Basic Information | |
---|---|
Family ID | F029455 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 188 |
Average Sequence Length | 50 residues |
Representative Sequence | MPDRTIDLDLWAEGNAERLPAITVTGQGLRIEGSVAEFDRLLLILGGWMKP |
Number of Associated Samples | 95 |
Number of Associated Scaffolds | 188 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 89.36 % |
% of genes near scaffold ends (potentially truncated) | 19.15 % |
% of genes from short scaffolds (< 2000 bps) | 74.47 % |
Associated GOLD sequencing projects | 77 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (71.277 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (25.532 % of family members) |
Environment Ontology (ENVO) | Unclassified (92.553 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.532 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.99% β-sheet: 12.66% Coil/Unstructured: 68.35% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 188 Family Scaffolds |
---|---|---|
PF03237 | Terminase_6N | 11.17 |
PF13936 | HTH_38 | 2.66 |
PF01978 | TrmB | 2.13 |
PF10544 | T5orf172 | 2.13 |
PF05133 | Phage_prot_Gp6 | 2.13 |
PF02195 | ParBc | 2.13 |
PF01381 | HTH_3 | 1.06 |
PF13455 | MUG113 | 1.06 |
PF10108 | DNA_pol_B_exo2 | 1.06 |
PF09339 | HTH_IclR | 0.53 |
PF14386 | DUF4417 | 0.53 |
PF00196 | GerE | 0.53 |
PF13384 | HTH_23 | 0.53 |
PF00078 | RVT_1 | 0.53 |
PF04703 | FaeA | 0.53 |
PF01022 | HTH_5 | 0.53 |
PF01844 | HNH | 0.53 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.00 % |
Unclassified | root | N/A | 25.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000032|Draft_c0006329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 2386 | Open in IMG/M |
3300000032|Draft_c0009140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 765 | Open in IMG/M |
3300000032|Draft_c0078767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 2314 | Open in IMG/M |
3300000558|Draft_10024192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 777 | Open in IMG/M |
3300000558|Draft_10062520 | Not Available | 3186 | Open in IMG/M |
3300000558|Draft_10084183 | Not Available | 3933 | Open in IMG/M |
3300000558|Draft_10116658 | Not Available | 4885 | Open in IMG/M |
3300000558|Draft_11547836 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1146 | Open in IMG/M |
3300000568|Draft_10103145 | Not Available | 647 | Open in IMG/M |
3300000568|Draft_10533920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 530 | Open in IMG/M |
3300001580|Draft_10059464 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → unclassified Methanosarcinales → Methanosarcinales archaeon ANME-2c ERB4 | 2343 | Open in IMG/M |
3300001580|Draft_10231893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 825 | Open in IMG/M |
3300001592|Draft_10282761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 617 | Open in IMG/M |
3300001605|Draft_10044957 | All Organisms → cellular organisms → Bacteria | 3719 | Open in IMG/M |
3300001605|Draft_10241126 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300001605|Draft_10613752 | Not Available | 557 | Open in IMG/M |
3300001761|CSTRM36_1004116 | All Organisms → cellular organisms → Bacteria | 2467 | Open in IMG/M |
3300002079|CSTR_1022636 | All Organisms → cellular organisms → Bacteria | 8854 | Open in IMG/M |
3300002170|JGI24711J26586_10100585 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
3300002219|SCADCLC_10036970 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin028 | 5897 | Open in IMG/M |
3300002220|MLSBCLC_10419038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 2173 | Open in IMG/M |
3300002446|NAPDCCLC_10021850 | All Organisms → cellular organisms → Bacteria | 4380 | Open in IMG/M |
3300002703|draft_10976100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 919 | Open in IMG/M |
3300002703|draft_11015366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1259 | Open in IMG/M |
3300002703|draft_11073202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 3783 | Open in IMG/M |
3300002821|Iso3TCLC_10019807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 7872 | Open in IMG/M |
3300002821|Iso3TCLC_10083239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1528 | Open in IMG/M |
3300002856|draft_11481993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1686 | Open in IMG/M |
3300003535|Ba1_1002337 | Not Available | 24572 | Open in IMG/M |
3300005326|Ga0074195_1110810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 729 | Open in IMG/M |
3300006360|Ga0079079_1010034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 2835 | Open in IMG/M |
3300006381|Ga0079102_1006242 | Not Available | 782 | Open in IMG/M |
3300006381|Ga0079102_1376126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 868 | Open in IMG/M |
3300006386|Ga0079068_1000562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 602 | Open in IMG/M |
3300006387|Ga0079069_1037150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 2516 | Open in IMG/M |
3300006593|Ga0079081_1011656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 2527 | Open in IMG/M |
3300006596|Ga0079074_1334350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 771 | Open in IMG/M |
3300006840|Ga0101790_135947 | Not Available | 10991 | Open in IMG/M |
3300006840|Ga0101790_147035 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
3300006930|Ga0079303_10206259 | Not Available | 788 | Open in IMG/M |
3300009121|Ga0118671_1001527 | Not Available | 13787 | Open in IMG/M |
3300009388|Ga0103809_1015077 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 | 1244 | Open in IMG/M |
3300009542|Ga0116234_1063480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 611 | Open in IMG/M |
3300009542|Ga0116234_1170286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 937 | Open in IMG/M |
3300009607|Ga0123327_1051955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1675 | Open in IMG/M |
3300009607|Ga0123327_1081719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1210 | Open in IMG/M |
3300009642|Ga0123331_1020274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 2721 | Open in IMG/M |
3300009642|Ga0123331_1025014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 2354 | Open in IMG/M |
3300009642|Ga0123331_1045875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1555 | Open in IMG/M |
3300009642|Ga0123331_1088537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1010 | Open in IMG/M |
3300009647|Ga0123326_1040227 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
3300009647|Ga0123326_1094212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1010 | Open in IMG/M |
3300009652|Ga0123330_1065640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1506 | Open in IMG/M |
3300009656|Ga0123329_1124711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 984 | Open in IMG/M |
3300009656|Ga0123329_1231309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 657 | Open in IMG/M |
3300009659|Ga0123328_1356555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 529 | Open in IMG/M |
3300009666|Ga0116182_1148610 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300009666|Ga0116182_1339455 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300009666|Ga0116182_1438389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 507 | Open in IMG/M |
3300009670|Ga0116183_1106087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1472 | Open in IMG/M |
3300009670|Ga0116183_1137696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1219 | Open in IMG/M |
3300009671|Ga0123334_1013012 | Not Available | 6424 | Open in IMG/M |
3300009671|Ga0123334_1051778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 2321 | Open in IMG/M |
3300009674|Ga0116173_1106057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1438 | Open in IMG/M |
3300009674|Ga0116173_1135567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1221 | Open in IMG/M |
3300009676|Ga0116187_1317765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 695 | Open in IMG/M |
3300009680|Ga0123335_1270946 | Not Available | 833 | Open in IMG/M |
3300009680|Ga0123335_1404276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 629 | Open in IMG/M |
3300009681|Ga0116174_10313674 | Not Available | 750 | Open in IMG/M |
3300009687|Ga0116144_10341882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 759 | Open in IMG/M |
3300009688|Ga0116176_10374198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
3300009688|Ga0116176_10408012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 663 | Open in IMG/M |
3300009690|Ga0116143_10094938 | Not Available | 1733 | Open in IMG/M |
3300009692|Ga0116171_10506052 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 | 631 | Open in IMG/M |
3300009692|Ga0116171_10659503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 536 | Open in IMG/M |
3300009696|Ga0116177_10130403 | Not Available | 1432 | Open in IMG/M |
3300009704|Ga0116145_1060561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1719 | Open in IMG/M |
3300009707|Ga0116195_1041544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1165 | Open in IMG/M |
3300009708|Ga0116194_1098942 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 | 585 | Open in IMG/M |
3300009768|Ga0116193_1050133 | All Organisms → cellular organisms → Bacteria | 2070 | Open in IMG/M |
3300009768|Ga0116193_1429124 | Not Available | 514 | Open in IMG/M |
3300010310|Ga0116235_1194677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 942 | Open in IMG/M |
3300010346|Ga0116239_11024037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 505 | Open in IMG/M |
3300010351|Ga0116248_10777661 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300010352|Ga0116247_10879105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 660 | Open in IMG/M |
3300010352|Ga0116247_11021309 | Not Available | 602 | Open in IMG/M |
3300010353|Ga0116236_11323321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 550 | Open in IMG/M |
3300010356|Ga0116237_10399707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1222 | Open in IMG/M |
3300010356|Ga0116237_10461681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1118 | Open in IMG/M |
3300010357|Ga0116249_10910687 | Not Available | 798 | Open in IMG/M |
3300014203|Ga0172378_10092843 | Not Available | 2500 | Open in IMG/M |
3300014203|Ga0172378_10202472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1573 | Open in IMG/M |
3300014203|Ga0172378_10815536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 674 | Open in IMG/M |
3300014203|Ga0172378_11149989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 550 | Open in IMG/M |
3300014203|Ga0172378_11309097 | Not Available | 510 | Open in IMG/M |
3300014204|Ga0172381_10002091 | Not Available | 22663 | Open in IMG/M |
3300014204|Ga0172381_10008637 | Not Available | 9934 | Open in IMG/M |
3300014204|Ga0172381_10065976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3057 | Open in IMG/M |
3300014204|Ga0172381_10316019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1235 | Open in IMG/M |
3300014204|Ga0172381_10342309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1179 | Open in IMG/M |
3300014204|Ga0172381_10384366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Halanaerobiales → Halanaerobiaceae → Halarsenatibacter → Halarsenatibacter silvermanii | 1100 | Open in IMG/M |
3300014204|Ga0172381_10407758 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
3300014204|Ga0172381_10408687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1061 | Open in IMG/M |
3300014204|Ga0172381_10413060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1054 | Open in IMG/M |
3300014204|Ga0172381_10461568 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
3300014204|Ga0172381_10555350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 882 | Open in IMG/M |
3300014204|Ga0172381_10728802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 748 | Open in IMG/M |
3300014204|Ga0172381_10755155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 732 | Open in IMG/M |
3300014204|Ga0172381_11197924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 554 | Open in IMG/M |
3300014204|Ga0172381_11205144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 552 | Open in IMG/M |
3300014204|Ga0172381_11213959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 549 | Open in IMG/M |
3300014204|Ga0172381_11253307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 539 | Open in IMG/M |
3300014204|Ga0172381_11316152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 523 | Open in IMG/M |
3300014205|Ga0172380_10091748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 2475 | Open in IMG/M |
3300014205|Ga0172380_10340607 | Not Available | 1134 | Open in IMG/M |
3300014205|Ga0172380_10392121 | Not Available | 1042 | Open in IMG/M |
3300014205|Ga0172380_10409800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1014 | Open in IMG/M |
3300014205|Ga0172380_10610368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 796 | Open in IMG/M |
3300014205|Ga0172380_10765158 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300014205|Ga0172380_10778678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 687 | Open in IMG/M |
3300014205|Ga0172380_10787062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 682 | Open in IMG/M |
3300014205|Ga0172380_10998742 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
3300014205|Ga0172380_11071473 | Not Available | 569 | Open in IMG/M |
3300014205|Ga0172380_11251347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 519 | Open in IMG/M |
3300014205|Ga0172380_11292298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 509 | Open in IMG/M |
3300014206|Ga0172377_10060577 | Not Available | 3552 | Open in IMG/M |
3300014206|Ga0172377_10176171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1885 | Open in IMG/M |
3300014206|Ga0172377_10244191 | Not Available | 1545 | Open in IMG/M |
3300014206|Ga0172377_10324126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1298 | Open in IMG/M |
3300014206|Ga0172377_10508939 | Not Available | 980 | Open in IMG/M |
3300014206|Ga0172377_10907899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 684 | Open in IMG/M |
3300014839|Ga0182027_10048674 | Not Available | 5327 | Open in IMG/M |
3300015214|Ga0172382_10058105 | Not Available | 3843 | Open in IMG/M |
3300015214|Ga0172382_10803468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 644 | Open in IMG/M |
3300015214|Ga0172382_11043902 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 540 | Open in IMG/M |
3300015214|Ga0172382_11090000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 524 | Open in IMG/M |
3300019206|Ga0179943_1203835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 602 | Open in IMG/M |
3300019224|Ga0180029_1150945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1015 | Open in IMG/M |
3300019226|Ga0179934_1249202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 591 | Open in IMG/M |
3300019231|Ga0179935_1151974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 533 | Open in IMG/M |
3300020072|Ga0180031_1068763 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 7048 | Open in IMG/M |
3300020812|Ga0214071_1496670 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin028 | 1659 | Open in IMG/M |
3300020813|Ga0214086_1558883 | Not Available | 1381 | Open in IMG/M |
3300020814|Ga0214088_1125317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1593 | Open in IMG/M |
3300020814|Ga0214088_1306962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 549 | Open in IMG/M |
3300020814|Ga0214088_1376557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1155 | Open in IMG/M |
3300020814|Ga0214088_1378812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 995 | Open in IMG/M |
3300020814|Ga0214088_1832410 | Not Available | 7935 | Open in IMG/M |
3300020814|Ga0214088_1835297 | Not Available | 1019 | Open in IMG/M |
3300020814|Ga0214088_1840856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 598 | Open in IMG/M |
3300021603|Ga0226659_10366763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 635 | Open in IMG/M |
3300023207|Ga0255811_10516932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1060 | Open in IMG/M |
3300023207|Ga0255811_11571852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 723 | Open in IMG/M |
3300025393|Ga0208041_1054191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 621 | Open in IMG/M |
3300025713|Ga0208195_1016897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 3961 | Open in IMG/M |
3300025713|Ga0208195_1033444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 2367 | Open in IMG/M |
3300025713|Ga0208195_1044296 | Not Available | 1918 | Open in IMG/M |
3300025713|Ga0208195_1059412 | Not Available | 1545 | Open in IMG/M |
3300025713|Ga0208195_1182301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 662 | Open in IMG/M |
3300025714|Ga0208458_1053903 | Not Available | 1579 | Open in IMG/M |
3300025737|Ga0208694_1039421 | Not Available | 2282 | Open in IMG/M |
3300025762|Ga0208040_1044634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 2091 | Open in IMG/M |
3300026194|Ga0209509_1040539 | Not Available | 1284 | Open in IMG/M |
3300026195|Ga0209312_1053129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1181 | Open in IMG/M |
3300026198|Ga0209313_1011046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 3078 | Open in IMG/M |
3300026250|Ga0209612_1169252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 549 | Open in IMG/M |
3300026290|Ga0209510_1083444 | Not Available | 1200 | Open in IMG/M |
3300026290|Ga0209510_1140536 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300026311|Ga0209723_1085613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1367 | Open in IMG/M |
3300026311|Ga0209723_1101222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1204 | Open in IMG/M |
3300027896|Ga0209777_10276692 | Not Available | 1308 | Open in IMG/M |
3300028601|Ga0265295_1038439 | All Organisms → cellular organisms → Bacteria | 3204 | Open in IMG/M |
3300028602|Ga0265294_10137201 | Not Available | 1872 | Open in IMG/M |
3300028602|Ga0265294_10374543 | Not Available | 911 | Open in IMG/M |
3300028602|Ga0265294_10396272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 875 | Open in IMG/M |
3300028602|Ga0265294_10692038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 583 | Open in IMG/M |
3300028602|Ga0265294_10716890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 568 | Open in IMG/M |
3300028603|Ga0265293_10088013 | Not Available | 2542 | Open in IMG/M |
3300028603|Ga0265293_10399971 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 828 | Open in IMG/M |
3300028624|Ga0302246_1012225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 3034 | Open in IMG/M |
3300028625|Ga0302251_1061850 | Not Available | 685 | Open in IMG/M |
3300028903|Ga0302250_1011844 | All Organisms → cellular organisms → Bacteria | 2531 | Open in IMG/M |
3300028916|Ga0310376_1000866 | Not Available | 40159 | Open in IMG/M |
3300029288|Ga0265297_10015925 | All Organisms → cellular organisms → Bacteria | 8465 | Open in IMG/M |
3300029288|Ga0265297_10022552 | Not Available | 6533 | Open in IMG/M |
3300029799|Ga0311022_10684898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 970 | Open in IMG/M |
3300029799|Ga0311022_13185825 | Not Available | 2779 | Open in IMG/M |
3300029825|Ga0134835_1105852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 572 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 25.53% |
Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 23.94% |
Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 15.43% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 9.57% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 5.32% |
Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 4.26% |
Hydrocarbon Resource Environments | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments | 3.19% |
Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 3.19% |
Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 1.60% |
Anaerobic Reactor | Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Anaerobic Reactor | 1.06% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.53% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.53% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.53% |
Petroleum Reservoir | Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Petroleum Reservoir | 0.53% |
Anaerobic Wastewater Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge | 0.53% |
Wastewater | Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater | 0.53% |
Wastewater Treatment Plant | Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater Treatment Plant | 0.53% |
Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 0.53% |
Anaerobic Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture | 0.53% |
Fermentation Pit Mud | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud | 0.53% |
Bioremediated Contaminated Groundwater | Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater | 0.53% |
Hydrocarbon Resource Environments | Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.53% |
Biogas Fermentantion | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion | 0.53% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000032 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300000568 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
3300001592 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2: | Engineered | Open in IMG/M |
3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
3300001761 | Wastewater microbial communities from Belvaux, Luxembourg - M36 | Engineered | Open in IMG/M |
3300002079 | CSTRmetagenomics | Engineered | Open in IMG/M |
3300002170 | Biogas fermentation microbial communities from Germany - Plant 3 DNA1 | Engineered | Open in IMG/M |
3300002219 | Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC: | Engineered | Open in IMG/M |
3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300002446 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
3300002703 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5 | Engineered | Open in IMG/M |
3300002821 | Iso-alkanes.Hi.seq-Iso3T | Engineered | Open in IMG/M |
3300002856 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Tailing Pond Surface TP_surface | Engineered | Open in IMG/M |
3300003535 | Petroleum reservoir microbial communities from Reconcavo Basin, Brazil, analyzing oil degradation - Bahia-well BA- 1 | Environmental | Open in IMG/M |
3300005326 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-23 | Engineered | Open in IMG/M |
3300006360 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Val_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300006381 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Total_1113_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300006386 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Oil_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300006387 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Oil_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300006593 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gly_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300006596 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Leu_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300006840 | Anaerobic bioreactor microbial communities from Canach, Luxembourg | Engineered | Open in IMG/M |
3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
3300009121 | Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C12.But.A IDBA | Engineered | Open in IMG/M |
3300009388 | Metatranscriptome sequencing of an Anaerobic Hexadecane-Degrading Microbial Consortia from University of California, San Diego, USA - Hexadecane | Engineered | Open in IMG/M |
3300009542 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A SIP RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300009607 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA | Engineered | Open in IMG/M |
3300009642 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C13 SIP DNA | Engineered | Open in IMG/M |
3300009647 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA | Engineered | Open in IMG/M |
3300009652 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C13 SIP DNA | Engineered | Open in IMG/M |
3300009656 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA | Engineered | Open in IMG/M |
3300009659 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C12 SIP DNA | Engineered | Open in IMG/M |
3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
3300009671 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA | Engineered | Open in IMG/M |
3300009674 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG | Engineered | Open in IMG/M |
3300009676 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG | Engineered | Open in IMG/M |
3300009680 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA | Engineered | Open in IMG/M |
3300009681 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG | Engineered | Open in IMG/M |
3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
3300009688 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG | Engineered | Open in IMG/M |
3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
3300009692 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG | Engineered | Open in IMG/M |
3300009696 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG | Engineered | Open in IMG/M |
3300009704 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG | Engineered | Open in IMG/M |
3300009707 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG | Engineered | Open in IMG/M |
3300009708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU001_MetaG | Engineered | Open in IMG/M |
3300009768 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC115_MetaG | Engineered | Open in IMG/M |
3300010310 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B SIP RNA (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300010346 | AD_USMOca | Engineered | Open in IMG/M |
3300010351 | AD_USPNca | Engineered | Open in IMG/M |
3300010352 | AD_JPHWca | Engineered | Open in IMG/M |
3300010353 | AD_USCAca | Engineered | Open in IMG/M |
3300010356 | AD_USDEca | Engineered | Open in IMG/M |
3300010357 | AD_USSTca | Engineered | Open in IMG/M |
3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015214 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG | Engineered | Open in IMG/M |
3300019206 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_STIC08_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019224 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R1-B RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019226 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC055_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019231 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300020072 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R2-B RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300020812 | Anaerobic digester digestate microbial community, University of Toronto, Ontario, Canada - DG074 megahit | Engineered | Open in IMG/M |
3300020813 | Anaerobic digester digestate microbial community, University of Toronto, Ontario, Canada - DG078 megahit | Engineered | Open in IMG/M |
3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
3300021603 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spades | Engineered | Open in IMG/M |
3300023207 | Combined Assembly of Gp0238866, Gp0238878, Gp0238879 | Engineered | Open in IMG/M |
3300025393 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025737 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025762 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300026194 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
3300026195 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
3300026198 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
3300026250 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
3300026290 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
3300026311 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300028601 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Methane capture system biofilm | Engineered | Open in IMG/M |
3300028602 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 | Environmental | Open in IMG/M |
3300028603 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R | Engineered | Open in IMG/M |
3300028624 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Trp | Engineered | Open in IMG/M |
3300028625 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_RA_Gln | Engineered | Open in IMG/M |
3300028903 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_RA_Asp | Engineered | Open in IMG/M |
3300028916 | Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA. Combined Assembly of Gp0220779, Gp0324998 | Engineered | Open in IMG/M |
3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
3300029799 | Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119 | Engineered | Open in IMG/M |
3300029825 | Liquor fermentation pit mud microbial communities from Luzhou, China - Meta-1-2-440-M | Engineered | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Draft_00063295 | 3300000032 | Hydrocarbon Resource Environments | IIDLDLWEDGNANQIPAITVTGQGLHFEGSTAEFDRLLLIMGGWLRP* |
Draft_00091402 | 3300000032 | Hydrocarbon Resource Environments | MPDRIIDLDLWEDGNANQLPAITVTGQGLHFEGSTAEFDRLLLIMGGWLKP* |
Draft_00787674 | 3300000032 | Hydrocarbon Resource Environments | MDERVIDLDLWAEGNAERLPAITVTAAGLRIEGSRAEFDRLLLILGGWMKP* |
Draft_100241922 | 3300000558 | Hydrocarbon Resource Environments | MPDRIIDLDLWEDGNANQLPAITVTGQGLHFEGSTAEFDRLLLIXGGWLKP* |
Draft_100625205 | 3300000558 | Hydrocarbon Resource Environments | MPDRTIDLDLWAEGNAERLPAITVTGQGLRIEGSVAEFDRLLLILGGWMKP* |
Draft_100841835 | 3300000558 | Hydrocarbon Resource Environments | MAERVIDLDLWAEGNAEKLPAITVTAAGLRIEGSQAEFDRLLLILGGWLRP* |
Draft_101166586 | 3300000558 | Hydrocarbon Resource Environments | MADRVIDLDLWEEGNAERLPAITVTPSGLRIEGSIAEFDRMILILGEWLKP* |
Draft_115478361 | 3300000558 | Hydrocarbon Resource Environments | MPDRTIDLDLWAEGNAEKLPAITVTPAGLRIEGSTAEFDRLILILGEWLKS* |
Draft_101031454 | 3300000568 | Hydrocarbon Resource Environments | IDLDLWEDGNANQIPAITVTPSGLHLEGSTAEFDRLLLIMGGWLKP* |
Draft_105339202 | 3300000568 | Hydrocarbon Resource Environments | PDRIIDLDLWAEGAANRLPAITVTPSGLRIEGSQAEFDRLILILGEWLHQ* |
Draft_100594646 | 3300001580 | Hydrocarbon Resource Environments | MADRVIDLDLWGEGAERLPAITVTPAGLRIEGSQAEFDRLLLILGGWMKP* |
Draft_102318931 | 3300001580 | Hydrocarbon Resource Environments | MPDRTIDLDLWADGAAEKLPAITVTGQGLRLKGSVAEFDRLILILGEWMKP* |
Draft_102827611 | 3300001592 | Hydrocarbon Resource Environments | WAEGNAEKLPAITVTAAGLRIEGSQAEFDRLLLILGGWMKP* |
Draft_100449573 | 3300001605 | Hydrocarbon Resource Environments | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSQAEFDRPLLILGGWMKP* |
Draft_102411261 | 3300001605 | Hydrocarbon Resource Environments | DLWAEGNAEKLPKITVTGQGLRLEGSVAEFDRLLLILGEWLKP* |
Draft_106137523 | 3300001605 | Hydrocarbon Resource Environments | MPDRIIDLDLWEDGNANQIPAITVTPSGLHLEGSTAEFDRLLLIMGGWLKP* |
CSTRM36_10041164 | 3300001761 | Wastewater | MADRVIDLDLWGEGAERLPAITITGQGLRIEGSQAEFDRLILIIGGWMK* |
CSTR_10226361 | 3300002079 | Wastewater Treatment Plant | ARGSMADRVIDLDLWGEGAERLPAITITGQGLRIEGSQAEFDRLILIIGGWMK* |
JGI24711J26586_101005853 | 3300002170 | Biogas Fermentantion | MADRVIDLDLWGEGAERLPAITITGQGLRIEGSQAEFDRLILIIGG |
SCADCLC_100369708 | 3300002219 | Hydrocarbon Resource Environments | MPDRIIDLDLWEDGNANQIPAITVTGQGLHFEGSTAEFDRLLLIMGGWLRP* |
MLSBCLC_104190383 | 3300002220 | Hydrocarbon Resource Environments | MADRLIDLDLWEDGASERLPKITVTGQGIRFEGTTAEFDRLLLILGGWLKL* |
NAPDCCLC_100218504 | 3300002446 | Hydrocarbon Resource Environments | MPDRTIDLDLWAEGNAEKLPKITVTGQGLRLEGSVAEFDRLLLILGEWLKP* |
draft_109761002 | 3300002703 | Hydrocarbon Resource Environments | MSDRVIDLDLWDEGAAERLPAIAVTPSGLRIEGSQAEFDRLLLILGGWLKP* |
draft_110153661 | 3300002703 | Hydrocarbon Resource Environments | MADRVINLDLWAEGVAERLPAITVTQAGLRLEGSTAEFDRLLLILGGWLKS* |
draft_110732027 | 3300002703 | Hydrocarbon Resource Environments | MPDRIIDLDLWEDGAANQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLKS* |
Iso3TCLC_100198079 | 3300002821 | Hydrocarbon Resource Environments | MADRVIDLDLWGEGAERLPAITVTGRGLRIEGSVAEFDRLILILGEWLKP* |
Iso3TCLC_100832391 | 3300002821 | Hydrocarbon Resource Environments | MPDRTIDLDLWADGAAERLPAITVTGQGLRIEGSIAEFDRLLLVLGGWMKP* |
draft_114819934 | 3300002856 | Hydrocarbon Resource Environments | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSQAEFDRLLLILGGWMKP* |
Ba1_10023373 | 3300003535 | Petroleum Reservoir | MTESKRIVDIDLWEDGTADRLPKITVTGAGLRFEGERAEFDRLCLILGGWLKP* |
Ga0074195_11108101 | 3300005326 | Bioremediated Contaminated Groundwater | DLDLWGVDNSKLPAITVTGGGLRFEGTPAEFDRLYLILKGWIKQ* |
Ga0079079_10100341 | 3300006360 | Anaerobic Digestor Sludge | MADRTIDLDLWDDGNADRLPAITVTPSGLRIEGSIAEFDRLILILGEWLRQ* |
Ga0079102_10062422 | 3300006381 | Anaerobic Digestor Sludge | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSIAEFDRLILILGEWLRQ* |
Ga0079102_13761261 | 3300006381 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNADQLPAITVTGRGLHFEGSAAEFDRLLLILGGWLRP* |
Ga0079068_10005622 | 3300006386 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNSNRLPAITVTGQGLHFEGSTAEFDRLLLILGGWLRP* |
Ga0079069_10371505 | 3300006387 | Anaerobic Digestor Sludge | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSVAEFDRLILILGEWLRQ* |
Ga0079081_10116561 | 3300006593 | Anaerobic Digestor Sludge | MPDRTIDLDLWAEGAAEKLPAITVTPSGLRIEGSIAEFDRLILILGEWLRQ* |
Ga0079074_13343502 | 3300006596 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNADQLPAITVTGQGLHFEGSAAEFDRLLLILGGWLRP* |
Ga0101790_1359473 | 3300006840 | Anaerobic Reactor | MADRVIDLDLWEDGAANQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLRP* |
Ga0101790_1470352 | 3300006840 | Anaerobic Reactor | MADRVIDLDLWGEGAERLPAITVTGQGLRIEGSQAEFDRLILIIGGWMK* |
Ga0079303_102062592 | 3300006930 | Deep Subsurface | MPSRVINLDLWGSDEAEKLPKISVTGQGLRLEGTTNEFDRLCLILGGWMKQ* |
Ga0118671_10015272 | 3300009121 | Anaerobic Wastewater Sludge | MPDRIIDLDLWEDGNSNQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLRP* |
Ga0103809_10150772 | 3300009388 | Enrichment Culture | MPDRTIDLNLWDEGAAENLPAITVTGQGLRIEGSIAEFDRLILILGEWLKS* |
Ga0116234_10634802 | 3300009542 | Anaerobic Biogas Reactor | MPDRIIDLDLWGEGAERLPAITVTGQGLRLEGSTAEFDRLLLILGGWLKS* |
Ga0116234_11702861 | 3300009542 | Anaerobic Biogas Reactor | MPDGIIDLDLWEDGNADQLPAITVTGQGLRLEGSTAEFDRLLLILGGWLRP* |
Ga0123327_10519552 | 3300009607 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGTAENLPAIAVTGQGLRIEGSIAEFDRLILILGEWLSP* |
Ga0123327_10817191 | 3300009607 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGSAERLPAFTVTGQGLRIEGSIAEFDRLILILGEWLSP* |
Ga0123331_10202744 | 3300009642 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGSAKNLPAFTVTGQGLRLEGSIAEFDRLILILGGWLRQ* |
Ga0123331_10250141 | 3300009642 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGTAENLPAIAVTGQGLRIEGSIAEFDRLVLILGGWMKP* |
Ga0123331_10458752 | 3300009642 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGAAERLPAFTFTGQGLRIEGSIAEFDRLILILGEWLSP* |
Ga0123331_10885372 | 3300009642 | Anaerobic Biogas Reactor | MPDGIIDLDLWEDGNADQLPAITVTGQGLHFEGSTAEFDRLLLIMGGWLRP* |
Ga0123326_10402271 | 3300009647 | Anaerobic Biogas Reactor | MPDRIIDLDLWEDGAANQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLRT* |
Ga0123326_10942121 | 3300009647 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGSAKNLPAFTVTGQGLRLEGSIAEFDRLIL |
Ga0123330_10656404 | 3300009652 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGAAENLPAITVTGQGLRIEGSIAEFDRLILILGEWLKS* |
Ga0123329_11247111 | 3300009656 | Anaerobic Biogas Reactor | MPDRIIDLDLWEDGAANQLPAITVTSQGLRLEGSTAEFDRLLLILGGWLRP* |
Ga0123329_12313091 | 3300009656 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGSAENLPAFTVTGQGLRIEGSIAEFDRLLLILGGW |
Ga0123328_13565552 | 3300009659 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGSAENLPAFTVTGQGLRIEGSIAEFDRLILILGEWLSP* |
Ga0116182_11486103 | 3300009666 | Anaerobic Digestor Sludge | MADRTIDLDLWDDGNADRLPAITVTPSGLRIEGSIAEFDRLLLILGGWLRP* |
Ga0116182_13394552 | 3300009666 | Anaerobic Digestor Sludge | MADRVIDLDLWEDGAADQLPAITVTGQGLHFEGSTAEFDRL |
Ga0116182_14383891 | 3300009666 | Anaerobic Digestor Sludge | MADRIIDLDLWGEGAERLPAITITGQGLRIEGSIAEFDRLILILGEWLSQ* |
Ga0116183_11060871 | 3300009670 | Anaerobic Digestor Sludge | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSTAEFDRLLLILGGWLRP* |
Ga0116183_11376962 | 3300009670 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGAADQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLRP* |
Ga0123334_10130122 | 3300009671 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGSAERLPAFTVTGQGLRIEGSIAEFDRLLLILGGWLKP* |
Ga0123334_10517782 | 3300009671 | Anaerobic Biogas Reactor | MPDRIIDLDLWEDGAANQLPAITVTGQGLRLEGSTAEFDRLLLILGGWLRP* |
Ga0116173_11060574 | 3300009674 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNANQIPAITVTGQGLHFEGSTAEFDRLLLILGGWLRP* |
Ga0116173_11355672 | 3300009674 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGAADQLPAITVTGQGLHFEGSTAEFDRLLLIMGGWLKP* |
Ga0116187_13177652 | 3300009676 | Anaerobic Digestor Sludge | MADRVIDLDLWAEGSAENLPEITVTGQGLRFEGSTSEFDRLLLILGGWI* |
Ga0123335_12709462 | 3300009680 | Anaerobic Biogas Reactor | MPDRIIDLDLWEDGNADQLPAITVTGQGLHFEGSTAEFDRLRLIMGGWLRP* |
Ga0123335_14042761 | 3300009680 | Anaerobic Biogas Reactor | MPDRIIDLDLWEDGAANQLPAITVTGQGLRLEGSTAEFDRLLLILGGWLKS* |
Ga0116174_103136741 | 3300009681 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNANQIPAITVTPSGLHLEGSTAEFDRLLLILGGWLRP* |
Ga0116144_103418822 | 3300009687 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNSNRLPAITVTGQGLHFEGSTAKFDRLLLILGGWLRP* |
Ga0116176_103741982 | 3300009688 | Anaerobic Digestor Sludge | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSVAEFDRLLLILGGWMKT* |
Ga0116176_104080121 | 3300009688 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNADQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLRP* |
Ga0116143_100949382 | 3300009690 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNADQLPAITVTPSGLHLEGSTAEFDRLLLILGGWLRP* |
Ga0116171_105060522 | 3300009692 | Anaerobic Digestor Sludge | DRTIDLDLWAEGAAQKLPAITVTPAGLRFEGSQAEFDRLCLILGGWLKT* |
Ga0116171_106595031 | 3300009692 | Anaerobic Digestor Sludge | MPDRTIDLDLWAPGAARKLPAITVTGQGLRLEGTQAEFDRLCLVLGGWLKP* |
Ga0116177_101304032 | 3300009696 | Anaerobic Digestor Sludge | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSTAEFDRLILILGEWLRQ* |
Ga0116145_10605612 | 3300009704 | Anaerobic Digestor Sludge | MDRVIDLDLWSEGNADNLPAITVTGQGLRFEGSTSEFDRLLLILGGWLKP* |
Ga0116195_10415441 | 3300009707 | Anaerobic Digestor Sludge | MPDRTIDLDLWDEGSAENLPAITVTCQGLRIEGSIAEFDRLILILGEWLSP* |
Ga0116194_10989421 | 3300009708 | Anaerobic Digestor Sludge | LWDEGAAENLPAITVTGQGLRIEGSIAEFDRLILILGEWLSP* |
Ga0116193_10501333 | 3300009768 | Anaerobic Digestor Sludge | MADRVIDLDLWGERAERLPAITVTGQGLRIEGSIAEFDRLLLILGGWMKP* |
Ga0116193_14291241 | 3300009768 | Anaerobic Digestor Sludge | MRTIDLDLWADGAAEKLPKITITAQGLRFEGREPEFDRLCLILGGWLKQ* |
Ga0116235_11946771 | 3300010310 | Anaerobic Biogas Reactor | MPDRIIDLDLWDEGAAERLPAITVTQAGLRLEGSTAEFDRLLLILGGWLKS* |
Ga0116239_110240372 | 3300010346 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNADQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLKP* |
Ga0116248_107776611 | 3300010351 | Anaerobic Digestor Sludge | MADRVIDLDLWGEGAERLPAITVTPPGLRIEGSQAEFDRLLLILGGWLA |
Ga0116247_108791052 | 3300010352 | Anaerobic Digestor Sludge | MPDRTIDLDLWAPGAARKLPAITVTGQGLRLEGTQAEFDRLCLILGG |
Ga0116247_110213092 | 3300010352 | Anaerobic Digestor Sludge | SMVEVREAGQRTVDLDLWAEGAAERLPKITVTAQGLRLQGSPQEFDRLCLVPGGWMKP* |
Ga0116236_113233211 | 3300010353 | Anaerobic Digestor Sludge | MPDRTIDLDLWAEGAAERLPAITVTGQGLRIEGSIAKFDRLILILGEWLK* |
Ga0116237_103997073 | 3300010356 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNADQLPAITVTGQGLHFEGSTAEFDRLLLIMGGWLRP* |
Ga0116237_104616812 | 3300010356 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNSNQLPAITVTGRGLHFEGSAAEFDRLLLILGGWLKP* |
Ga0116249_109106873 | 3300010357 | Anaerobic Digestor Sludge | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSTAEFDRLILILG |
Ga0172378_100928432 | 3300014203 | Groundwater | LDLWAEGVAERLPAITVTPSGLRIEGSIAEFDRLILILGEWLKP* |
Ga0172378_102024721 | 3300014203 | Groundwater | MPDRTINLDLWAEGAAERLPAITVTPAGLRIEGSQAEFDRLLLIIGGWMK* |
Ga0172378_108155361 | 3300014203 | Groundwater | MADRVIDLDLWGEGAERLPAITVTGQGLRIEGSIAEFDRLILILGEWLK |
Ga0172378_111499891 | 3300014203 | Groundwater | ARGSMPDRIIDLDLWEDGAERLPAITITGQGLRIEGSQAEFDRLLLILGGWMKP* |
Ga0172378_113090972 | 3300014203 | Groundwater | MPDRIIDLDLWEDGNADQLPAITVIGQGLHFEGSTAEFDRLLLILGGWLRP* |
Ga0172381_1000209139 | 3300014204 | Landfill Leachate | MNRIIDIDLWSDGAAESLPKITVTGQGLRIEGEPKEFDRLCLILGGWLKQ* |
Ga0172381_100086374 | 3300014204 | Landfill Leachate | MPDRTIDLDLWAEGNAERLPAITVTPSGLRIEGSIAEFDRLILILGEWLKP* |
Ga0172381_100659762 | 3300014204 | Landfill Leachate | MAERVIDLDLWAEGAAERLPAITVTPSGLRIEGSRAEFDRLLLILGGWMKP* |
Ga0172381_103160194 | 3300014204 | Landfill Leachate | MPDRTIDLDLWAEGAVEKLPKITVTPSGLRIEGSQAEFDRLLLILGGWMKP* |
Ga0172381_103423091 | 3300014204 | Landfill Leachate | MPDRIIDLDLWEDGNADQLPAITVTGQGLHFEGSTVEFDRLLLILGGWLRP* |
Ga0172381_103843661 | 3300014204 | Landfill Leachate | MPDRTIDLDLWAEGAAERLPAITVTGQGLRIEGSQAEFDRLLLILGGWMKS* |
Ga0172381_104077581 | 3300014204 | Landfill Leachate | MADRVIDLDLWAEGAAEKLPAITVTPAGLRIEGSQAEFDRLLLIL |
Ga0172381_104086872 | 3300014204 | Landfill Leachate | MPDRTIDLDLWAEGVAERLPAITVTGQGLRIEGSIAEFDRLILIIGGWMK* |
Ga0172381_104130604 | 3300014204 | Landfill Leachate | MPDRTIDLDLWGEGNAEKLPAITVTPSGLRIEGSIAEFDRLLLILGGWLK* |
Ga0172381_104615682 | 3300014204 | Landfill Leachate | MADRIIDLDLWGEGAERLPAITVTGQGLRIEGSQAEFDRLILILGEWLSQ* |
Ga0172381_105553501 | 3300014204 | Landfill Leachate | DMADRVIDLDLWEYADQLPAITVTPQGLHFEGSVAEFDRLLLILGGWMKP* |
Ga0172381_107288022 | 3300014204 | Landfill Leachate | MADRVIDLDLWAEGNAEKLPAITVTAAGLRIEGSQAEFDRLLLILGGWMK* |
Ga0172381_107551552 | 3300014204 | Landfill Leachate | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSQAEFDRLLLIL |
Ga0172381_111979241 | 3300014204 | Landfill Leachate | MTERVIDLDLWDEGSAERLPAITVTGQGLRIEGSTAEFDRLLLILGGWMKP* |
Ga0172381_112051441 | 3300014204 | Landfill Leachate | MPDRIIDLDLWEDGAADQLPAITVTGRGLHFEGSAAEFDRLLLILGGWLRP* |
Ga0172381_112139592 | 3300014204 | Landfill Leachate | MADRVINLDLWAEGAAERLPAITVTPSGLRIEGSIAEFDRLILILGEWLKP* |
Ga0172381_112533072 | 3300014204 | Landfill Leachate | MPDRVIDLDLWDEGAAERLPAITVTQAGLRLEGSTAEFDRLLLILGGWLRP* |
Ga0172381_113161521 | 3300014204 | Landfill Leachate | MPDRTIDLDLWAEGAAERLPAITVTGQGLRIEGSQAEFDRLILILGEWISQ* |
Ga0172380_100917481 | 3300014205 | Landfill Leachate | MPDRTIDLDLWAEGAAERLPAITVTCQGLRIEGSIAEFDRLILIIGGWMK* |
Ga0172380_103406072 | 3300014205 | Landfill Leachate | MPDLRTIDLDLWAEGAAQSLPKITVTPAGLRIEGEPKEFDRLCLILAGWLKQS* |
Ga0172380_103921212 | 3300014205 | Landfill Leachate | MIRTIDLNLWAEGAAESLPKITVTPAGLRIEGEPKEFDRLCLILGGWLKQSR* |
Ga0172380_104098001 | 3300014205 | Landfill Leachate | MADRVIDLDLWGEGAERLPAITVTPAGLRIEGSIAEFDRLLLILGGWLK* |
Ga0172380_106103682 | 3300014205 | Landfill Leachate | MPDRTIDLDLWADGAAEKLPAITVTGQGLRIEGSIAEFDRLILILGEWLRQ* |
Ga0172380_107651582 | 3300014205 | Landfill Leachate | MTERVIDLDLWDEGSAERLPAITVTGQGLRIEGSQAEFDRLILIIGGWMK* |
Ga0172380_107786782 | 3300014205 | Landfill Leachate | MPDRIIDLDLWEDGNSNQLPAITVTGQGLHFEGSTAEFDRLLLIMGGWLKP* |
Ga0172380_107870622 | 3300014205 | Landfill Leachate | MPDRIIDLDLWEDGNANQLPAITVTGQGLHLEGSTAEFDRLLLILGGWLRP* |
Ga0172380_109987421 | 3300014205 | Landfill Leachate | MADRTIDLDLWDDGNADRLPAITVTPSGLRIEGSIAEFDRLILI |
Ga0172380_110714732 | 3300014205 | Landfill Leachate | MADRVINLDLWAEGVAERLPAITVTPSGLRIEGSIAEFDRLILILGEWLKP* |
Ga0172380_112513471 | 3300014205 | Landfill Leachate | MPDRTIDLDLWVEGAAEKLPAITVTAAGLRIEGSIAEFDRLILIIGGWMK* |
Ga0172380_112922981 | 3300014205 | Landfill Leachate | MPDRTIDLDLWDEGVAERLPAITVTGQGLRIEGSIAEFDRLILILGEWLKP* |
Ga0172377_100605773 | 3300014206 | Landfill Leachate | MRSVDIDLWSDGASDQLPKITVTPSGLRIEGEPKEFDRLCLILGGWIKQ* |
Ga0172377_101761711 | 3300014206 | Landfill Leachate | MPDRIIDLDLWEDGAERLPAITITGQGLRIEGSQAEFDRLLLILGGWMKP* |
Ga0172377_102441911 | 3300014206 | Landfill Leachate | MADRVIDLDLWGEGAERLPAITVTGQGLRIEGSQAEFDRLILILGEWLSQ* |
Ga0172377_103241263 | 3300014206 | Landfill Leachate | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSQAEFDRLLLILGGWM |
Ga0172377_105089392 | 3300014206 | Landfill Leachate | MPYRVIDLDLWEDGAADQLPAITVTGQGLHFEGSTAEFDRLLLIMGGWLKS* |
Ga0172377_109078993 | 3300014206 | Landfill Leachate | DLWEDGNSNQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLRP* |
Ga0182027_100486749 | 3300014839 | Fen | MNNRVIDLDLWQEGAAESLPKITVTPQGLRIEGKPAEFDRLCLILGGWLKP* |
Ga0172382_100581054 | 3300015214 | Landfill Leachate | MPDRIIDLDLWEDGNADQLPAITVTGQGLRLEGSTAEFDRLLLILGGWLRP* |
Ga0172382_108034681 | 3300015214 | Landfill Leachate | MPDRTIDLDLWVEGAAEKLPAITVTAAGLRIEGSQAEFDRLLLILGGWMKP* |
Ga0172382_110439021 | 3300015214 | Landfill Leachate | GDMADRVINLDLWAEGVAERLPAITVTGQGIRIEGSQAEFDRLLLIIGGWMK* |
Ga0172382_110900001 | 3300015214 | Landfill Leachate | MPDRVIDLDLWEDGAANQLPAITVTGQGLRLEGSTAEFDRLLLILGGWLRT* |
Ga0179943_12038351 | 3300019206 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNADQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLRP |
Ga0180029_11509453 | 3300019224 | Anaerobic Biogas Reactor | MPDRIIDLDLWDEGAAERLPAITVTQAGLRLEGSTAEFDRLLLILGGWLRP |
Ga0179934_12492021 | 3300019226 | Anaerobic Digestor Sludge | MADRVIDLDLWEDGNADQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLRP |
Ga0179935_11519741 | 3300019231 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNSNQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLRP |
Ga0180031_10687638 | 3300020072 | Anaerobic Biogas Reactor | MPDRIIDLDLWEDGAANQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLRP |
Ga0214071_14966701 | 3300020812 | Anaerobic Digester Digestate | MQKMRTIDLDLWTEGAAERLPAITITPAGLHFEGTTAEFDRLCLILGGWLKQ |
Ga0214086_15588832 | 3300020813 | Anaerobic Digester Digestate | MRTIDLDLWAEGAAERLPKITITAQGLRFQGEDPEFDRLCLILGGWLKQ |
Ga0214088_11253171 | 3300020814 | Granular Sludge | MPDRIIDLDVWEDGNANQLPAITVTGQGLHFEGSTAEFDRLLLIMGGWLRP |
Ga0214088_13069622 | 3300020814 | Granular Sludge | MPDRIIDLDLWEDGAANQLPAITVTGQGLRLEGSTAEFDRLLLILGGWLKS |
Ga0214088_13765572 | 3300020814 | Granular Sludge | MPDRIIDLDLWEDGNADQLPAITVTGQGLHFEGSTVEFDRLLLILGGWLRP |
Ga0214088_13788121 | 3300020814 | Granular Sludge | MPDRIIDLDLWEDGNANQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLRP |
Ga0214088_183241013 | 3300020814 | Granular Sludge | MPDRVIDLDLWGEGAERLPAITVTGQGLRIEGSIAEFDRLILILGEWLSQ |
Ga0214088_18352971 | 3300020814 | Granular Sludge | MPDRIIDLDLWEDGAANQLPAITVTGQGLHFEGSTAEFDRLLLIL |
Ga0214088_18408562 | 3300020814 | Granular Sludge | MPDRIIDLDLWEDGNADQIPAITVTGQGLHLEGSTAEFDRLLLILGGWLRP |
Ga0226659_103667631 | 3300021603 | Granular Sludge | MPDRTIDLDLWDEGAAENLPAIAVTGQGIRIEGSIAEFDRLIMIL |
Ga0255811_105169323 | 3300023207 | Anaerobic Digester Digestate | MPDRIIDLDLWEDGNADQIPAITVTGQGLHLEGSTAEFDRLLLILGGWLKP |
Ga0255811_115718523 | 3300023207 | Anaerobic Digester Digestate | DLWEDGNADQLPAITVTGQGLHFEGSTVEFDRLLLILGGWLRP |
Ga0208041_10541911 | 3300025393 | Anaerobic Digestor Sludge | MPDRTIDLDLWDEGSAENLPAITVTCQGLRIEGSIAEFDRLILILGEWLSP |
Ga0208195_10168977 | 3300025713 | Anaerobic Digestor Sludge | MADRVIDLDLWGEGAERLPAITVTGQGLRIEGSQAEFDRLILIIGGWMK |
Ga0208195_10334442 | 3300025713 | Anaerobic Digestor Sludge | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSVAEFDRLLLILGGWMKT |
Ga0208195_10442963 | 3300025713 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGAADQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLRP |
Ga0208195_10594123 | 3300025713 | Anaerobic Digestor Sludge | MADRIIDLDLWGEGAERLPAITITGQGLRIEGSIAEFDRLILILGEWLSQ |
Ga0208195_11823012 | 3300025713 | Anaerobic Digestor Sludge | MADRTIDLDLWDDGNADRLPAITVTPSGLRIEGSIAEFDRLLLILGGWLRP |
Ga0208458_10539031 | 3300025714 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGNANQIPAITVTGQGLHFEGSTAEFDRLLLIMGGWLRP |
Ga0208694_10394215 | 3300025737 | Anaerobic Digestor Sludge | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSTAEFDRLLLI |
Ga0208040_10446343 | 3300025762 | Anaerobic Digestor Sludge | MPDRIIDLDLWEDGAADQLPAITVTGQGLHFEGSTAEFDRLLLIMGGWLKP |
Ga0209509_10405391 | 3300026194 | Anaerobic Biogas Reactor | MPDRIIDLDLWDEGAAERLPAITVTQAGLRLEGSTAEFDRL |
Ga0209312_10531292 | 3300026195 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGTAENLPAIAVTGQGLRIEGSIAEFDRLILILGEWLSP |
Ga0209313_10110466 | 3300026198 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGSAKNLPAFTVTGQGLRLEGSIAEFDRLILILGGWLRQ |
Ga0209612_11692521 | 3300026250 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGTAENLPAIAVTGQGLRIEGSIAEFDRL |
Ga0209510_10834443 | 3300026290 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGSAERLPAFTVTGQGLRIEGSIAEFDRLILILGEWLSP |
Ga0209510_11405361 | 3300026290 | Anaerobic Biogas Reactor | MPDRIIDLDLWEDGAANQLPAITVTGQGLRLEGSTAEFDRLLLILGGWLRP |
Ga0209723_10856131 | 3300026311 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGTAENLPAIAVTGQGLRIEGSIAEFDRLVLILGGWMKP |
Ga0209723_11012224 | 3300026311 | Anaerobic Biogas Reactor | MPDRTIDLDLWDEGAAENLPAITVTGQGLRIEGSQAEFDRLILILGEWLSQ |
Ga0209777_102766924 | 3300027896 | Freshwater Lake Sediment | MRTVDLDLWAEGVAQELPKITVTDQGLRFEGEPKEFDRLCLILGGWLKP |
Ga0265295_10384393 | 3300028601 | Landfill Leachate | MPDRVIDLDLWGEGAERLPAITVTPSGLRIEGSQAEFDRLLLILGGWIKE |
Ga0265294_101372013 | 3300028602 | Groundwater | MPDRTIDLDLWADGAAEKLPAITVTGQGLRLKGSVAEFDRLILILGEWMKP |
Ga0265294_103745432 | 3300028602 | Groundwater | MADRVINLDLWAEGVAERLPAITVTPSGLRIEGSIAEFDRLILILGEWLKP |
Ga0265294_103962721 | 3300028602 | Groundwater | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSQAEFDRLLLILGGWMKP |
Ga0265294_106920381 | 3300028602 | Groundwater | MPDRIIDLDLWEDGAADQLPAITVTGQGLHLEGSTAEFDRLLLILGGWLRP |
Ga0265294_107168902 | 3300028602 | Groundwater | MPDRIIDLDLWEDGAERLPAITITGQGLRIEGSQAEFDRLILIIGGWMK |
Ga0265293_100880135 | 3300028603 | Landfill Leachate | MPDRIIDLDLWEDGAERLPAITVTGQGLRIEGSQAEFDRLILILGEWLSQ |
Ga0265293_103999712 | 3300028603 | Landfill Leachate | MPDRIIDLDLWEDGAANQLPAITVTGQGLRLEGSTAEFDRLLLILGGWLRT |
Ga0302246_10122255 | 3300028624 | Activated Sludge | MPDRTIDLDLWAEGAAEKLPAITVTPAGLRIEGSIAEFDRLILILGEWLRQ |
Ga0302251_10618502 | 3300028625 | Activated Sludge | MRQIDLDLWADGAADNLPKITVTAQGLRLEGEPAEFDRLCLILS |
Ga0302250_10118444 | 3300028903 | Activated Sludge | MRQIDLDLWADGAADNLPKITVTAQGLRLEGEPAEFDRLCLILSGWIKQ |
Ga0310376_100086643 | 3300028916 | Anaerobic Enrichment Culture | MRSVDIDLWADGVAESLPKITITGQGLRIEGEPKEFDRLCLILGGWIKQS |
Ga0265297_100159254 | 3300029288 | Landfill Leachate | MPDRIIDLDLWEDGAERLPAITVTGQGIRIEGSQAEFDRLLLIIGGWMKP |
Ga0265297_1002255212 | 3300029288 | Landfill Leachate | MPDRVIDLDLWGEGAERLPAITITGQGLRIEGSIAEFDRLILIIGGWMK |
Ga0311022_106848982 | 3300029799 | Anaerobic Digester Digestate | MPDRIIDLDLWEDGNADQLPAITVTGQGLHFEGSTVEFDRLLLILGGWLR |
Ga0311022_131858256 | 3300029799 | Anaerobic Digester Digestate | MPDRIIDLDLWEDGAANQLPAITVTGQGLHFEGSTAEFDRLLLILGGWLKS |
Ga0134835_11058522 | 3300029825 | Fermentation Pit Mud | MADRVIDLDLWGEGAERLPAITVTGQGLRIEGSIAEFDRLILVLGEWMK |
⦗Top⦘ |