


| Basic Information | |
|---|---|
| Family ID | F026449 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 198 |
| Average Sequence Length | 41 residues |
| Representative Sequence | TISKSKMISRRQGGGDEAYCTYVEEADDAANKDSALI |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 198 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.19 % |
| % of genes near scaffold ends (potentially truncated) | 73.23 % |
| % of genes from short scaffolds (< 2000 bps) | 72.22 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.202 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (35.353 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.364 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.071 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 198 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 3.54 |
| PF00076 | RRM_1 | 2.02 |
| PF00293 | NUDIX | 2.02 |
| PF01261 | AP_endonuc_2 | 2.02 |
| PF00155 | Aminotran_1_2 | 1.52 |
| PF01476 | LysM | 1.52 |
| PF00501 | AMP-binding | 1.01 |
| PF01979 | Amidohydro_1 | 1.01 |
| PF00850 | Hist_deacetyl | 1.01 |
| PF02775 | TPP_enzyme_C | 1.01 |
| PF00107 | ADH_zinc_N | 1.01 |
| PF01029 | NusB | 1.01 |
| PF00005 | ABC_tran | 1.01 |
| PF02310 | B12-binding | 1.01 |
| PF00291 | PALP | 1.01 |
| PF13193 | AMP-binding_C | 1.01 |
| PF02789 | Peptidase_M17_N | 1.01 |
| PF00491 | Arginase | 1.01 |
| PF09924 | LPG_synthase_C | 1.01 |
| PF02386 | TrkH | 1.01 |
| PF02219 | MTHFR | 1.01 |
| PF02604 | PhdYeFM_antitox | 1.01 |
| PF01734 | Patatin | 1.01 |
| PF00226 | DnaJ | 0.51 |
| PF13362 | Toprim_3 | 0.51 |
| PF00206 | Lyase_1 | 0.51 |
| PF04536 | TPM_phosphatase | 0.51 |
| PF13519 | VWA_2 | 0.51 |
| PF02163 | Peptidase_M50 | 0.51 |
| PF16363 | GDP_Man_Dehyd | 0.51 |
| PF02954 | HTH_8 | 0.51 |
| PF03695 | UPF0149 | 0.51 |
| PF13810 | DUF4185 | 0.51 |
| PF06580 | His_kinase | 0.51 |
| PF13484 | Fer4_16 | 0.51 |
| PF13187 | Fer4_9 | 0.51 |
| PF13304 | AAA_21 | 0.51 |
| PF12850 | Metallophos_2 | 0.51 |
| PF07883 | Cupin_2 | 0.51 |
| PF07690 | MFS_1 | 0.51 |
| PF02823 | ATP-synt_DE_N | 0.51 |
| PF06463 | Mob_synth_C | 0.51 |
| PF00670 | AdoHcyase_NAD | 0.51 |
| PF03950 | tRNA-synt_1c_C | 0.51 |
| PF02253 | PLA1 | 0.51 |
| PF13091 | PLDc_2 | 0.51 |
| PF00860 | Xan_ur_permease | 0.51 |
| PF03479 | PCC | 0.51 |
| PF05016 | ParE_toxin | 0.51 |
| PF10400 | Vir_act_alpha_C | 0.51 |
| PF00383 | dCMP_cyt_deam_1 | 0.51 |
| PF13180 | PDZ_2 | 0.51 |
| PF00152 | tRNA-synt_2 | 0.51 |
| PF03853 | YjeF_N | 0.51 |
| PF17033 | Peptidase_M99 | 0.51 |
| PF04191 | PEMT | 0.51 |
| PF02826 | 2-Hacid_dh_C | 0.51 |
| PF00133 | tRNA-synt_1 | 0.51 |
| PF06050 | HGD-D | 0.51 |
| PF04432 | FrhB_FdhB_C | 0.51 |
| PF02565 | RecO_C | 0.51 |
| PF00694 | Aconitase_C | 0.51 |
| PF01613 | Flavin_Reduct | 0.51 |
| PF05958 | tRNA_U5-meth_tr | 0.51 |
| PF13539 | Peptidase_M15_4 | 0.51 |
| PF05973 | Gp49 | 0.51 |
| PF05157 | T2SSE_N | 0.51 |
| PF00132 | Hexapep | 0.51 |
| PF00920 | ILVD_EDD | 0.51 |
| PF12806 | Acyl-CoA_dh_C | 0.51 |
| PF05746 | DALR_1 | 0.51 |
| PF01964 | ThiC_Rad_SAM | 0.51 |
| PF01642 | MM_CoA_mutase | 0.51 |
| PF13561 | adh_short_C2 | 0.51 |
| PF08902 | DUF1848 | 0.51 |
| PF14492 | EFG_III | 0.51 |
| PF14022 | DUF4238 | 0.51 |
| PF03188 | Cytochrom_B561 | 0.51 |
| PF01951 | Archease | 0.51 |
| PF00156 | Pribosyltran | 0.51 |
| PF02646 | RmuC | 0.51 |
| PF06071 | YchF-GTPase_C | 0.51 |
| PF13624 | SurA_N_3 | 0.51 |
| PF11741 | AMIN | 0.51 |
| PF03668 | ATP_bind_2 | 0.51 |
| PF07313 | DUF1460 | 0.51 |
| PF02803 | Thiolase_C | 0.51 |
| PF00004 | AAA | 0.51 |
| PF03764 | EFG_IV | 0.51 |
| PF00158 | Sigma54_activat | 0.51 |
| PF00348 | polyprenyl_synt | 0.51 |
| PF00591 | Glycos_transf_3 | 0.51 |
| PF10458 | Val_tRNA-synt_C | 0.51 |
| PF13487 | HD_5 | 0.51 |
| PF13231 | PMT_2 | 0.51 |
| PF02576 | RimP_N | 0.51 |
| PF01545 | Cation_efflux | 0.51 |
| PF01969 | Ni_insertion | 0.51 |
| PF08335 | GlnD_UR_UTase | 0.51 |
| PF00561 | Abhydrolase_1 | 0.51 |
| PF08032 | SpoU_sub_bind | 0.51 |
| PF00912 | Transgly | 0.51 |
| PF17191 | RecG_wedge | 0.51 |
| PF04199 | Cyclase | 0.51 |
| PF01121 | CoaE | 0.51 |
| PF01869 | BcrAD_BadFG | 0.51 |
| PF01242 | PTPS | 0.51 |
| PF04055 | Radical_SAM | 0.51 |
| PF13336 | AcetylCoA_hyd_C | 0.51 |
| PF13801 | Metal_resist | 0.51 |
| PF16123 | HAGH_C | 0.51 |
| PF01656 | CbiA | 0.51 |
| PF13507 | GATase_5 | 0.51 |
| PF00270 | DEAD | 0.51 |
| PF00012 | HSP70 | 0.51 |
| PF00378 | ECH_1 | 0.51 |
| PF16916 | ZT_dimer | 0.51 |
| PF01926 | MMR_HSR1 | 0.51 |
| PF01758 | SBF | 0.51 |
| PF01497 | Peripla_BP_2 | 0.51 |
| PF06305 | LapA_dom | 0.51 |
| PF02749 | QRPTase_N | 0.51 |
| PF11818 | DUF3340 | 0.51 |
| PF00437 | T2SSE | 0.51 |
| PF00462 | Glutaredoxin | 0.51 |
| PF14714 | KH_dom-like | 0.51 |
| PF02353 | CMAS | 0.51 |
| PF02254 | TrkA_N | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 198 Family Scaffolds |
|---|---|---|---|
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.02 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 1.01 |
| COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 1.01 |
| COG0168 | Trk-type K+ transport system, membrane component | Inorganic ion transport and metabolism [P] | 1.01 |
| COG0260 | Leucyl aminopeptidase | Amino acid transport and metabolism [E] | 1.01 |
| COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 1.01 |
| COG1752 | Predicted acylesterase/phospholipase RssA, containd patatin domain | General function prediction only [R] | 1.01 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.01 |
| COG3621 | Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotR | General function prediction only [R] | 1.01 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.01 |
| COG4667 | Predicted phospholipase, patatin/cPLA2 family | Lipid transport and metabolism [I] | 1.01 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0012 | Ribosome-binding ATPase YchF, GTP1/OBG family | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.51 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0062 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate epimerase domain | Nucleotide transport and metabolism [F] | 0.51 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.51 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 0.51 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.51 |
| COG0237 | Dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.51 |
| COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 0.51 |
| COG0422 | 4-amino-2-methyl-5-hydroxymethylpyrimidine (HMP) synthase ThiC | Coenzyme transport and metabolism [H] | 0.51 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG0480 | Translation elongation factor EF-G, a GTPase | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 0.51 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0566 | tRNA G18 (ribose-2'-O)-methylase SpoU | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0614 | ABC-type Fe3+-hydroxamate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.51 |
| COG0720 | 6-pyruvoyl-tetrahydropterin synthase | Coenzyme transport and metabolism [H] | 0.51 |
| COG0744 | Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0779 | Ribosome maturation factor RimP | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG1035 | Coenzyme F420-reducing hydrogenase, beta subunit | Energy production and conversion [C] | 0.51 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.51 |
| COG1322 | DNA anti-recombination protein (rearrangement mutator) RmuC | Replication, recombination and repair [L] | 0.51 |
| COG1371 | Archease, activates RNA ligation by RtcB (tRNA splicing) | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG1381 | Recombinational DNA repair protein RecO (RecF pathway) | Replication, recombination and repair [L] | 0.51 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.51 |
| COG1641 | CTP-dependent cyclometallase, nickel-pincer nucleotide (NPN) cofactor biosynthesis | Coenzyme transport and metabolism [H] | 0.51 |
| COG1660 | RNase adaptor protein RapZ for GlmZ sRNA degradation, contains a P-loop ATPase domain | Signal transduction mechanisms [T] | 0.51 |
| COG1661 | Predicted DNA-binding protein with PD1-like DNA-binding motif, PPC/DUF296 domain | General function prediction only [R] | 0.51 |
| COG1775 | Benzoyl-CoA reductase/2-hydroxyglutaryl-CoA dehydratase subunit, BcrC/BadD/HgdB | Amino acid transport and metabolism [E] | 0.51 |
| COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.51 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.51 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 0.51 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.51 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.51 |
| COG2230 | Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferases | Lipid transport and metabolism [I] | 0.51 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG2829 | Outer membrane phospholipase A | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG2844 | UTP:GlnB (protein PII) uridylyltransferase | Signal transduction mechanisms [T] | 0.51 |
| COG2896 | GTP 3',8-cyclase (molybdenum cofactor biosynthesis protein MoaA) | Coenzyme transport and metabolism [H] | 0.51 |
| COG2972 | Sensor histidine kinase YesM | Signal transduction mechanisms [T] | 0.51 |
| COG3079 | Uncharacterized conserved protein YgfB, UPF0149 family | Function unknown [S] | 0.51 |
| COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.51 |
| COG3657 | Putative component of the toxin-antitoxin plasmid stabilization module | Defense mechanisms [V] | 0.51 |
| COG3771 | Lipopolysaccharide assembly protein YciS/LapA, DUF1049 family | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.51 |
| COG4558 | ABC-type hemin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.51 |
| COG4592 | ABC-type Fe2+-enterobactin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.51 |
| COG4594 | ABC-type Fe3+-citrate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.51 |
| COG4607 | ABC-type enterochelin transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.51 |
| COG4679 | Phage-related protein gp49, toxin component of the Tad-Ata toxin-antitoxin system | Defense mechanisms [V] | 0.51 |
| COG4953 | Membrane carboxypeptidase/penicillin-binding protein PbpC | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG5009 | Membrane carboxypeptidase/penicillin-binding protein | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.71 % |
| Unclassified | root | N/A | 29.29 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908035|B3_GZOS_CLC_ConsensusfromContig105992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1170 | Open in IMG/M |
| 2124908035|B3_GZOS_CLC_ConsensusfromContig114770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 624 | Open in IMG/M |
| 2124908035|B3_GZOS_CLC_ConsensusfromContig98883 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 2124908038|B3_all_c_ConsensusfromContig137130 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 2124908038|B3_all_c_ConsensusfromContig153003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 2770 | Open in IMG/M |
| 2124908039|B3_v_NODE_51601_len_1388_cov_5_347262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella | 1438 | Open in IMG/M |
| 2140918024|NODE_166641_length_1397_cov_11.842520 | Not Available | 1447 | Open in IMG/M |
| 2140918024|NODE_472538_length_5963_cov_9.661412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus | 6013 | Open in IMG/M |
| 2140918024|NODE_60612_length_754_cov_9.099469 | Not Available | 804 | Open in IMG/M |
| 2140918024|NODE_77163_length_2020_cov_10.088614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2070 | Open in IMG/M |
| 2140918025|NODE_419632_length_832_cov_16.991587 | Not Available | 882 | Open in IMG/M |
| 3300001410|JGI20179J14886_1021884 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
| 3300001870|JGI24129J20441_1062524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 768 | Open in IMG/M |
| 3300002066|JGIcombinedJ21911_10024574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2178 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10018254 | All Organisms → cellular organisms → Bacteria | 3166 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10079819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-6 | 1353 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10187922 | Not Available | 748 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10188080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-10 | 748 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10203028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC | 709 | Open in IMG/M |
| 3300002071|JGIcombinedJ21915_10291855 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300002072|JGIcombinedJ21914_10205142 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300002179|JGI24141J26756_1007248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3325 | Open in IMG/M |
| 3300002183|JGI24145J26757_10001467 | All Organisms → cellular organisms → Bacteria | 7070 | Open in IMG/M |
| 3300002183|JGI24145J26757_10008753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus | 2606 | Open in IMG/M |
| 3300002183|JGI24145J26757_10055940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 902 | Open in IMG/M |
| 3300002183|JGI24145J26757_10070721 | Not Available | 786 | Open in IMG/M |
| 3300002515|JGI24144J35610_10130061 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300002538|JGI24132J36420_10001682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 10006 | Open in IMG/M |
| 3300002538|JGI24132J36420_10002261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus | 8553 | Open in IMG/M |
| 3300002538|JGI24132J36420_10026209 | All Organisms → cellular organisms → Bacteria | 2119 | Open in IMG/M |
| 3300002549|JGI24130J36418_10019484 | Not Available | 2090 | Open in IMG/M |
| 3300002549|JGI24130J36418_10146758 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300002551|JGI24135J36437_1005578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus | 2594 | Open in IMG/M |
| 3300002569|JGI24136J36422_10021387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus | 2034 | Open in IMG/M |
| 3300002569|JGI24136J36422_10067462 | Not Available | 1015 | Open in IMG/M |
| 3300002569|JGI24136J36422_10151765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 600 | Open in IMG/M |
| 3300003369|JGI24140J50213_10012774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3207 | Open in IMG/M |
| 3300003852|Ga0031655_10001275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 15078 | Open in IMG/M |
| 3300003852|Ga0031655_10003734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 8472 | Open in IMG/M |
| 3300003852|Ga0031655_10005704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 6740 | Open in IMG/M |
| 3300003858|Ga0031656_10215715 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300003861|Ga0031654_10243538 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300003861|Ga0031654_10247793 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005236|Ga0066636_10146686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus | 1120 | Open in IMG/M |
| 3300005938|Ga0066795_10048733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1248 | Open in IMG/M |
| 3300005938|Ga0066795_10086304 | Not Available | 932 | Open in IMG/M |
| 3300005938|Ga0066795_10089577 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300005947|Ga0066794_10087930 | Not Available | 927 | Open in IMG/M |
| 3300005947|Ga0066794_10104834 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300005947|Ga0066794_10185244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 626 | Open in IMG/M |
| 3300005980|Ga0066798_10046633 | Not Available | 1379 | Open in IMG/M |
| 3300006589|Ga0079072_1213840 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300006591|Ga0079071_1004360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae | 1122 | Open in IMG/M |
| 3300006594|Ga0079073_1255731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 557 | Open in IMG/M |
| 3300006640|Ga0075527_10164623 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300006640|Ga0075527_10266659 | Not Available | 503 | Open in IMG/M |
| 3300006642|Ga0075521_10401724 | Not Available | 667 | Open in IMG/M |
| 3300006795|Ga0075520_1003522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella | 7894 | Open in IMG/M |
| 3300006795|Ga0075520_1003701 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7733 | Open in IMG/M |
| 3300006795|Ga0075520_1034418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2493 | Open in IMG/M |
| 3300006795|Ga0075520_1050155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2005 | Open in IMG/M |
| 3300006795|Ga0075520_1077682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1540 | Open in IMG/M |
| 3300006795|Ga0075520_1125676 | All Organisms → cellular organisms → Bacteria → Spirochaetes | 1140 | Open in IMG/M |
| 3300006795|Ga0075520_1183287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 896 | Open in IMG/M |
| 3300006949|Ga0075528_10219593 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300008008|Ga0100399_1076619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1559 | Open in IMG/M |
| 3300008085|Ga0100378_1468250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 544 | Open in IMG/M |
| 3300009029|Ga0066793_10244502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1041 | Open in IMG/M |
| 3300009029|Ga0066793_10291167 | Not Available | 944 | Open in IMG/M |
| 3300009029|Ga0066793_10298112 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300009131|Ga0115027_11440934 | Not Available | 562 | Open in IMG/M |
| 3300009168|Ga0105104_10766472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 558 | Open in IMG/M |
| 3300009179|Ga0115028_10284414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1102 | Open in IMG/M |
| 3300009615|Ga0116103_1092593 | Not Available | 781 | Open in IMG/M |
| 3300009687|Ga0116144_10019947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 4692 | Open in IMG/M |
| 3300009687|Ga0116144_10023205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4231 | Open in IMG/M |
| 3300009690|Ga0116143_10115664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1527 | Open in IMG/M |
| 3300009690|Ga0116143_10126350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1443 | Open in IMG/M |
| 3300009692|Ga0116171_10068520 | All Organisms → cellular organisms → Bacteria | 2223 | Open in IMG/M |
| 3300009692|Ga0116171_10334657 | Not Available | 818 | Open in IMG/M |
| 3300009692|Ga0116171_10447871 | Not Available | 681 | Open in IMG/M |
| 3300009693|Ga0116141_10510894 | Not Available | 605 | Open in IMG/M |
| 3300009694|Ga0116170_10027177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4189 | Open in IMG/M |
| 3300009694|Ga0116170_10266240 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300009694|Ga0116170_10682691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 536 | Open in IMG/M |
| 3300009694|Ga0116170_10742030 | Not Available | 509 | Open in IMG/M |
| 3300009707|Ga0116195_1007424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4119 | Open in IMG/M |
| 3300009707|Ga0116195_1008805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3641 | Open in IMG/M |
| 3300009707|Ga0116195_1065993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300010341|Ga0074045_10037142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC | 3617 | Open in IMG/M |
| 3300010352|Ga0116247_10142577 | Not Available | 2044 | Open in IMG/M |
| 3300012931|Ga0153915_10856050 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1055 | Open in IMG/M |
| 3300014494|Ga0182017_10226853 | Not Available | 1186 | Open in IMG/M |
| 3300014496|Ga0182011_10031763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC | 3796 | Open in IMG/M |
| 3300014496|Ga0182011_10799244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 591 | Open in IMG/M |
| 3300014496|Ga0182011_10901617 | Not Available | 550 | Open in IMG/M |
| 3300014498|Ga0182019_10909412 | Not Available | 635 | Open in IMG/M |
| 3300014502|Ga0182021_10723025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin022 | 1194 | Open in IMG/M |
| 3300014502|Ga0182021_11990581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 699 | Open in IMG/M |
| 3300014502|Ga0182021_12130498 | Not Available | 675 | Open in IMG/M |
| 3300014502|Ga0182021_12653219 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 602 | Open in IMG/M |
| 3300014502|Ga0182021_13515201 | Not Available | 521 | Open in IMG/M |
| 3300017941|Ga0187850_10504524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium | 523 | Open in IMG/M |
| 3300018030|Ga0187869_10263096 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300018070|Ga0184631_10011510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2773 | Open in IMG/M |
| 3300019861|Ga0206388_1026606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 569 | Open in IMG/M |
| 3300020163|Ga0194039_1187516 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300020814|Ga0214088_1766195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC | 3201 | Open in IMG/M |
| 3300021074|Ga0194044_10263144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 660 | Open in IMG/M |
| 3300021603|Ga0226659_10039963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. PtaB.Bin001 | 2931 | Open in IMG/M |
| 3300022517|Ga0224540_1013106 | Not Available | 534 | Open in IMG/M |
| 3300022650|Ga0236339_1181956 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300022830|Ga0224515_1028553 | Not Available | 796 | Open in IMG/M |
| 3300023075|Ga0224520_1063663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SDB | 837 | Open in IMG/M |
| 3300023075|Ga0224520_1077635 | Not Available | 746 | Open in IMG/M |
| 3300023075|Ga0224520_1079947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-9 | 734 | Open in IMG/M |
| 3300023203|Ga0255812_10836311 | Not Available | 837 | Open in IMG/M |
| 3300023207|Ga0255811_10109504 | All Organisms → cellular organisms → Bacteria | 2542 | Open in IMG/M |
| 3300025036|Ga0210049_1228613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 759 | Open in IMG/M |
| 3300025533|Ga0208584_1038307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-1 | 1270 | Open in IMG/M |
| 3300025533|Ga0208584_1138911 | Not Available | 558 | Open in IMG/M |
| 3300025575|Ga0209430_1132673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 542 | Open in IMG/M |
| 3300025600|Ga0209125_1059078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1136 | Open in IMG/M |
| 3300025600|Ga0209125_1134488 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300025650|Ga0209385_1089213 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 1024 | Open in IMG/M |
| 3300025692|Ga0209744_1029411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. F21 | 2114 | Open in IMG/M |
| 3300025692|Ga0209744_1033828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1956 | Open in IMG/M |
| 3300025692|Ga0209744_1155506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 733 | Open in IMG/M |
| 3300025716|Ga0209746_1002393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 8758 | Open in IMG/M |
| 3300025716|Ga0209746_1020555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2527 | Open in IMG/M |
| 3300025750|Ga0209747_1071280 | All Organisms → cellular organisms → Bacteria → Chrysiogenetes → Chrysiogenetes → Chrysiogenales → unclassified Chrysiogenales → Chrysiogenales bacterium | 1236 | Open in IMG/M |
| 3300025750|Ga0209747_1080986 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
| 3300025750|Ga0209747_1241790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 526 | Open in IMG/M |
| 3300025764|Ga0209539_1009358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4675 | Open in IMG/M |
| 3300025764|Ga0209539_1056566 | Not Available | 1672 | Open in IMG/M |
| 3300025764|Ga0209539_1063091 | Not Available | 1564 | Open in IMG/M |
| 3300025764|Ga0209539_1075980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1394 | Open in IMG/M |
| 3300025764|Ga0209539_1149530 | Not Available | 902 | Open in IMG/M |
| 3300025764|Ga0209539_1316163 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300025784|Ga0209200_1096668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1124 | Open in IMG/M |
| 3300025784|Ga0209200_1177757 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300025784|Ga0209200_1202971 | Not Available | 687 | Open in IMG/M |
| 3300025784|Ga0209200_1207894 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300025836|Ga0209748_1008858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC | 4624 | Open in IMG/M |
| 3300025846|Ga0209538_1042924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-1 | 1959 | Open in IMG/M |
| 3300025852|Ga0209124_10028517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 2292 | Open in IMG/M |
| 3300025858|Ga0209099_1021154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3685 | Open in IMG/M |
| 3300025859|Ga0209096_1072901 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 1475 | Open in IMG/M |
| 3300025861|Ga0209605_1074052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1436 | Open in IMG/M |
| 3300025864|Ga0209429_10015355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 3900 | Open in IMG/M |
| 3300025864|Ga0209429_10026831 | Not Available | 2817 | Open in IMG/M |
| 3300025865|Ga0209226_10153300 | Not Available | 1029 | Open in IMG/M |
| 3300025865|Ga0209226_10386076 | Not Available | 569 | Open in IMG/M |
| 3300025888|Ga0209540_10014958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 4802 | Open in IMG/M |
| 3300025888|Ga0209540_10067582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella | 2201 | Open in IMG/M |
| 3300025888|Ga0209540_10091249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1869 | Open in IMG/M |
| 3300025888|Ga0209540_10374698 | Not Available | 785 | Open in IMG/M |
| 3300025888|Ga0209540_10428330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 714 | Open in IMG/M |
| 3300027896|Ga0209777_10149587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 1927 | Open in IMG/M |
| 3300027896|Ga0209777_10589571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 806 | Open in IMG/M |
| 3300027896|Ga0209777_10710130 | Not Available | 714 | Open in IMG/M |
| 3300027896|Ga0209777_10811846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin022 | 655 | Open in IMG/M |
| 3300027896|Ga0209777_11079137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella | 544 | Open in IMG/M |
| 3300027897|Ga0209254_10081245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2753 | Open in IMG/M |
| 3300027902|Ga0209048_10123118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1966 | Open in IMG/M |
| 3300028625|Ga0302251_1002594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC | 8579 | Open in IMG/M |
| 3300028625|Ga0302251_1058354 | Not Available | 716 | Open in IMG/M |
| 3300028627|Ga0302243_1013818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC | 2585 | Open in IMG/M |
| 3300028644|Ga0302238_1015560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 3291 | Open in IMG/M |
| 3300028644|Ga0302238_1031831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1841 | Open in IMG/M |
| 3300028644|Ga0302238_1053261 | Not Available | 1192 | Open in IMG/M |
| 3300028730|Ga0307363_1042367 | Not Available | 622 | Open in IMG/M |
| 3300028903|Ga0302250_1069706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 538 | Open in IMG/M |
| (restricted) 3300029286|Ga0247841_10407949 | Not Available | 893 | Open in IMG/M |
| 3300029288|Ga0265297_10217805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC | 1383 | Open in IMG/M |
| 3300029799|Ga0311022_11942494 | All Organisms → cellular organisms → Bacteria | 3435 | Open in IMG/M |
| 3300029799|Ga0311022_14047035 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.Bin478 | 850 | Open in IMG/M |
| 3300029833|Ga0307340_117518 | Not Available | 746 | Open in IMG/M |
| 3300029983|Ga0302284_1128755 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300029984|Ga0311332_10589883 | Not Available | 878 | Open in IMG/M |
| 3300030019|Ga0311348_10679934 | Not Available | 768 | Open in IMG/M |
| 3300030294|Ga0311349_10619638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1023 | Open in IMG/M |
| 3300030294|Ga0311349_10972074 | Not Available | 797 | Open in IMG/M |
| 3300030339|Ga0311360_11533893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 520 | Open in IMG/M |
| 3300030838|Ga0311335_11139865 | Not Available | 558 | Open in IMG/M |
| 3300031232|Ga0302323_101737312 | Not Available | 706 | Open in IMG/M |
| 3300031834|Ga0315290_10185974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 1801 | Open in IMG/M |
| 3300031902|Ga0302322_103323349 | Not Available | 552 | Open in IMG/M |
| 3300031918|Ga0311367_12092319 | Not Available | 545 | Open in IMG/M |
| 3300032164|Ga0315283_12184581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 545 | Open in IMG/M |
| 3300032401|Ga0315275_10324392 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → unclassified Halobacteria → Halobacteria archaeon | 1724 | Open in IMG/M |
| 3300033521|Ga0316616_104983548 | Not Available | 500 | Open in IMG/M |
| 3300033821|Ga0334818_050462 | Not Available | 606 | Open in IMG/M |
| 3300033890|Ga0334810_061817 | Not Available | 909 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 35.35% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 14.14% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 6.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 5.56% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 5.05% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 4.55% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 3.54% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 3.54% |
| Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 3.54% |
| Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 2.02% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.52% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.52% |
| Serpentinite Rock And Fluid | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid | 1.52% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 1.01% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.01% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.01% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.01% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 1.01% |
| Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 1.01% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.51% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.51% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.51% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.51% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.51% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.51% |
| Anaerobic Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Anaerobic Enrichment Culture | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908035 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2124908038 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 2124908039 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Bog Site B4 | Environmental | Open in IMG/M |
| 2140918024 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
| 2140918025 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
| 3300001410 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 | Environmental | Open in IMG/M |
| 3300001870 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 | Environmental | Open in IMG/M |
| 3300002066 | Barrow Graham LP Ref core NGADG0002-211 (Barrow Graham LP Ref core NGADG0002-211,NGADG0004-311, ASSEMBLY_DATE=20131004) | Environmental | Open in IMG/M |
| 3300002071 | Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
| 3300002072 | Barrow Graham LP Ref core NGADG0011-211 (Barrow Graham LP Ref core NGADG0011-211,NGADG0004-312, ASSEMBLY_DATE=20131005) | Environmental | Open in IMG/M |
| 3300002179 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A | Environmental | Open in IMG/M |
| 3300002183 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A | Environmental | Open in IMG/M |
| 3300002515 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A | Environmental | Open in IMG/M |
| 3300002538 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 | Environmental | Open in IMG/M |
| 3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
| 3300002551 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 | Environmental | Open in IMG/M |
| 3300002569 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300003858 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI | Environmental | Open in IMG/M |
| 3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
| 3300005236 | Groundwater microbial communities from aquifer - Crystal Geyser CG07_land_8/20/14_0.80 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300005980 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203 | Environmental | Open in IMG/M |
| 3300006589 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Ile_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006591 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Ile_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006594 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Ile_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006640 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
| 3300008008 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-23 | Environmental | Open in IMG/M |
| 3300008085 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-02 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
| 3300009692 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG | Engineered | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300009694 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG | Engineered | Open in IMG/M |
| 3300009707 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG | Engineered | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010352 | AD_JPHWca | Engineered | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
| 3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
| 3300019861 | Lab enriched sediment microbial communities from oil refinery in Oklahoma, USA - DGG1A 1 | Engineered | Open in IMG/M |
| 3300020163 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8m | Environmental | Open in IMG/M |
| 3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
| 3300021074 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-17m | Environmental | Open in IMG/M |
| 3300021603 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spades | Engineered | Open in IMG/M |
| 3300022517 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 10-14 | Environmental | Open in IMG/M |
| 3300022650 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3 | Environmental | Open in IMG/M |
| 3300022830 | Peat soil microbial communities from Stordalen Mire, Sweden - IR.F.S.T-25 | Environmental | Open in IMG/M |
| 3300023075 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25 | Environmental | Open in IMG/M |
| 3300023203 | Combined Assembly of Gp0238866, Gp0238878 | Engineered | Open in IMG/M |
| 3300023207 | Combined Assembly of Gp0238866, Gp0238878, Gp0238879 | Engineered | Open in IMG/M |
| 3300025036 | Groundwater microbial communities from aquifer - Crystal Geyser CG06_land_8/20/14_3.00 (SPAdes) | Environmental | Open in IMG/M |
| 3300025515 | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Jul_8B1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025516 | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_8Bad (SPAdes) | Environmental | Open in IMG/M |
| 3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025575 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-33A (SPAdes) | Environmental | Open in IMG/M |
| 3300025600 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025692 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes) | Environmental | Open in IMG/M |
| 3300025716 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025750 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311 (SPAdes) | Environmental | Open in IMG/M |
| 3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
| 3300025784 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025846 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes) | Environmental | Open in IMG/M |
| 3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
| 3300025858 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025859 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025861 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025864 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028625 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_RA_Gln | Engineered | Open in IMG/M |
| 3300028627 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Met | Engineered | Open in IMG/M |
| 3300028644 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Asn | Engineered | Open in IMG/M |
| 3300028730 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_RA_Asp2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300028903 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_RA_Asp | Engineered | Open in IMG/M |
| 3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
| 3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
| 3300029799 | Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119 | Engineered | Open in IMG/M |
| 3300029833 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Pro1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029983 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_1 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033821 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-X0 | Environmental | Open in IMG/M |
| 3300033890 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-M | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B3_GZOS_CLC_02418350 | 2124908035 | Soil | SKSKMISRRQGGGDEAYFTYVEEADDAVNKDSALI |
| B3_GZOS_CLC_01808760 | 2124908035 | Soil | FINGLKNGYNTISKSKMISRRQGGGDEAYCIYVEEADDEANKDSALI |
| B3_GZOS_CLC_02117530 | 2124908035 | Soil | SKSKMISRRQGGGDEAYCTYVEEADDAANKDSALI |
| B3_all_c_00128550 | 2124908038 | Soil | SKSKMVSRRQGEGDEAYCTYVEEADDAANKDSALI |
| B3_all_c_00417900 | 2124908038 | Soil | INWENRKNYITGSILLSRQLGGGEETYCTYVEEADDDANKDSALI |
| B3_v_00774150 | 2124908039 | Soil | ISKSKMISRRQGGGDEAYCTYVEEADDDANKDGALIGSAFP |
| B_all_v_00542940 | 2140918024 | Soil | MSPFYTISKSKMISRRQGGLDEAYFTNVCEADDAANKDSALI |
| B_all_v_02712190 | 2140918024 | Soil | MILRRQGGGDEAYCTNVPKADDAANKDSALIYNWNKLH |
| B_all_v_01459240 | 2140918024 | Soil | MIDLGCNIIFKSKMISRRLGGGNEAYFTYVEEADDNANKDSALI |
| B_all_v_00530850 | 2140918024 | Soil | MISRRQGGGDEAYCTYVEEADDDANKDGALIGSAFP |
| b3_nosca_v_00374920 | 2140918025 | Soil | KKANTNSKSKMISRRQRGSDEAYYTYVEEADDDANKDSSLI |
| JGI20179J14886_10218842 | 3300001410 | Arctic Peat Soil | MTNKLPINTISKSEMISRRQGGGDEAYCTYVEEADDAANKDSALI* |
| JGI24129J20441_10625242 | 3300001870 | Arctic Peat Soil | MIDRGCNTIFKSKMISRRLGGGNEAYFTYVEEADDDANKDSAWI* |
| JGIcombinedJ21911_100245742 | 3300002066 | Arctic Peat Soil | MIDRGCNTIFKSKMISRRLGGGNEAYFTYVEEADDDTNKDSAWI* |
| JGIcombinedJ21915_100182542 | 3300002071 | Arctic Peat Soil | MCLYHFKSKMISRQRGGSDDAYCTYVEEADDAANKDSALI* |
| JGIcombinedJ21915_100798191 | 3300002071 | Arctic Peat Soil | TITNTISKSKMISRRQGGGDEAYFTYVEEADDAANKDSALI* |
| JGIcombinedJ21915_101879221 | 3300002071 | Arctic Peat Soil | IAIRNYATSKSKMISRRQGGGDEAYCCTYVEEADDAVNKDNALI* |
| JGIcombinedJ21915_101880803 | 3300002071 | Arctic Peat Soil | INYTISKSKMISRRQGGGNEAYCTYVEEANDAANKDSALI* |
| JGIcombinedJ21915_102030282 | 3300002071 | Arctic Peat Soil | YTISKSKMILRRLGGGNEAITYTYVEEADNNANKNSALI* |
| JGIcombinedJ21915_102918551 | 3300002071 | Arctic Peat Soil | MTFYTISTKSKMISRRQGGGDEAYCTYVEEADDAANKDSAL |
| JGIcombinedJ21914_102051421 | 3300002072 | Arctic Peat Soil | MTFYTISTKSKMISRRQGGGDEAYCTYVEEADDAANKDSALI |
| JGI24141J26756_10072485 | 3300002179 | Arctic Peat Soil | MVCESNTISKSKMISRRQGGGDETYCTYVEEADDAANKDSALI* |
| JGI24145J26757_100014676 | 3300002183 | Arctic Peat Soil | MISRRQGGGDEAYCTYVEEADDAANKDSALIWNWDYI* |
| JGI24145J26757_100087534 | 3300002183 | Arctic Peat Soil | MTNKLPINTIXKSEMISXRXGGGDEAYXTYVEEADDAANKDSALI* |
| JGI24145J26757_100559402 | 3300002183 | Arctic Peat Soil | MIDRGCNTIFKSKMISRRLGGGDEAYFTYVEEADDNANKDSA* |
| JGI24145J26757_100707212 | 3300002183 | Arctic Peat Soil | MIDRGCNTIFKSKMISRRLGXGDEAYFTYVEEADDNANKDSAWI* |
| JGI24144J35610_101300612 | 3300002515 | Arctic Peat Soil | MIDRGCNTIFKSKMISRRLGGGDEAYFTYVEEADDNANKDSAWI* |
| JGI24132J36420_100016827 | 3300002538 | Arctic Peat Soil | MCLYYFKSKMISRQRGGSDDAYCTYVEEADDAANKDSALI* |
| JGI24132J36420_100022615 | 3300002538 | Arctic Peat Soil | MTNKLPINTISKSEMISRRQGGDEAYCTYVEEADDAANKDSALI* |
| JGI24132J36420_100262091 | 3300002538 | Arctic Peat Soil | MYLNANSKSKMISRRQGEGDEAYFTYVEEADDAANKDSALI* |
| JGI24130J36418_100194842 | 3300002549 | Arctic Peat Soil | MISRRQEGGDEAYFTYVEEADDAANKDSADLELVLEESWAA |
| JGI24130J36418_101467581 | 3300002549 | Arctic Peat Soil | LIYAGYKSKMILRRLGGGDETYCTYVEEADNDANKNSALI* |
| JGI24135J36437_10055782 | 3300002551 | Arctic Peat Soil | MTNTISKSEMISRRQGGGGDAYYTYVEEADDDANKDSALI* |
| JGI24136J36422_100213871 | 3300002569 | Arctic Peat Soil | EPNTISKSKMISRRQGGGDETYCTYVEEADNAANKDSALI* |
| JGI24136J36422_100674622 | 3300002569 | Arctic Peat Soil | SKMILRRLGGGDEAYYTRVTFRLYVEEADNDANKNSALI* |
| JGI24136J36422_101517651 | 3300002569 | Arctic Peat Soil | MAVIEVIVYFVLTNTISKSKMILRRLDGGDEAYCTYVEEADNDANKNSALI* |
| JGI24140J50213_100127744 | 3300003369 | Arctic Peat Soil | MCLYYFKSKMISRQRGGSDDAYCTYVEEADDAANKDSVLI* |
| Ga0031655_1000127512 | 3300003852 | Freshwater Lake Sediment | MKSPLFNTISKSKMISRRLGGGNEAYFTYVEEADDDANKDSALI* |
| Ga0031655_100037342 | 3300003852 | Freshwater Lake Sediment | MISRRLGRGDEAYYTYVEEANNDANKDSALIYKLVLFATG* |
| Ga0031655_100057045 | 3300003852 | Freshwater Lake Sediment | MQFTNNTNSKSKMILRRLGGGNEVYYTRVTFRLYVEEADNDANKNSALI* |
| Ga0031656_102157151 | 3300003858 | Freshwater Lake Sediment | MKQFAAYYSIPKSKMISRRQGGGDEAYFTYAEEADDAANKDSALM* |
| Ga0031654_102435382 | 3300003861 | Freshwater Lake Sediment | MQFTNNTNSKSKMILRRLGGGNEVYYTRVTFRLYVEEADN |
| Ga0031654_102477931 | 3300003861 | Freshwater Lake Sediment | MTSYYINSKSKMKSRRLDEGDEAYYTYVEEAYNDANKDSALI* |
| Ga0066636_101466862 | 3300005236 | Groundwater | MWQSNTISKSRMISRQQGGGGEAYYKYVEEADDYADKDSALI* |
| Ga0066795_100487331 | 3300005938 | Soil | LYHSKSKMISRRQGGGDEAYCTYVKEADDAANKDSALI* |
| Ga0066795_100863041 | 3300005938 | Soil | NTISKSKMISRRQGGGDECTYVEEADDAASKDSALI* |
| Ga0066795_100895772 | 3300005938 | Soil | MTFNTISKSKMISRRQGGGDEAYCTCVEEADDAANKDSALI* |
| Ga0066794_100879302 | 3300005947 | Soil | ETCFVLFTYYTISKSKMISRRQGGGDEAYCTYVEEADDAANKDSALI* |
| Ga0066794_101048342 | 3300005947 | Soil | LIIYEPNTISKSKMISRRQGGGDETYCTYVEEADNAANKDSALI* |
| Ga0066794_101852441 | 3300005947 | Soil | TNTISKSKMISRRQGGGDDAYCTYAEEADDAANKDSALI* |
| Ga0066798_100466331 | 3300005980 | Soil | TISKSKMISRRQGGGDETYCTYVEEADDAANKDSALI* |
| Ga0079072_12138402 | 3300006589 | Anaerobic Digestor Sludge | MENTCYHSISKSMMISRRLGGGDEAYYTYVEEADDDANKDSA* |
| Ga0079071_10043603 | 3300006591 | Anaerobic Digestor Sludge | MENTCYHSISKSMMISRRLGGGDEAYYTYVEEADDD |
| Ga0079073_12557312 | 3300006594 | Anaerobic Digestor Sludge | SISKSMMISRRLGGGDEAYYTYVEEADDDANKDSA* |
| Ga0075527_101646232 | 3300006640 | Arctic Peat Soil | MTFYTISTKSKMISRRQGGGDEAYCTYVEEADDAANKDS |
| Ga0075527_102666591 | 3300006640 | Arctic Peat Soil | TISKSKMISRRQGGGDDAYCTYAEEADDAANKDSALI* |
| Ga0075521_104017241 | 3300006642 | Arctic Peat Soil | NTISKSKMISRRQGGGDDAYCIYVEEADDAANKDSALI* |
| Ga0075520_10035228 | 3300006795 | Arctic Peat Soil | SKSKMILRRLGGGDEAYCTYVEEADNEANKNSALI* |
| Ga0075520_10037015 | 3300006795 | Arctic Peat Soil | MINTIAKSKMIFRRLGGGDEAYCIRVTFRLYVEEADNDANKNSALI* |
| Ga0075520_10344184 | 3300006795 | Arctic Peat Soil | SKSKMISRRQGGGDEAYFTYVEEANDAANKDSAVI* |
| Ga0075520_10501551 | 3300006795 | Arctic Peat Soil | PTATYTSSKSKMISRRQGGGYETYCTYAEEADDAANKDSALI* |
| Ga0075520_10776822 | 3300006795 | Arctic Peat Soil | SKSKMISRRQGGGDETYFTYVEEADDDANKDSALI* |
| Ga0075520_11256763 | 3300006795 | Arctic Peat Soil | SKSKMISRRQGGGDEAYCTYVEEADDAANKDSALNLEVE* |
| Ga0075520_11832873 | 3300006795 | Arctic Peat Soil | MTNTISKSEMISRRQVGGGDAYYTYVEEADDDANKDSALI* |
| Ga0075528_102195932 | 3300006949 | Arctic Peat Soil | LIIYEPNTISKSKMISRRQGGGDETYCTYVEEADDAANKDSALI |
| Ga0100399_10766193 | 3300008008 | Aquifer | TNSKSKMISRRQGGGDETYYTYVEEADDAANKDSALI* |
| Ga0100378_14682501 | 3300008085 | Aquifer | KSKMISRRQGGGDETYYTYVEKADDTANKDSALI* |
| Ga0066793_102445022 | 3300009029 | Prmafrost Soil | SKSKMISRRQGGGDDAYCTYVEETDDAANKDSALI* |
| Ga0066793_102911672 | 3300009029 | Prmafrost Soil | MSYAISKSKMISRRQEGGDEAYNLKVTRCTYVEEADNDANKD |
| Ga0066793_102981123 | 3300009029 | Prmafrost Soil | IYEPNTISKSKMISRRQGGGDETYCTYVEEADNAANKDSALI* |
| Ga0115027_114409342 | 3300009131 | Wetland | SKSKMISRRLGGGDEAYFTYVEETDDDANADSALSWKRN* |
| Ga0105104_107664722 | 3300009168 | Freshwater Sediment | SKSKMILRRLGGGDEVYFTYVEEADNDANKNSALIWEW* |
| Ga0115028_102844141 | 3300009179 | Wetland | KSRMISRQLGGGDEAYYIYVEEADDDANKDSALI* |
| Ga0116103_10925931 | 3300009615 | Peatland | KSKMISRRQGAGDEAYYTYAPEAVRDADKDSALIL* |
| Ga0116144_100199471 | 3300009687 | Anaerobic Digestor Sludge | TPLLNNLSWNYSISKSMMISRRLGGGNEAYYTYVEEADDDANKDSA* |
| Ga0116144_100232055 | 3300009687 | Anaerobic Digestor Sludge | ISKSMMISRRLGGGDEAYYTYVEEADDDANKDSA* |
| Ga0116143_101156641 | 3300009690 | Anaerobic Digestor Sludge | MLYNSISKSMMISRRLGGGDEAYYTYVEEADDDANKDSA* |
| Ga0116143_101263502 | 3300009690 | Anaerobic Digestor Sludge | NSVSKSMMISRRLGGGDEAYYPYVEEADDDANKDSA* |
| Ga0116171_100685203 | 3300009692 | Anaerobic Digestor Sludge | MMISRRLGGGDEAYNLKVTRYTYVEEADDDVNKDCT* |
| Ga0116171_103346571 | 3300009692 | Anaerobic Digestor Sludge | QIKPVMSMEFNSISKSIMIPRRLGGGDEAYYTSVEEADDDANKDSA* |
| Ga0116171_104478711 | 3300009692 | Anaerobic Digestor Sludge | VRRLCSIPKSMMIPRRLGGGDEAYYAYVEEADNDANKGSA* |
| Ga0116141_105108941 | 3300009693 | Anaerobic Digestor Sludge | KSKMISRRLGGVNEAYYTYVEDADNDANKDCALI* |
| Ga0116170_100271771 | 3300009694 | Anaerobic Digestor Sludge | MSKSMMISRRLGGCDEAYYTYVEEADDDANKDSA* |
| Ga0116170_102662402 | 3300009694 | Anaerobic Digestor Sludge | MMISRRLGGGDEAYNLKVSRYTYVEEADDDVNKDCT* |
| Ga0116170_106826912 | 3300009694 | Anaerobic Digestor Sludge | PWILNNSISKSMMISRRLGGGDEAYYTYVEEADDDANKDSA* |
| Ga0116170_107420302 | 3300009694 | Anaerobic Digestor Sludge | ISKSMMIPRRLGGGDEAYYTCVEEADDDVNKGSA* |
| Ga0116195_10074245 | 3300009707 | Anaerobic Digestor Sludge | YNSISKSMMISRRLGGGDEAYYTYVEEADDDANKDSA* |
| Ga0116195_10088053 | 3300009707 | Anaerobic Digestor Sludge | ISKSMMIPRRLGGGNEAYYTYVEEADDDANKGSA* |
| Ga0116195_10659932 | 3300009707 | Anaerobic Digestor Sludge | SISKSMMISRRLGGGDEAYYTYVEEADDEANKDSA* |
| Ga0074045_100371424 | 3300010341 | Bog Forest Soil | SKSKMILRRLGGGDETYCTYVKEADNDVNKNSALI* |
| Ga0116247_101425771 | 3300010352 | Anaerobic Digestor Sludge | ISKSYMIPRRQGGGDEAYYAYVEEADDNANKGSA* |
| Ga0153915_108560502 | 3300012931 | Freshwater Wetlands | MKQKEKYNSKSKMILRRLGGGDEAYYTYVEDADDEANKNSALI* |
| Ga0182017_102268532 | 3300014494 | Fen | SSPNTISKSKMILRRLGGGDEAYFTRVTFRLYVEEADNDANKNSALI* |
| Ga0182011_100317636 | 3300014496 | Fen | MMISRRLGGGDEAYCTRVTFRLYIEEADDDANKDSA* |
| Ga0182011_107992441 | 3300014496 | Fen | SGRPEGGDDAYINYVEEADNNANKDSALMWNWNYH* |
| Ga0182011_109016172 | 3300014496 | Fen | MKSNTSFKSKMILRRLGGGDEAYCIYVEEADNDANKN |
| Ga0182019_109094122 | 3300014498 | Fen | MRLESLLFKFIIYTTSKSKMISRRQEEGDEAYYIYVEEADDAANKDSALI* |
| Ga0182021_107230251 | 3300014502 | Fen | TNSKSKMILRRLGGGDEAYCTYVEEADNDANKNSALI* |
| Ga0182021_119905812 | 3300014502 | Fen | SKSKMILRRLGGGDEAYCTYVEEADNDANKNSALI* |
| Ga0182021_121304982 | 3300014502 | Fen | ISKSKMILRRLGGGDEAYSPYVEEADNDANKNSALI* |
| Ga0182021_126532191 | 3300014502 | Fen | TFSKSKMILRRLGGGDEAYCTYAEEADNDANKNSVLI* |
| Ga0182021_135152011 | 3300014502 | Fen | AALKSSSPNTISKSKMILRRLGGGDEAYFTRVTFRLYVEEADNDANKNSALI* |
| Ga0187850_105045242 | 3300017941 | Peatland | YYINSKSKMNSRRLDGGDEVYYTRVTFRLYVEEADNDANKDSALI |
| Ga0187869_102630961 | 3300018030 | Peatland | INTISKSKMILRRLGGDNEAYCICVEEDDNDANKNSALI |
| Ga0184631_100115104 | 3300018070 | Groundwater Sediment | MISRRQGGGDEAYNLKVTRCTYVEEADDDANKDSALI |
| Ga0206388_10266062 | 3300019861 | Anaerobic Enrichment Culture | ISRRQGGVDEAYYTYVEEVDDEANKDSALIQKSDT |
| Ga0194039_11875162 | 3300020163 | Anoxic Zone Freshwater | CRDYSASKSQMKSRRQGGGDAGVFLYVEEPIADANEDSALI |
| Ga0214088_17661951 | 3300020814 | Granular Sludge | MENTCYHSISKSMMISRRLEGGDEAYYTYVEEADDDANKDSA |
| Ga0194044_102631442 | 3300021074 | Anoxic Zone Freshwater | CNTISKSKMISRRQGGGDEAYCTYVEEADDDANKDSALI |
| Ga0226659_100399631 | 3300021603 | Granular Sludge | LTYSISKSMMISWRLGGGDEAYCTYVEEADDDANK |
| Ga0224540_10131061 | 3300022517 | Soil | TISKSKMISRRLVRGDDAYNLKVTRYKYVEEADNDANKDSALI |
| Ga0236339_11819561 | 3300022650 | Freshwater | TTSKSKMISRRQGGGDETYYTYVEEADDAANKDSALI |
| Ga0224515_10285531 | 3300022830 | Soil | INTISKSKMILRRLGGGDEAYCTRVTFRLYVEEADNDANKNSALI |
| Ga0224520_10636632 | 3300023075 | Soil | INTNSKSEMILRRLGGGDEAYCTYVEEADNDANKNSALI |
| Ga0224520_10776352 | 3300023075 | Soil | MINTISKSKMILRRLGGGDEAYCTRVTFRLYVEEADNDANKNSALI |
| Ga0224520_10799471 | 3300023075 | Soil | NSISKSMMISRRLGGGDEAYYTRVTFRLYVEEADNDANKDSA |
| Ga0255812_108363112 | 3300023203 | Anaerobic Digester Digestate | PASASASNSISKSMMISRRQHPLPPPAGDSGDEAYYPYVEEADDDANKDSA |
| Ga0255811_101095043 | 3300023207 | Anaerobic Digester Digestate | GYYSISNSMMIPRRQGGGDEAYYTYVEEADDDANKGSA |
| Ga0210049_12286131 | 3300025036 | Groundwater | INIHKSKSSSKSKMISRQLGGGNEAYYAYVEEADDEANKDSALI |
| Ga0208733_1083201 | 3300025515 | Serpentinite Rock And Fluid | HQTLKGRCSRYSIPKSKMISRRQGGGDEAYCTYVEEADDAANKDSELI |
| Ga0208733_1111892 | 3300025515 | Serpentinite Rock And Fluid | LFLKNDRLVFHQTPNSISKSKMISRRQGGGDEAYCTYVEEADDDANKDSALI |
| Ga0207951_1060121 | 3300025516 | Serpentinite Rock And Fluid | FLKNDRLVFHQTPNSISKSKMISRRQGGGDEAYCTYVEEADDDANKDSALI |
| Ga0208584_10383071 | 3300025533 | Arctic Peat Soil | SKSKMISRRQGGGDETYCTYVEEADDVANKDSALI |
| Ga0208584_11389112 | 3300025533 | Arctic Peat Soil | PMIDRGCNTIFKSKMISRRLGGGDEAYFTYVEEADDNANKDSAWI |
| Ga0209430_11326732 | 3300025575 | Arctic Peat Soil | MTNTISKSEMISRWQGGGDDAYCTYVEEADDDANKDSALI |
| Ga0209125_10590782 | 3300025600 | Arctic Peat Soil | SIFKSKMISRRQGGGDEAYFIYVEEADDAANKDSALI |
| Ga0209125_11344882 | 3300025600 | Arctic Peat Soil | TISKSKMISRRQGGGDEAYCTYVEEADDAANKDSALI |
| Ga0209385_10892133 | 3300025650 | Arctic Peat Soil | MISRRQGGGDEAYCTYVEEADDAANKDSALNLEVE |
| Ga0209744_10294115 | 3300025692 | Arctic Peat Soil | LFMANLQQGFNTTSKSKMISRRQEGGDEAYCTYVEEADNA |
| Ga0209744_10338282 | 3300025692 | Arctic Peat Soil | LLMVCESNTISKSKMISRRQGGGDETYCTYVEEADDAANKDSALI |
| Ga0209744_11555061 | 3300025692 | Arctic Peat Soil | TSKSKMISRRQGGGDDAYCTYVEETDDAANKDSALI |
| Ga0209746_10023933 | 3300025716 | Arctic Peat Soil | VIEVIVYFVLTNTISKSKMILRRLDGGDEAYCTYVEEADNDANKNSALI |
| Ga0209746_10205551 | 3300025716 | Arctic Peat Soil | YTNSKSKMILRRLGGGDEAYCTNAPEADNDANKNSALI |
| Ga0209747_10712802 | 3300025750 | Arctic Peat Soil | QHKGTDTISKSKMISRRQGEGDEAYCTYVEEADGAANKDSALI |
| Ga0209747_10809861 | 3300025750 | Arctic Peat Soil | TISKSKMISRRQEGSDETYCTYVEEADDAANKDSALI |
| Ga0209747_12417902 | 3300025750 | Arctic Peat Soil | TISKSKMISRRQGGGDEAYFTYVEEADDAANKDSALI |
| Ga0209539_10093581 | 3300025764 | Arctic Peat Soil | IFKSKMISRRQGGGDEAYCTYIEEADDVANKDNAFI |
| Ga0209539_10565662 | 3300025764 | Arctic Peat Soil | TKDDNTISKSKMVSRRQGGGDDAYCIYVEEADDAANKDSALI |
| Ga0209539_10630911 | 3300025764 | Arctic Peat Soil | ISKSKMISRWQGGGDEAYSSYVEEADDAANKDSALI |
| Ga0209539_10759801 | 3300025764 | Arctic Peat Soil | VLSINSNSKSKMISRRQGGGDEAYFIYVEEADDAANKDSALI |
| Ga0209539_11495302 | 3300025764 | Arctic Peat Soil | AYYTISKSKMISRRQGGGDETYCTYVEEADDAANKDGALI |
| Ga0209539_13161632 | 3300025764 | Arctic Peat Soil | VFSKSKMISRRQGGGDETYCIYVEEADDAANKDSALI |
| Ga0209200_10966681 | 3300025784 | Anaerobic Digestor Sludge | YSISKSMMISRRLGGGNEAYYTYVEEADDDANKDSA |
| Ga0209200_11777571 | 3300025784 | Anaerobic Digestor Sludge | ACIRETPRNSVSKSMMISRRLGGGDEAYYAYVEEADDDANKDSA |
| Ga0209200_12029711 | 3300025784 | Anaerobic Digestor Sludge | MMISRRQPPPTPPAGGGQGDEAYYTYVEEADNDANKD |
| Ga0209200_12078941 | 3300025784 | Anaerobic Digestor Sludge | NSISKSMMISRRLGGGDEAYYTYVEEADDDANKDSA |
| Ga0209748_10088581 | 3300025836 | Arctic Peat Soil | KSKMISRRQGGGDEAYCCTYVEEADDDANKDSALI |
| Ga0209748_10268455 | 3300025836 | Arctic Peat Soil | TDRSNYSLNIYLLMVCESNTISKSKMISRRQGGGDETYCTYVEEADDAANKDSALI |
| Ga0209538_10429244 | 3300025846 | Arctic Peat Soil | PSGHGRRNTISKSKMILRRQGQGGGDETYCTYVEEADDAANKDNALI |
| Ga0209124_100285173 | 3300025852 | Arctic Peat Soil | SKSKMISRRQGGGDETYCTYVEEADDAANKDSALI |
| Ga0209099_10211541 | 3300025858 | Anaerobic Digestor Sludge | PFSKSMMISRRRGGGDEAYYIYVEEADDDANKDSA |
| Ga0209096_10729013 | 3300025859 | Anaerobic Digestor Sludge | MLYNSISKSMMISRRLGGGDEAYYTYVEEADDDANKDSA |
| Ga0209605_10740522 | 3300025861 | Anaerobic Digestor Sludge | TPLLNNLSWNYSISKSMMISRRLGGGNEAYYTYVEEADDDANKDSA |
| Ga0209429_100153553 | 3300025864 | Arctic Peat Soil | NSQDTISKSKMISRRQGGGDETYCTYVEEADDAANKDSALI |
| Ga0209429_100268311 | 3300025864 | Arctic Peat Soil | IVYAYSISKSMMISRRLGGGDEAYFRYVEEADDDANKDSA |
| Ga0209226_101533002 | 3300025865 | Arctic Peat Soil | MISRRQGGGDKEYCTYIEEADDAANKDSALIQNWNKALSC |
| Ga0209226_103860762 | 3300025865 | Arctic Peat Soil | MAVIEVIVYFVLTNTISKSKMILRRLDGGDEAYCTYVEEADNDANKNSALI |
| Ga0209540_100149581 | 3300025888 | Arctic Peat Soil | QYILLPNSTSKSKMILRRQGGGDDAYCTYVEEADDAANKDSALI |
| Ga0209540_100675821 | 3300025888 | Arctic Peat Soil | FCKKMCLYHFKSKMISRQRGGSDDAYCTYVEEADDAANKDSALI |
| Ga0209540_100912491 | 3300025888 | Arctic Peat Soil | TNTISKSKMILRRLDGGDEAYCTYVEEADNDANKNSALI |
| Ga0209540_103746982 | 3300025888 | Arctic Peat Soil | MILRRQGEGDEAYNLKVTRYTYVEKTDDVANKNSALIGSASPLG |
| Ga0209540_104283302 | 3300025888 | Arctic Peat Soil | FTNFKSKMILRRLSGGDEAYFTPVTFRLYVEEADNDTNKNSALI |
| Ga0209777_101495871 | 3300027896 | Freshwater Lake Sediment | HKIKPMKSPLFNTISKSKMISRRLGGGNEAYFTRVTFRLYVEEADDDANKDSALI |
| Ga0209777_105895712 | 3300027896 | Freshwater Lake Sediment | MRKEYNTISKSKMILRRLGGGNEAYFTRVTFRLYVEEADNDTNKNSALS |
| Ga0209777_107101302 | 3300027896 | Freshwater Lake Sediment | LKLTNSKSKTILRRLSGGDEAYCTYVEEADNDANKNSALI |
| Ga0209777_108118461 | 3300027896 | Freshwater Lake Sediment | KSKMILRRLGGGDEAYYTRVTFRLYVEEADNDANKNSDLI |
| Ga0209777_110791371 | 3300027896 | Freshwater Lake Sediment | KMISRRQGGGNEAYCTYVEEADDAANEDSALIWKWN |
| Ga0209254_100812452 | 3300027897 | Freshwater Lake Sediment | MKQFAAYYSIPKSKMISRRQGGGDEAYFTYAEEADDAANKDSALM |
| Ga0209048_101231182 | 3300027902 | Freshwater Lake Sediment | MRKEYNTISKSKMILRRLGGGNKAYFTRVTFRLYVEEADDGTNKNSALS |
| Ga0302251_10025942 | 3300028625 | Activated Sludge | MSATGSCFISQSNSIFKSMMISRRLGGGDEAYYTYVEEADDDANKDSD |
| Ga0302251_10583542 | 3300028625 | Activated Sludge | MISRRQGGGDEAYYIYVEDADDDANKDSALIWNWNYPAAIPEAIS |
| Ga0302243_10138181 | 3300028627 | Activated Sludge | SISKSMMISRRLGGGDEAYYTYVEEADDDANKDSA |
| Ga0302238_10155601 | 3300028644 | Activated Sludge | NSISKSMMISRRLGGGDEAYYTYVEETDDDANKDSA |
| Ga0302238_10318311 | 3300028644 | Activated Sludge | SVTLQNNRPGNSISKSMMISRRLGGGDEAYYAYVEEADDDANKDSA |
| Ga0302238_10532611 | 3300028644 | Activated Sludge | TGAGFEKTGINLFCNSISKSMMISRRLGGGDEAYYPYVEEADDDANKDST |
| Ga0307363_10423672 | 3300028730 | Anaerobic Digestor Sludge | VSYSISKSMMISRRQGGGNEAYYTYVEEADDAANKDSA |
| Ga0302250_10697062 | 3300028903 | Activated Sludge | SISKSMMIPRRLGEGDEAYYTYVEEADDDANKGSA |
| (restricted) Ga0247841_104079492 | 3300029286 | Freshwater | YYTIPKSKMILRRQEEDDEAYYAYAEEADDAANKNSALI |
| Ga0265297_102178051 | 3300029288 | Landfill Leachate | FKSKMISRRLGGGDEAYCTYVEDADNDANKDSALI |
| Ga0311022_119424945 | 3300029799 | Anaerobic Digester Digestate | CSVYNSISKSMMITRRLGGGDEANYTYVEEADDDANKDSA |
| Ga0311022_140470352 | 3300029799 | Anaerobic Digester Digestate | VSSRFYSISKSMMISRRQGGGNEAYYTYVEEADDEANKDSA |
| Ga0307340_1175181 | 3300029833 | Anaerobic Digestor Sludge | IAFPYNSICKSMMIPRRLGGGNEAYYTYVGEADDDANKDSA |
| Ga0302284_11287552 | 3300029983 | Fen | TQHISISKLKMILRRQEGGDEAYYVYVEEADDAANKNSALI |
| Ga0311332_105898832 | 3300029984 | Fen | MISRRLVRGDEAYNLKVTRYKYVEEADNDANKDSA |
| Ga0311348_106799341 | 3300030019 | Fen | PAITFETMQSFTNTISKSKMILRRLGGGDEAYCTYVVEADNEANKNSALI |
| Ga0311349_106196382 | 3300030294 | Fen | KNNTISKSKLILWRLGGGNETYYTYVEEADNDANKNSALI |
| Ga0311349_109720741 | 3300030294 | Fen | TISKSKMILRRLGGGDEAYNLKVTRYKYVEEADNDANKDSALI |
| Ga0311360_115338931 | 3300030339 | Bog | MKSNTSFKSKMILRRLGGGDEAYCIYVEEADNDANKNSALI |
| Ga0311335_111398651 | 3300030838 | Fen | ETRRAALKSSSPNTISKSKMILRRLGGGDEAYFTRVTFRLYVEEADNDANKNSALI |
| Ga0302323_1017373122 | 3300031232 | Fen | MIMSHTISKAKMISRRQGGGDEAYNLKVTRYTNIPEADN |
| Ga0315290_101859744 | 3300031834 | Sediment | SYIISKSEMISRRQGGGDEAYCTYVEEADDDANKDSALI |
| Ga0302322_1033233492 | 3300031902 | Fen | YTTFKSKMISRQLGGGNETNNLKVTRYIYVEEADNEANKDSALI |
| Ga0311367_120923192 | 3300031918 | Fen | YDMKSNTSFKSKMILRRLGGGDEAYCIYVEEADNDANKNSALI |
| Ga0315283_121845812 | 3300032164 | Sediment | MISRRQGGGDEAYCTYVEEADDAANKDSALIYNWNYL |
| Ga0315275_103243922 | 3300032401 | Sediment | ISKSKMISRRQGGGDEAYFTYVEEADDAANKDSALI |
| Ga0316616_1049835481 | 3300033521 | Soil | RYHSKSRMISRQLGGGDEAYYTYVEEADDDANKDSALI |
| Ga0334818_050462_431_604 | 3300033821 | Soil | AETRRAALKSSSPNTISKSKMILRRLGGGDEAYFTRVTFRLYVEEADNDANKNSALI |
| Ga0334810_061817_762_908 | 3300033890 | Soil | SSSPNTISKSKMILRRLGGGDEAYFTRVTFRLYVEEADNDANKNSALI |
| ⦗Top⦘ |