
Ga0114920_103725152 | 3300009528 | Deep Subsurface | MEQNGIPLSIGIIIGAAVLGVTFIAGMVLMAILLA* |
Ga0114920_106448813 | 3300009528 | Deep Subsurface | MGQDGIPLSIGIIIAAAILGVTFIAGMVLLAILFV* |
Ga0114920_108144872 | 3300009528 | Deep Subsurface | MGQNGIPLSIGVIIAAAILGATFVVGMVLMAVLSA* |
Ga0114920_108792623 | 3300009528 | Deep Subsurface | MGQDGIPLSIGIIIAAAILGVMFVAGMVLMAILSV* |
Ga0114920_110566712 | 3300009528 | Deep Subsurface | MEEGIPLSIGIIIAAAILGVTFVAGMVLLAVLFV* |
Ga0114919_100447532 | 3300009529 | Deep Subsurface | MGQDGIPISIGIIIAAVILGACFVMGMVLMAILFA* |
Ga0114919_102120561 | 3300009529 | Deep Subsurface | MGQDGIPISIGIIIAAAILGVTFVAGMVLMAILFT* |
Ga0114919_102666212 | 3300009529 | Deep Subsurface | MRQDGIPISIGIIIAAAILGATFIAGVVLMAILFT* |
Ga0129287_105010431 | 3300009538 | Beach Aquifer Porewater | MEQQGIPLSIGIIIAAAVIGATFIAGMALMAILSALK* |
Ga0129287_105275721 | 3300009538 | Beach Aquifer Porewater | MEQQGLPVSISIIIAAAVIGVMFAAGMVLLAVLSSK* |
Ga0131789_100573473 | 3300009874 | Sediment | KGVIMGENGIPISVGIIIGAAILGAMTIAGMILMAIIGGAIG* |
Ga0129301_10008382 | 3300010284 | Hot Spring Microbial Mat | MQDGIPLSLGIIVAAAILGATFVLGMVLMAVLFP* |
Ga0129297_101825183 | 3300010324 | Lake Sediment | MGPDGIPVSIGIIIAAAILGASFVLGMVLMAILFA* |
Ga0129297_105419292 | 3300010324 | Lake Sediment | MGQDGIPLSLGIIIAAAILGATFVLGMVLMAVLSA* |
Ga0129298_100365914 | 3300010328 | Lake Sediment | MGQDGIPVSIGIIIAAAILGASFVLGMVLMAILFA* |
Ga0136851_101854575 | 3300010413 | Mangrove Sediment | MGQDGIPISIGIIIAAAILGACFVLGMVLMAVLTA* |
Ga0139323_1465152 | 3300010995 | Sediment | MGQDGIPLSISIIIAAAVLGATFIIGMLLFAVLSAA* |
Ga0139308_1164242 | 3300010996 | Sediment | MNQEGIPLSIGIIVAASVLGAAFIAGMVLLAVLFA* |
Ga0151652_112186122 | 3300011340 | Wetland | MGENGLPLSVGIIIAAAVLGVLVIVGMVLAAILGA* |
Ga0151652_128569192 | 3300011340 | Wetland | MGENSLPLSVGIIIAAAVLGVLVIVGLVLLAILGA* |
Ga0153915_131848582 | 3300012931 | Freshwater Wetlands | MNQDGIPLSLGVVIAAAILGAFIVAGMVIFAVISII* |
Ga0153916_112537092 | 3300012964 | Freshwater Wetlands | MGQDGIPISITIIVAAAILGAAFIAGMVLLAVLFP* |
Ga0153916_116684713 | 3300012964 | Freshwater Wetlands | MGQDGIPVSIGIIIAAAILGACFVLGMVLMAILFA* |
Ga0153916_119567162 | 3300012964 | Freshwater Wetlands | MNQDGIPMSLAAIIAAAILGAAFVAGMVLLAVLFG* |
Ga0163202_10041322 | 3300013086 | Freshwater | MGQDGIPISIGIIIAAAILGACFVLGMVLLAILFA* |
Ga0163203_10019205 | 3300013089 | Freshwater | MGDNGIPLSIGIIIAAAVLGATFIAGMVLLAVLFG* |
(restricted) Ga0172365_100725652 | 3300013127 | Sediment | MNQDGIPLSIGIIIAAVVLGAAFVAGMVLLAVLFV* |
(restricted) Ga0172366_105318552 | 3300013128 | Sediment | MGQDGIPLSIGIIIAAAILGATFIIGMVMLAILSA* |
(restricted) Ga0172366_106934072 | 3300013128 | Sediment | MMGDNGVPLSIGIIIAAAILGAAFIAGMVLLAVLFT* |
Ga0180009_101716673 | 3300015370 | Groundwater | MGQDGIPLSIGIIIAAAILGVTFVAGMVLMAILSA* |
Ga0180009_103238141 | 3300015370 | Groundwater | MGQNGIPIAITIIVAAAILGATFIVGMVLMAVLFT* |
Ga0180437_1000783115 | 3300017963 | Hypersaline Lake Sediment | MGQDGIPISIGIIIAAAILGACFVLGMVLMAILFA |
Ga0180437_104532982 | 3300017963 | Hypersaline Lake Sediment | MGQDGIPVSIGMIIAAAILGACFVLGMVLMAVLFA |
Ga0180437_107329272 | 3300017963 | Hypersaline Lake Sediment | MGQDGIPISIGIIIAAAILGACFVLGMVLMAILFT |
Ga0180437_107468872 | 3300017963 | Hypersaline Lake Sediment | MGENGIPLSIGLIVAAAILGATFVIGMVLMAVLFA |
Ga0180438_104130143 | 3300017971 | Hypersaline Lake Sediment | MGQEGIPLAIGVIVGAAILGVMIVAGFVLLAILST |
Ga0180432_102240732 | 3300017989 | Hypersaline Lake Sediment | MGQDGIPLSIGLVIAAAILGVAFVAGMVLMAVLFV |
Ga0194113_101134353 | 3300020074 | Freshwater Lake | MGQDGIPISIGIIIAAAILGACFVLGMVLMAVLFT |
Ga0194111_108989932 | 3300020083 | Freshwater Lake | MEQGGIPLSLGIIVAAAILGATFVLGMILMAVLSI |
Ga0214088_13886375 | 3300020814 | Granular Sludge | MGDNGIPVTMGVIIAAAVLGAMIIAGLVLLAVFLV |
Ga0214088_14310302 | 3300020814 | Granular Sludge | MNQEGIPLSLGVVMAAAILGAFIVAGMVIFAVFSII |
Ga0226659_103276292 | 3300021603 | Granular Sludge | MNQEGIPLSLGVVIAAAILGAFIVAGMVIFAVFSII |
Ga0224506_100288554 | 3300022221 | Sediment | MGDNGIPLSIGIIIAAAILGATFIAGMVLLAVLLQLTAL |
Ga0224506_103818412 | 3300022221 | Sediment | MEQEGIPLSIGIIIAAAILGATFIAGMVLLAVLFT |
Ga0224501_101482472 | 3300022223 | Sediment | MGDNGIPLSIGIIIAAAILGATFIAGMVLLAVLFS |
Ga0212089_102354882 | 3300022551 | Lake Sediment | MGQDGIPVSIGIIIAAAILGASFVLGMVLMAILFA |
Ga0212124_1000209612 | 3300022553 | Freshwater | MGQDGIPISIGIIIAAAILGACFVLGMVLLAILFA |
Ga0212124_100302185 | 3300022553 | Freshwater | EQDGMPLSIGIIIAAAILGATFIAGMVLLAVLFGA |
Ga0212124_100495441 | 3300022553 | Freshwater | MGDNGIPLSIGIIIAAAVLGATFIAGMVLLAVLFG |
Ga0209978_100015112 | 3300024263 | Deep Subsurface | MEQNGIPLSIGIVIGAAILGVMFVCGMVLMAVLFT |
Ga0209978_100033182 | 3300024263 | Deep Subsurface | MGQDGIPISIGIIIAAAILGATFIAGVVLMAILFV |
Ga0209978_100040262 | 3300024263 | Deep Subsurface | MEQNGIPLSIGIVIGAAILGVMFVCGMVLMAVLSA |
Ga0209978_100156316 | 3300024263 | Deep Subsurface | MGQDGIPISIGIIIAATILGATFIIGMILLAVLSA |
Ga0209978_100172342 | 3300024263 | Deep Subsurface | MEQDGIPLSIGIIIAAGILGATFIAGMVLLAILLSVV |
Ga0209978_103287332 | 3300024263 | Deep Subsurface | MGQDGIPLSIGIIIAAAILGATFVAGMVLMAILSA |
Ga0209978_104590213 | 3300024263 | Deep Subsurface | MEQNGIPLSIGIIIGAAVLGVTFIAGMVLMAILFA |
Ga0209979_10790333 | 3300024353 | Deep Subsurface | MQQQQDGIPLSIGIIIAAAVLGAAFIAGMVLLAILLA |
Ga0209979_10915793 | 3300024353 | Deep Subsurface | MGQDGIPLSIGIIIAAGILGATFIAGMVLLAILLSVV |
Ga0209979_11702462 | 3300024353 | Deep Subsurface | MGQDGIPLSIGIIIAAAILGATFIAGMVLLAILFV |
Ga0209991_101302001 | 3300024429 | Deep Subsurface | MGQDGIPLSIGIIIAAAILGVMFVAGMVLMAILSV |
Ga0209991_102427603 | 3300024429 | Deep Subsurface | MGQDGIPISIGIIIAATILGATFIIGMILLAILSA |
Ga0209991_104813252 | 3300024429 | Deep Subsurface | MGQEGIPLSLGVIIAAAILGATFVAGLVLMAVLLG |
Ga0209986_1000006688 | 3300024433 | Deep Subsurface | MGDNGIPLSIGIIIAAAVLGATFIAGMVLLAILSA |
Ga0209986_101577693 | 3300024433 | Deep Subsurface | MGQDGIPLSIGIIIGAAILGVMFVGGMVLVAILFT |
Ga0209986_105412262 | 3300024433 | Deep Subsurface | GVIMGQDGIPISIGIIIAAAILGATFIAGVVLMAILFT |
Ga0209212_12104641 | 3300025309 | Soil | MQDGIPLSIGIIIVAALLGATFIAGVVVFSVLSAAF |
Ga0209431_112535852 | 3300025313 | Soil | MQDGIPLSIGIIIAAAVLGATFIAGMVVFAVLSAPF |
Ga0209342_103552351 | 3300025326 | Soil | PVSIGIIIAAAILGAVLGGAFIVGMAVQAVLGAGQ |
Ga0208325_11536563 | 3300025824 | Freshwater | MGQDGIPLSIGIIIAAAILGATFIVGMVLLAVLIA |
Ga0209269_10000984 | 3300027051 | Enrichment Culture | MGQEGIPISISIIVAAAILGAMFFIVGMALVLVLAG |
Ga0209426_10032484 | 3300027323 | Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal Fluid | MGQDGIPVSIGMIIAAAILGACFVLGMVLMAVLFASG |
Ga0209164_11692892 | 3300027690 | Enrichment Culture | MGQDGIPVSIGMIIAAAILGACFVLGMVLMAVLFT |
Ga0214474_12453832 | 3300027740 | Soil | MAQEGIPLSIGIIIGAAILGVTFIAGMVLLAVLFT |
Ga0209635_101505162 | 3300027888 | Marine Sediment | MGENGIPLSIGLIVAAAILGATFIIGMVLMAVLFA |
Ga0209635_101630104 | 3300027888 | Marine Sediment | MEQQGIPLSISIIIAAAVLGATFIIGMVLFAVLSAM |
Ga0209635_108651322 | 3300027888 | Marine Sediment | MGQDGIPISIGIIIAAAILGACFVLGMVLMAVLFA |
Ga0209636_102991363 | 3300027893 | Marine Sediment | MGQDGIPLSIGIIIAAGILGATFIVGMILLAILFA |
Ga0209636_104269302 | 3300027893 | Marine Sediment | MGQNGIPLSIGIIIAAAILGVTFVAGMVLMAILSI |
Ga0209636_112293542 | 3300027893 | Marine Sediment | MEQDGIPLSLGIIIGAAILGATFIAGMVLFAILSGL |
Ga0209636_112510512 | 3300027893 | Marine Sediment | MGDNGIPLSIGIIIAAAVLGAAFIAGMVLLAILFA |
Ga0209427_100065699 | 3300027901 | Marine Sediment | MGQDGIPISIGIIIAAAILGACFVLGMVLTAILFA |
Ga0209536_1017417683 | 3300027917 | Marine Sediment | MGQDGIPLSIGVIIAAAVLGTVLVGGMVLLAIIMIS |
Ga0268281_11116823 | 3300028156 | Saline Water | MGQDGFPLAIGIIIAAAVLGAAFIAGLVLLAVLAI |
Ga0265596_10300343 | 3300028161 | Saline Water | MGQEGIPLSIGIIIAAAILGATFIAGMVLLAILFV |
Ga0257137_10391891 | 3300029693 | Marine | VMGQDGFPLAIGIIIAAAVLGAASIAGLVLLAVLAI |
Ga0311022_126650472 | 3300029799 | Anaerobic Digester Digestate | MNQEGIPLSLGVVIAAAILGALIVAGMVIFAVFSII |
Ga0307925_1307621 | 3300030714 | Soil | MGQDGIPISIGIIIAAAILGACFVLGMVLMAVLSA |
Ga0315555_10143764 | 3300031257 | Salt Marsh Sediment | MEDNGIPLSIGIIIAAAVLGAAFIAGMVLLAILLA |
Ga0315555_11083622 | 3300031257 | Salt Marsh Sediment | MGDNGIPLSIGIIIAAAVLGATFIAGMVLLAVLLG |
Ga0307443_10096241 | 3300031365 | Salt Marsh | MGDNGIPLAIGIIIAAAVLGAAFIAGMVLLAILLA |
Ga0307380_102049713 | 3300031539 | Soil | MGEEGIPLSISLIIAASILGATFVIGMVLLAILSG |
Ga0315548_10452712 | 3300031551 | Salt Marsh Sediment | MEQDGIPLSIGIIIGAAILGATFIAGMVLFAVLSTL |
Ga0307378_106022132 | 3300031566 | Soil | MGQDGFPLAIGIIIAATVLGATFIAGMVLLAVLFG |
Ga0307378_110830613 | 3300031566 | Soil | MGQDSFPLAIGIIIAAAILGATFIAGMVLLAVLAL |
(restricted) Ga0315308_10800743 | 3300031587 | Sediment | MGQDGIPLSLGIIIAAAILGAIFVLGVLLMAVLSA |
(restricted) Ga0315307_10251376 | 3300031593 | Sediment | MGQDGIPLSLGIIIAAAILGAIFVLGVVLMAVLSA |
(restricted) Ga0315309_10896492 | 3300031604 | Sediment | MGQDGIPLSLGIIIAAAILGATFVLGMVLMAVLSA |
Ga0315545_10716693 | 3300031624 | Salt Marsh Sediment | MEDGIPLSIGIIIGAAILGATFIAGMVLFAVLSAM |
Ga0315291_110962922 | 3300031707 | Sediment | MGQDGIPVSIGIIIAAAILGACFVLGMVLMAILFA |
Ga0315280_1000498516 | 3300031862 | Sediment | MGQEGLPISLAIIVAATILGAAFIAGMVLLAVLFT |
Ga0315280_1001028312 | 3300031862 | Sediment | MNQEGIPLSIGIIVAAAVLGATFIAGMVLLAVLFG |
Ga0315280_100143165 | 3300031862 | Sediment | MEQNGVPLSIGIIIAAAILGATFIAGMVLLAVLFT |
Ga0315280_100287602 | 3300031862 | Sediment | MGENGIPLSLGIIIAAAVLGATFIAGMVLLAVLFS |
Ga0315280_102114893 | 3300031862 | Sediment | MGQDGIPISITIIVAAAILGAAFIAGMVLLAVLFT |
Ga0315280_104083702 | 3300031862 | Sediment | MGDNGIPLSIAIIIAAAILGATFVAGMVLLAVLFT |
(restricted) Ga0315310_102465752 | 3300031876 | Sediment | MEQDGIPLSLGIIIAAAILGATFVLGMVLMAVLSA |
(restricted) Ga0315314_10755753 | 3300031877 | Sediment | MGQDGIPISIGIIIAAAILGACFVLGMVLMAVILA |
(restricted) Ga0315312_10207843 | 3300031898 | Sediment | MGQEGIPLSLGVIIAAAVLGAIVVLGMVLLAVLSA |
Ga0315274_1000494217 | 3300031999 | Sediment | MGQDGIPISVVIIIATAILGVCFVMSMVLIAVFFS |
Ga0315274_103327873 | 3300031999 | Sediment | MAQEGIPLSIGIIIGAAILGVTFIAGMVLMAVLFT |
Ga0315296_1000021521 | 3300032020 | Sediment | MGDNGIPLSIGIIIAAAILGATFIVGMVLLAVLFT |
Ga0315296_100027119 | 3300032020 | Sediment | MGQDGIPISVVIIIATAILGACFVWGMVLMAIILA |
Ga0315296_100139914 | 3300032020 | Sediment | MGDNGIPLSIGIIIAAAILGATFIAGMVLLAVLFT |
Ga0315296_100141867 | 3300032020 | Sediment | MGQDGIPISLAIIIAAAILGATFVAGMVLLALLFT |
Ga0315296_101710423 | 3300032020 | Sediment | MGDNGIPLSIGIIIAAAILGAMFVAGMVLLAVLFT |
Ga0315289_103529181 | 3300032046 | Sediment | MGQDGIPISITIIVAAAILGATFIAGMVLLAVLFT |
Ga0315277_112762551 | 3300032118 | Sediment | MAQEGIPLSIGIIIGAAILGFTFIAGMVLLAVLFT |
Ga0316624_104277052 | 3300033486 | Soil | MNQDGIPLSLGVIIAAAIMGAFIVAGMVIFAVFSII |
Ga0316630_104790352 | 3300033487 | Soil | MNQDGIPLSLGVVIAAAILGAFIVAGMVIFAVFSII |
Ga0316628_1010819492 | 3300033513 | Soil | MNQDGIPLSLGVVIAAAILGAFIVTGMVIFAVFSMI |
Ga0334965_0005086_7603_7710 | 3300033991 | Sediment | MGQDGVPLSIGIIIAAAILGATFIAGMVLLAILFG |
⦗Top⦘ |