Metagenome / Metatranscriptome Family F064744

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F064744
Family Type	Metagenome / Metatranscriptome
Number of Sequences	128
Average Sequence Length	43 residues
Representative Sequence	MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGTD
Number of Associated Samples	75
Number of Associated Scaffolds	128

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	80.95 %
% of genes near scaffold ends (potentially truncated)	22.66 %
% of genes from short scaffolds (< 2000 bps)	82.03 %
Associated GOLD sequencing projects	53
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (61.719 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (64.844 % of family members)
Environment Ontology (ENVO)	Unclassified (92.188 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (82.812 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 49.32% β-sheet: 0.00% Coil/Unstructured: 50.68%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.58
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 128 Family Scaffolds
PF02195	ParBc	13.28
PF03237	Terminase_6N	6.25
PF09682	Phage_holin_6_1	6.25
PF13384	HTH_23	5.47
PF04545	Sigma70_r4	5.47
PF14386	DUF4417	2.34
PF03592	Terminase_2	2.34
PF01555	N6_N4_Mtase	1.56
PF13551	HTH_29	0.78
PF00196	GerE	0.78
PF15960	DUF4763	0.78
PF02592	Vut_1	0.78
PF04404	ERF	0.78
PF04448	DUF551	0.78
PF04466	Terminase_3	0.78
PF03602	Cons_hypoth95	0.78
PF04860	Phage_portal	0.78

COG ID	Name	Functional Category	% Frequency in 128 Family Scaffolds
COG3728	Phage terminase, small subunit	Mobilome: prophages, transposons [X]	2.34
COG0863	DNA modification methylase	Replication, recombination and repair [L]	1.56
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	1.56
COG2189	Adenine specific DNA methylase Mod	Replication, recombination and repair [L]	1.56
COG0742	16S rRNA G966 N2-methylase RsmD	Translation, ribosomal structure and biogenesis [J]	0.78
COG1092	23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI	Translation, ribosomal structure and biogenesis [J]	0.78
COG1738	Queuosine precursor transporter YhhQ, DUF165 family	Translation, ribosomal structure and biogenesis [J]	0.78
COG1783	Phage terminase large subunit	Mobilome: prophages, transposons [X]	0.78
COG2242	Precorrin-6B methylase 2	Coenzyme transport and metabolism [H]	0.78
COG2265	tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family	Translation, ribosomal structure and biogenesis [J]	0.78
COG2890	Methylase of polypeptide chain release factors	Translation, ribosomal structure and biogenesis [J]	0.78

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	71.09 %
Unclassified	root	N/A	28.91 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	62.50 %
Unclassified	root	N/A	28.91 %
Viruses	superkingdom	All Organisms → Viruses	8.59 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	61.72 %
Unclassified	root	N/A	28.91 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.59 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.91 %
Thermotogae	phylum	All Organisms → cellular organisms → Bacteria → Thermotogae	27.34 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	13.28 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.59 %
Asgard group	clade	All Organisms → cellular organisms → Archaea → Asgard group	0.78 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.78 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.91 %
Thermotogae	class	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae	27.34 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	13.28 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.59 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.78 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.78 %
Candidatus Lokiarchaeota	phylum	All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.91 %
Thermotogales	order	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales	27.34 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	12.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.59 %
Patescibacteria group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group	0.78 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.78 %
unclassified Lokiarchaeota	no rank	All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.91 %
Thermotogaceae	family	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae	27.34 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	12.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.59 %
Microgenomates group	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group	0.78 %
Candidatus Lokiarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon	0.78 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.91 %
unclassified Thermotogaceae	no rank	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae	27.34 %
Clostridiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae	12.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.59 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	0.78 %
Candidatus Shapirobacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Shapirobacteria	0.78 %
Candidatus Lokiarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.91 %
Thermotogaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	27.34 %
unclassified Clostridiaceae	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae	12.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.59 %
Flavobacteriaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae	0.78 %
Candidatus Shapirobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Shapirobacteria → Candidatus Shapirobacteria bacterium	0.78 %
Candidatus Lokiarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.91 %
Thermotogaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	27.34 %
Clostridiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	12.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.59 %
unclassified Flavobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae	0.78 %
Candidatus Shapirobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Shapirobacteria → Candidatus Shapirobacteria bacterium	0.78 %
Candidatus Lokiarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.91 %
Thermotogaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	27.34 %
Clostridiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	12.50 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	8.59 %
Flavobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	0.78 %
Candidatus Shapirobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Shapirobacteria → Candidatus Shapirobacteria bacterium	0.78 %
Candidatus Lokiarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon	0.78 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2236876020\|2244396769	Not Available	872	Open in IMG/M
3300000185\|Draft_c109580	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	530	Open in IMG/M
3300000568\|Draft_10053079	All Organisms → cellular organisms → Bacteria	1624	Open in IMG/M
3300002219\|SCADCLC_10063476	All Organisms → cellular organisms → Archaea → Asgard group → Candidatus Lokiarchaeota → unclassified Lokiarchaeota → Candidatus Lokiarchaeota archaeon	1677	Open in IMG/M
3300002703\|draft_11074907	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	4111	Open in IMG/M
3300005664\|Ga0073685_1179604	Not Available	529	Open in IMG/M
3300006395\|Ga0079066_1414553	All Organisms → cellular organisms → Bacteria	710	Open in IMG/M
3300006805\|Ga0075464_10039063	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	2573	Open in IMG/M
3300006805\|Ga0075464_10241073	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	1080	Open in IMG/M
3300006805\|Ga0075464_10342733	Not Available	903	Open in IMG/M
3300006805\|Ga0075464_10433147	All Organisms → cellular organisms → Bacteria	801	Open in IMG/M
3300006805\|Ga0075464_10722144	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	617	Open in IMG/M
3300006805\|Ga0075464_10919924	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	547	Open in IMG/M
3300006805\|Ga0075464_10941915	Not Available	540	Open in IMG/M
3300006917\|Ga0075472_10170928	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	1068	Open in IMG/M
3300009542\|Ga0116234_1180442	All Organisms → cellular organisms → Bacteria	2292	Open in IMG/M
3300009588\|Ga0116232_1082984	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	1060	Open in IMG/M
3300009659\|Ga0123328_1104137	All Organisms → cellular organisms → Bacteria	1173	Open in IMG/M
3300009669\|Ga0116148_1171439	Not Available	969	Open in IMG/M
3300009669\|Ga0116148_1220807	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	812	Open in IMG/M
3300009669\|Ga0116148_1231671	All Organisms → cellular organisms → Bacteria	785	Open in IMG/M
3300009669\|Ga0116148_1244652	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	757	Open in IMG/M
3300009673\|Ga0116185_1131346	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	1204	Open in IMG/M
3300009675\|Ga0116149_1079749	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	1774	Open in IMG/M
3300009675\|Ga0116149_1114650	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	1365	Open in IMG/M
3300009680\|Ga0123335_1242685	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	900	Open in IMG/M
3300009688\|Ga0116176_10070598	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	1912	Open in IMG/M
3300009688\|Ga0116176_10271379	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	843	Open in IMG/M
3300009693\|Ga0116141_10237545	Not Available	987	Open in IMG/M
3300009693\|Ga0116141_10689614	Not Available	504	Open in IMG/M
3300009696\|Ga0116177_10055571	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	2417	Open in IMG/M
3300009696\|Ga0116177_10170992	All Organisms → cellular organisms → Bacteria	1210	Open in IMG/M
3300009696\|Ga0116177_10250199	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	959	Open in IMG/M
3300009720\|Ga0116159_1197336	Not Available	825	Open in IMG/M
3300009771\|Ga0116155_10027449	All Organisms → Viruses → Predicted Viral	2949	Open in IMG/M
3300009771\|Ga0116155_10071307	Not Available	1606	Open in IMG/M
3300009771\|Ga0116155_10135832	All Organisms → Viruses → Predicted Viral	1068	Open in IMG/M
3300009771\|Ga0116155_10169156	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	933	Open in IMG/M
3300009776\|Ga0116154_10056263	All Organisms → cellular organisms → Bacteria	1840	Open in IMG/M
3300009776\|Ga0116154_10078948	All Organisms → Viruses → Predicted Viral	1509	Open in IMG/M
3300009776\|Ga0116154_10120287	All Organisms → cellular organisms → Bacteria	1176	Open in IMG/M
3300009776\|Ga0116154_10232210	Not Available	801	Open in IMG/M
3300009778\|Ga0116151_10005564	All Organisms → cellular organisms → Bacteria	10856	Open in IMG/M
3300009780\|Ga0116156_10066680	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium	2210	Open in IMG/M
3300009780\|Ga0116156_10363080	Not Available	714	Open in IMG/M
3300009780\|Ga0116156_10540130	Not Available	548	Open in IMG/M
3300009781\|Ga0116178_10241126	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	909	Open in IMG/M
3300009781\|Ga0116178_10313103	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	777	Open in IMG/M
3300009781\|Ga0116178_10595982	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	535	Open in IMG/M
3300009782\|Ga0116157_10067139	All Organisms → cellular organisms → Bacteria	2255	Open in IMG/M
3300009782\|Ga0116157_10151107	Not Available	1321	Open in IMG/M
3300009782\|Ga0116157_10242519	All Organisms → cellular organisms → Bacteria	975	Open in IMG/M
3300009782\|Ga0116157_10452763	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	658	Open in IMG/M
3300009783\|Ga0116158_10293554	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	909	Open in IMG/M
3300009783\|Ga0116158_10332580	All Organisms → cellular organisms → Bacteria	839	Open in IMG/M
3300009838\|Ga0116153_10208313	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	805	Open in IMG/M
3300009838\|Ga0116153_10236845	Not Available	749	Open in IMG/M
3300009838\|Ga0116153_10255255	Not Available	718	Open in IMG/M
3300010346\|Ga0116239_10359741	All Organisms → Viruses → Predicted Viral	1000	Open in IMG/M
3300010346\|Ga0116239_10585818	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	727	Open in IMG/M
3300010346\|Ga0116239_10689090	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	654	Open in IMG/M
3300010346\|Ga0116239_10829688	Not Available	579	Open in IMG/M
3300010346\|Ga0116239_10948254	Not Available	531	Open in IMG/M
3300010351\|Ga0116248_10189122	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	1700	Open in IMG/M
3300010353\|Ga0116236_10152743	All Organisms → Viruses → Predicted Viral	2150	Open in IMG/M
3300010353\|Ga0116236_10401924	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	1166	Open in IMG/M
3300010353\|Ga0116236_10640220	Not Available	871	Open in IMG/M
3300010355\|Ga0116242_10279707	All Organisms → cellular organisms → Bacteria	1609	Open in IMG/M
3300010355\|Ga0116242_11602858	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	528	Open in IMG/M
3300010357\|Ga0116249_10347437	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	1369	Open in IMG/M
3300010365\|Ga0116251_10216333	Not Available	1140	Open in IMG/M
3300010429\|Ga0116241_10045665	All Organisms → cellular organisms → Bacteria	4114	Open in IMG/M
3300010429\|Ga0116241_10106974	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	2417	Open in IMG/M
3300014204\|Ga0172381_10001238	All Organisms → cellular organisms → Bacteria	30491	Open in IMG/M
3300014204\|Ga0172381_10858452	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	677	Open in IMG/M
3300014204\|Ga0172381_10934997	Not Available	643	Open in IMG/M
3300014206\|Ga0172377_11037073	Not Available	631	Open in IMG/M
3300019216\|Ga0179939_1025348	All Organisms → Viruses → Predicted Viral	1155	Open in IMG/M
3300019219\|Ga0179942_1096213	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	548	Open in IMG/M
3300019219\|Ga0179942_1110557	All Organisms → cellular organisms → Bacteria	1527	Open in IMG/M
3300019220\|Ga0179936_1074007	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	522	Open in IMG/M
3300019220\|Ga0179936_1144752	Not Available	728	Open in IMG/M
3300019231\|Ga0179935_1106217	Not Available	515	Open in IMG/M
3300019231\|Ga0179935_1257448	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	735	Open in IMG/M
3300019236\|Ga0179944_1293675	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	606	Open in IMG/M
3300019237\|Ga0180028_1006269	All Organisms → cellular organisms → Bacteria	750	Open in IMG/M
3300020176\|Ga0181556_1180620	Not Available	828	Open in IMG/M
3300020814\|Ga0214088_1367255	Not Available	553	Open in IMG/M
3300021603\|Ga0226659_10171240	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	1040	Open in IMG/M
3300023207\|Ga0255811_11554561	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	951	Open in IMG/M
3300025708\|Ga0209201_1019698	All Organisms → Viruses → Predicted Viral	3522	Open in IMG/M
3300025708\|Ga0209201_1028914	All Organisms → cellular organisms → Bacteria	2647	Open in IMG/M
3300025708\|Ga0209201_1085348	Not Available	1181	Open in IMG/M
3300025713\|Ga0208195_1183503	Not Available	658	Open in IMG/M
3300025715\|Ga0209310_1019594	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	2760	Open in IMG/M
3300025715\|Ga0209310_1041503	All Organisms → Viruses → Predicted Viral	1622	Open in IMG/M
3300025715\|Ga0209310_1080508	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	1029	Open in IMG/M
3300025730\|Ga0209606_1031268	All Organisms → cellular organisms → Bacteria	2684	Open in IMG/M
3300025737\|Ga0208694_1138293	Not Available	859	Open in IMG/M
3300025748\|Ga0208459_1138863	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	886	Open in IMG/M
3300025762\|Ga0208040_1249809	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	592	Open in IMG/M
3300025772\|Ga0208939_1128254	Not Available	926	Open in IMG/M
3300025847\|Ga0209607_1036819	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	2587	Open in IMG/M
3300025855\|Ga0209717_1082251	All Organisms → Viruses → Predicted Viral	1411	Open in IMG/M
3300025856\|Ga0209604_1194784	Not Available	811	Open in IMG/M
3300025866\|Ga0208822_1135601	All Organisms → cellular organisms → Bacteria	924	Open in IMG/M
3300025866\|Ga0208822_1236211	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	647	Open in IMG/M
3300025882\|Ga0209097_10363202	All Organisms → cellular organisms → Bacteria	553	Open in IMG/M
3300025896\|Ga0208916_10416892	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	586	Open in IMG/M
3300025902\|Ga0209202_1048752	All Organisms → Viruses → Predicted Viral	1568	Open in IMG/M
3300026195\|Ga0209312_1094797	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	774	Open in IMG/M
3300026311\|Ga0209723_1154979	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	877	Open in IMG/M
(restricted) 3300028564\|Ga0255344_1037822	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	2741	Open in IMG/M
(restricted) 3300028567\|Ga0255342_1191887	All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Thermotogaceae → unclassified Thermotogaceae → Thermotogaceae bacterium	830	Open in IMG/M
(restricted) 3300028568\|Ga0255345_1060140	All Organisms → cellular organisms → Bacteria	2051	Open in IMG/M
(restricted) 3300028568\|Ga0255345_1155185	All Organisms → cellular organisms → Bacteria	982	Open in IMG/M
(restricted) 3300028570\|Ga0255341_1091929	All Organisms → Viruses → Predicted Viral	1434	Open in IMG/M
(restricted) 3300028593\|Ga0255347_1239412	Not Available	807	Open in IMG/M
(restricted) 3300028593\|Ga0255347_1301730	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	670	Open in IMG/M
(restricted) 3300028677\|Ga0255346_1048950	All Organisms → cellular organisms → Bacteria	2273	Open in IMG/M
(restricted) 3300028677\|Ga0255346_1057855	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Shapirobacteria → Candidatus Shapirobacteria bacterium	2004	Open in IMG/M
(restricted) 3300028677\|Ga0255346_1070045	Not Available	1737	Open in IMG/M
(restricted) 3300028677\|Ga0255346_1149494	Not Available	985	Open in IMG/M
3300029440\|Ga0167329_1071959	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium	582	Open in IMG/M
3300029446\|Ga0167332_1072181	Not Available	630	Open in IMG/M
3300029799\|Ga0311022_16307728	Not Available	523	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Engineered	Engineered	91.41%
Environmental	Environmental	8.59%

Habitat	Taxonomy	Distribution
Wastewater	Engineered → Wastewater	70.31%
Bioreactor	Engineered → Bioreactor	9.38%
Aquatic	Environmental → Aquatic	8.59%
Built Environment	Engineered → Built Environment	8.59%
Solid Waste	Engineered → Solid Waste	3.12%

Habitat	Taxonomy	Distribution
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	64.84%
Anaerobic	Engineered → Bioreactor → Anaerobic	9.38%
Water Treatment Plant	Engineered → Built Environment → Water Treatment Plant	8.59%
Marine	Environmental → Aquatic → Marine	7.81%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	5.47%
Landfill	Engineered → Solid Waste → Landfill	3.12%
Freshwater	Environmental → Aquatic → Freshwater	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	64.84%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified	9.38%
Unclassified	Engineered → Built Environment → Water Treatment Plant → Unclassified	8.59%
Coastal	Environmental → Aquatic → Marine → Coastal	7.03%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	3.91%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified	3.12%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Unclassified	1.56%
Lotic	Environmental → Aquatic → Freshwater → Lotic	0.78%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	64.84%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified	9.38%
Unclassified	Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified	8.59%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	7.03%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	3.91%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified → Unclassified	3.12%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified	1.56%
Unclassified	Environmental → Aquatic → Freshwater → Lotic → Unclassified	0.78%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh	0.78%

Habitat	Taxonomy	Distribution
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	64.84%
Wastewater	Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater	8.59%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	7.03%
Anaerobic Biogas Reactor	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor	6.25%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	3.91%
Landfill Leachate	Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate	3.12%
Biosolids	Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids	1.56%
Anaerobic Digester Digestate	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate	1.56%
Granular Sludge	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge	1.56%
Aquatic	Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic	0.78%
Salt Marsh	Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh	0.78%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2236876020	Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC:	Engineered	Open in IMG/M
3300000185	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011	Engineered	Open in IMG/M
3300000568	Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC:	Engineered	Open in IMG/M
3300002219	Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC:	Engineered	Open in IMG/M
3300002703	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5	Engineered	Open in IMG/M
3300005664	Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USA	Environmental	Open in IMG/M
3300006395	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_02_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300006917	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA	Environmental	Open in IMG/M
3300009542	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A SIP RNA (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300009588	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A SIP RNA (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300009647	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA	Engineered	Open in IMG/M
3300009659	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C12 SIP DNA	Engineered	Open in IMG/M
3300009669	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG	Engineered	Open in IMG/M
3300009673	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG	Engineered	Open in IMG/M
3300009675	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG	Engineered	Open in IMG/M
3300009680	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA	Engineered	Open in IMG/M
3300009688	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG	Engineered	Open in IMG/M
3300009693	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG	Engineered	Open in IMG/M
3300009696	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG	Engineered	Open in IMG/M
3300009720	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG	Engineered	Open in IMG/M
3300009771	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG	Engineered	Open in IMG/M
3300009776	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG	Engineered	Open in IMG/M
3300009778	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG	Engineered	Open in IMG/M
3300009780	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG	Engineered	Open in IMG/M
3300009781	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG	Engineered	Open in IMG/M
3300009782	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG	Engineered	Open in IMG/M
3300009783	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG	Engineered	Open in IMG/M
3300009838	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG	Engineered	Open in IMG/M
3300010346	AD_USMOca	Engineered	Open in IMG/M
3300010351	AD_USPNca	Engineered	Open in IMG/M
3300010353	AD_USCAca	Engineered	Open in IMG/M
3300010355	AD_USDVca	Engineered	Open in IMG/M
3300010357	AD_USSTca	Engineered	Open in IMG/M
3300010365	AD_USDIca	Engineered	Open in IMG/M
3300010429	AD_USRAca	Engineered	Open in IMG/M
3300014204	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG	Engineered	Open in IMG/M
3300014206	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG	Engineered	Open in IMG/M
3300019216	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC032_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019219	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC052_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019220	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC059_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019231	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019236	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_STIC10_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300019237	Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R1-A RNA time zero (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300020176	Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)	Environmental	Open in IMG/M
3300020814	Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit	Engineered	Open in IMG/M
3300021603	Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spades	Engineered	Open in IMG/M
3300023207	Combined Assembly of Gp0238866, Gp0238878, Gp0238879	Engineered	Open in IMG/M
3300025706	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025708	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025713	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025715	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025730	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025737	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025748	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025762	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025772	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025847	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025855	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025856	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025866	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025882	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025896	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)	Environmental	Open in IMG/M
3300025902	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG (SPAdes)	Engineered	Open in IMG/M
3300026195	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA (SPAdes)	Engineered	Open in IMG/M
3300026311	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes)	Engineered	Open in IMG/M
3300028564 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18	Engineered	Open in IMG/M
3300028567 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant14	Engineered	Open in IMG/M
3300028568 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant20	Engineered	Open in IMG/M
3300028570 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12	Engineered	Open in IMG/M
3300028593 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24	Engineered	Open in IMG/M
3300028677 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22	Engineered	Open in IMG/M
3300029440	Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP10 - Uppsala-digested 111	Engineered	Open in IMG/M
3300029446	Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP13 - Kappala-digested 114	Engineered	Open in IMG/M
3300029799	Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119	Engineered	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
2244023179	2236876020	Hydrocarbon Resource Environments	MAMEVIDGAYQLLLARLLAIEADMAVLRERVEELEDELHETWMGGTD
Draft_1095802	3300000185	Hydrocarbon Resource Environments	LLLARLLAIEADMAVLRERVEELEDELHETWMGGTD*
Draft_100530792	3300000568	Hydrocarbon Resource Environments	MAMEVIDGAYQLLLARLLAIEADMAVLRERVEELEDELHETWMGGTD*
SCADCLC_100634764	3300002219	Hydrocarbon Resource Environments	YTLLLAELMAIKAEIAALRERVDEIDGELHETWMGGTD*
draft_1107490711	3300002703	Hydrocarbon Resource Environments	MPTIDGAYQLLLARLMAIEADMADLRERVQELEGDLHEAQF*
Ga0073685_11796041	3300005664	Aquatic	MEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHEAQF*
Ga0079066_14145532	3300006395	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMALESDLADLRERVAELEAELHETWMGGTD*
Ga0075464_100390634	3300006805	Aqueous	MEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHETWMGGNE*
Ga0075464_102410733	3300006805	Aqueous	MEVIDGAYQLLLARLMAIEADMADLRERVSELEADVHEAQF*
Ga0075464_103427332	3300006805	Aqueous	MDGAYQLLLARLLAIEADMADLRERVDELEAALHETWMGGNE*
Ga0075464_104331472	3300006805	Aqueous	MEVIDGAYQLLLARLMAIEADMADLRERVQELEAALHEAQF*
Ga0075464_107221441	3300006805	Aqueous	MPVIDGAYQLLLARLLAIEADMADLRERVQELEEALHEAQF*
Ga0075464_109199242	3300006805	Aqueous	MEVIDGAYQLLLARLMAIEADMADLRERVAELEAELHETWMGGNE*
Ga0075464_109419151	3300006805	Aqueous	MEVIDGAYQLLLARLMAVEADMEALRERVAELEAELHEAWMGGTD*
Ga0075472_101709283	3300006917	Aqueous	MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGNE*
Ga0116234_11804424	3300009542	Anaerobic Biogas Reactor	MPTIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGNE*
Ga0116232_10829842	3300009588	Anaerobic Biogas Reactor	MPVIDGAYQLLLARLLAIEADMADLRERVAELEAELHETWMGGTD*
Ga0123326_10404205	3300009647	Anaerobic Biogas Reactor	MPTIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGTD*
Ga0123328_11041373	3300009659	Anaerobic Biogas Reactor	MPVIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGNE*
Ga0116148_11714392	3300009669	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLAIEADMADLRERVAELEGRLHEAWMGGTD*
Ga0116148_12208073	3300009669	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLAIEADMADLRERVQELEAALHEAQF*
Ga0116148_12316713	3300009669	Anaerobic Digestor Sludge	AYQLLLARLMALESDLAGLRERVAELEAELHETWMGGND*
Ga0116148_12446522	3300009669	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLAIEADMADLRERVSELEADVHEAQF*
Ga0116185_11313461	3300009673	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMAIEADMADLRERVVELESDLHEAWLGGTD*
Ga0116149_10797496	3300009675	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLLAIEADMADLRERVAELEGRLHE
Ga0116149_11146503	3300009675	Anaerobic Digestor Sludge	MPTIDGAYALLLARLMALESDLAALRERVAELEAELHEAWLGGTD*
Ga0123335_12426852	3300009680	Anaerobic Biogas Reactor	MPTIDGAYQLLLARLLAIEADMADLRERVAELEAELHETWMGGTD*
Ga0116176_100705982	3300009688	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLMALESDLADLRERVAELEGELHETWMGGNE*
Ga0116176_102713793	3300009688	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLALESDLADLRERVQELEAALHEAQF*
Ga0116141_102375451	3300009693	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETW
Ga0116141_106896141	3300009693	Anaerobic Digestor Sludge	AYQLLLARLLAIEADMADLRERVQELEEALHETWMGGTD*
Ga0116177_100555713	3300009696	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLMALESDLADLRERVDEIDGELHEAGMK*
Ga0116177_101709922	3300009696	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLAIEANMADLRERVQELEAALHEAQF*
Ga0116177_102501991	3300009696	Anaerobic Digestor Sludge	RSRSMEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHETWMGGNE*
Ga0116159_11973361	3300009720	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLLAIEADMADLRERVQELEAE
Ga0116155_100274491	3300009771	Anaerobic Digestor Sludge	IDGAYQLLLARLMAIEADMADLRERVQELEAALHEAQF*
Ga0116155_100713072	3300009771	Anaerobic Digestor Sludge	MPTIDGAYALLLARLMAVEADKEALRERVAELEAELHEAWMGGTD*
Ga0116155_101358321	3300009771	Anaerobic Digestor Sludge	MDIPMAMPEDWYGLLLAKLHAIESELAALEERVQELEAELHETWMGGND*
Ga0116155_101691562	3300009771	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMALESDLADLRERVAELEAELHEAGMK*
Ga0116154_100562631	3300009776	Anaerobic Digestor Sludge	EVIDGAYQLLLARLMAIEADMADLRERVAELEAALHEAQF*
Ga0116154_100789481	3300009776	Anaerobic Digestor Sludge	QLLLARLLAIEADMADLRERVQELEEALHEAGMRG*
Ga0116154_101202873	3300009776	Anaerobic Digestor Sludge	MLMEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHEAQF*
Ga0116154_102322103	3300009776	Anaerobic Digestor Sludge	MPTIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGNE*
Ga0116151_100055646	3300009778	Anaerobic Digestor Sludge	MPTIDGAYQLLLARLLAIEADMADLRERVDELDDELHEAWLGGTD*
Ga0116156_100666803	3300009780	Anaerobic Digestor Sludge	MEVIDGVYQLLLARLMAIEADMADLCERVQELEAELHEAQF*
Ga0116156_103630803	3300009780	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLAIEADMADLCEWVKDLVDELHEVE
Ga0116156_105401302	3300009780	Anaerobic Digestor Sludge	METNLPDAYALLLARLIALETELSALRERVAELEAELHETWMGGNE*
Ga0116178_102411262	3300009781	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMAIEADMADLRERVAELEAELHEAQF*
Ga0116178_103131032	3300009781	Anaerobic Digestor Sludge	MPTIDGAYQLLLARLMAIEADMADLRERVQELEAELHETWMGGNE*
Ga0116178_105959821	3300009781	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMAIEADMADLRERVQELEAALHEAQ
Ga0116157_100671393	3300009782	Anaerobic Digestor Sludge	LAKLHAIESELAALEERVQELEAELHETWMGGNE*
Ga0116157_101511072	3300009782	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELSEAQF*
Ga0116157_102425192	3300009782	Anaerobic Digestor Sludge	MPEDWYGLLLAKLHAIESELAALEERVQELEAELHETWMGGND*
Ga0116157_104527631	3300009782	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLLAIEADMADLRERVAELEAELHETWMGGNE*
Ga0116158_102935542	3300009783	Anaerobic Digestor Sludge	MPTIDGAYALLLARLMVIEADMADLRERVQELEAELHETWMGGNE*
Ga0116158_103325802	3300009783	Anaerobic Digestor Sludge	METNLPDAYALLLARLIALETELSALRERVAELEGELHEAWVGGTD*
Ga0116153_102083133	3300009838	Anaerobic Digestor Sludge	MPTIDGAYQLLLARLMAIEADMADLRERVQELEAELHEAQF*
Ga0116153_102368451	3300009838	Anaerobic Digestor Sludge	SMEVIDGAYQLLLARLMAIEADMADLRERVQELEAALHEAQF*
Ga0116153_102552552	3300009838	Anaerobic Digestor Sludge	MPEDWYGLLLAKLHAIESELAALEERVQELEEALHEAQF*
Ga0116239_103597412	3300010346	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLAIEADMADLRERVDEIDGELHETWMGGTD*
Ga0116239_105858182	3300010346	Anaerobic Digestor Sludge	MPTIDGAYQLLLARLMAIEADMEELRERVQELEDELHETWMGGNE*
Ga0116239_106890901	3300010346	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMAIEADMADLRERVQELEAELSEAQF*
Ga0116239_108296882	3300010346	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLMAIEADMADLCERVQELEAELHEAQF*
Ga0116239_109482542	3300010346	Anaerobic Digestor Sludge	MDGAYQLLLARLMALESDLADLRERVAELEGELHETWMGGNE*
Ga0116248_101891222	3300010351	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMAIEADMADLRERVAELEDELREAGMK*
Ga0116236_101527432	3300010353	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLAIEADMADLRERVQELEEALHEVGMK*
Ga0116236_104019243	3300010353	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLAIEADMADLRERVQELEDELHETWMGGTD*
Ga0116236_106402201	3300010353	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLAIEADMADLRERVSELEAD
Ga0116242_102797073	3300010355	Anaerobic Digestor Sludge	MAMPEDWYGLLLAKLHAIESELAALEERVQELEAELHETWMGGND*
Ga0116242_116028582	3300010355	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLLAIEADMADLRERVQELEAELHEAQF*
Ga0116249_103474371	3300010357	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMALESDLADLRERVAELEAELHETW
Ga0116251_102163332	3300010365	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGNE*
Ga0116241_100456655	3300010429	Anaerobic Digestor Sludge	MPTIDGAYQLLLARLLAIEADMADLRERVQELEEALHEAGMRG*
Ga0116241_101069742	3300010429	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLLAIEADMAALRERVDELEAELHEAQF*
Ga0172381_1000123861	3300014204	Landfill Leachate	MAMPEDWYGLLLARLMAIEADMADLRERVSELEADVHEAQF*
Ga0172381_108584522	3300014204	Landfill Leachate	MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHEAQF*
Ga0172381_109349971	3300014204	Landfill Leachate	METNLPDSSAFLLVRLIALETELSAVRERVKELEADVHEAQ
Ga0172377_110370731	3300014206	Landfill Leachate	MPTIDGAYQLLLARLLAIEADMADLRERVQELEAELHEAQF*
Ga0179939_10253484	3300019216	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHE
Ga0179942_10962132	3300019219	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMALESDLADLRERVAELEGELHEAWVGGTD
Ga0179942_11105573	3300019219	Anaerobic Digestor Sludge	MAMPEDWYGLLLAKLHAIESELAALEERVQELEAELHETWMGGND
Ga0179936_10740071	3300019220	Anaerobic Digestor Sludge	MPTIDGAYALLLARLMALESDLAALRERVAELEAELHEA
Ga0179936_11447521	3300019220	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLMALESDLADLRERVAELEGELHETWMGGTD
Ga0179935_11062172	3300019231	Anaerobic Digestor Sludge	METNLPDAYALLLARLIALETELSALRERVAELEAELHETWMGGND
Ga0179935_12574482	3300019231	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMALESDLADLRERVAELEAELHEAWLGGTD
Ga0179944_12936752	3300019236	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMALEIDLADLRERVQELEAELHETWMGGNE
Ga0180028_10062692	3300019237	Anaerobic Biogas Reactor	MPTIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGNE
Ga0181556_11806201	3300020176	Salt Marsh	METTLPDAYALLLARLMAVEADMEALRERVAELEAELHEAWMGGTD
Ga0214088_13672552	3300020814	Granular Sludge	MEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHETWMGGNE
Ga0226659_101712402	3300021603	Granular Sludge	MPVIDGAYQLLLARLMAIEADMADLRERVQELEEALHETWMGGNE
Ga0255811_115545611	3300023207	Anaerobic Digester Digestate	MPTIDGAYQLLLARLMAIEADMADLRERVQELEEALHEAQF
Ga0209507_10450561	3300025706	Anaerobic Digestor Sludge	SPRRSRERRSRLMEVIDGAYQLLLARLMAIEADMADLRERVQELEAALHEAQF
Ga0209201_10196984	3300025708	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMALESDLADLRERVAELEAELHETWMGGTD
Ga0209201_10289141	3300025708	Anaerobic Digestor Sludge	YALLLARLMALESDLAALRERVAELEAELHEAWLGGTD
Ga0209201_10853482	3300025708	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLLAIEADMADLRERVAELEGRLHEAWMGGTD
Ga0208195_11835032	3300025713	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETW
Ga0209310_10195947	3300025715	Anaerobic Digestor Sludge	MRWAMLMEVIDGAYQLLLARLMAIEADMADLRERVQELEAELHEAQF
Ga0209310_10415034	3300025715	Anaerobic Digestor Sludge	MPTIDGAYQLLLARLLAIEADMADLRERVQELEEALHEAGMRG
Ga0209310_10805083	3300025715	Anaerobic Digestor Sludge	MPTIDGAYQLLLARLMAIEADMADLRERVQELEAELHEAQF
Ga0209606_10312684	3300025730	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGNE
Ga0208694_11382932	3300025737	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGNE
Ga0208459_11388632	3300025748	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMAIEADMADLRERVAELEDELREAGMK
Ga0208040_12498092	3300025762	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMAIEADMADLRERVDEIDGELHETWMGGNE
Ga0208939_11282541	3300025772	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLMALESDLADLRERVAELEGELHETWMGGNE
Ga0209607_103681910	3300025847	Anaerobic Digestor Sludge	MPTIDGAYQLLLARLLAIEADMADLRERVDELDDELHEAWLGGTD
Ga0209717_10822511	3300025855	Anaerobic Digestor Sludge	MPVIDGAYQLLLARLLAIEADMADLRERVAELEAELHETWMGGNE
Ga0209604_11947841	3300025856	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLLAIEADMADLRERVQELEAE
Ga0208822_11356013	3300025866	Anaerobic Digestor Sludge	AYQLLLARLMAIEADMADLRERVQELEAELHETWMGGNE
Ga0208822_12362113	3300025866	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLIALETELSALRERVAELEAALHETWMGGNE
Ga0209097_103632022	3300025882	Anaerobic Digestor Sludge	METNLPDAYALLLARLIALETELSALRERVAELEGELHEAWVGGTD
Ga0208916_104168921	3300025896	Aqueous	MEVIDGAYQLLLARLMAIEADMADLCERVQELEDELHEAQF
Ga0209202_10487523	3300025902	Anaerobic Digestor Sludge	MEVIDGAYQLLLARLMAIEADMADLRERVQELEAALHEAQF
Ga0209312_10947972	3300026195	Anaerobic Biogas Reactor	MPVIDGAYQLLLARLLAIEADMADLRERVAELEAELHETWMGGTD
Ga0209723_11549792	3300026311	Anaerobic Biogas Reactor	MPTIDGAYQLLLARLLAIEADMADLRERVAELEAELHETWMGGTD
(restricted) Ga0255344_10378229	3300028564	Wastewater	MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHEAWLGGNE
(restricted) Ga0255342_11918873	3300028567	Wastewater	MEVIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGTD
(restricted) Ga0255345_10601402	3300028568	Wastewater	MPVIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGTD
(restricted) Ga0255345_11551853	3300028568	Wastewater	MPVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGTD
(restricted) Ga0255341_10919292	3300028570	Wastewater	MEVIDGAYQLLLARLMAIEADMADLRERMDELDDELHEAWLGGTD
(restricted) Ga0255347_12394121	3300028593	Wastewater	VIDGAYQLLLARLLAIEADMAALRERMDELDDELHEAWLGGMD
(restricted) Ga0255347_13017302	3300028593	Wastewater	MEVIDGAYQLLLARLLAIEADMADLRERVQELEAELHETWMGGTD
(restricted) Ga0255346_10489504	3300028677	Wastewater	EVIDGAYQLLLARLLAIEADMADLRERMDELDDELHEAWLGGTD
(restricted) Ga0255346_10578551	3300028677	Wastewater	METNLPDAYALLLARLLAIEADMADLRERMDELDDELHEAWLGGTD
(restricted) Ga0255346_10700455	3300028677	Wastewater	MPVIDGAYQLLLARLLAIEADMADLRERVSETWLGGTE
(restricted) Ga0255346_11494942	3300028677	Wastewater	MEVIDGAYQLLLARLLAIEADMADLRERVAELEGELHETWMGGNE
Ga0167329_10719591	3300029440	Biosolids	MPVIDGAYQLLLARLMAIEADMADLRERVQELEAELHEAQF
Ga0167332_10721811	3300029446	Biosolids	MDGAYQLLLARLMALESDLADLRERVDEIDGELHETWMGGNE
Ga0311022_163077282	3300029799	Anaerobic Digester Digestate	MEVIDGAYQLLLARLMAIEADMADLRERVQELEEALHETWMGGNE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters