Basic Information | |
---|---|
Family ID | F067893 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 125 |
Average Sequence Length | 47 residues |
Representative Sequence | MQTVYPRYTMAERLVLAVVAVVTWPVERFLGWVRRKVAVDLAPSADRR |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 125 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 77.87 % |
% of genes near scaffold ends (potentially truncated) | 34.40 % |
% of genes from short scaffolds (< 2000 bps) | 70.40 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (36.800 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.200 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (51.200 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.37% β-sheet: 0.00% Coil/Unstructured: 52.63% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 125 Family Scaffolds |
---|---|---|
PF01741 | MscL | 30.40 |
PF00072 | Response_reg | 29.60 |
PF00873 | ACR_tran | 5.60 |
PF08546 | ApbA_C | 3.20 |
PF00582 | Usp | 2.40 |
PF01266 | DAO | 2.40 |
PF00005 | ABC_tran | 1.60 |
PF02558 | ApbA | 1.60 |
PF00483 | NTP_transferase | 0.80 |
PF07732 | Cu-oxidase_3 | 0.80 |
PF05559 | DUF763 | 0.80 |
PF04879 | Molybdop_Fe4S4 | 0.80 |
PF01935 | DUF87 | 0.80 |
PF00115 | COX1 | 0.80 |
PF04143 | Sulf_transp | 0.80 |
PF00691 | OmpA | 0.80 |
PF07509 | DUF1523 | 0.80 |
PF00753 | Lactamase_B | 0.80 |
COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
---|---|---|---|
COG1970 | Large-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 30.40 |
COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 3.20 |
COG1415 | Uncharacterized conserved protein, DUF763 domain | Function unknown [S] | 0.80 |
COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.80 |
COG2391 | Uncharacterized membrane protein YedE/YeeE, contains two sulfur transport domains | General function prediction only [R] | 0.80 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.00 % |
Unclassified | root | N/A | 28.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000032|Draft_c0027837 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5799 | Open in IMG/M |
3300000032|Draft_c0442904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 1201 | Open in IMG/M |
3300000313|WSSedB1CaDRAFT_10027889 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 1131 | Open in IMG/M |
3300000506|Soeholt_1002136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 39309 | Open in IMG/M |
3300001096|JGI11944J13513_1003370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus | 10075 | Open in IMG/M |
3300001213|JGIcombinedJ13530_100622953 | Not Available | 673 | Open in IMG/M |
3300002961|JGI11641J44799_10003060 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5137 | Open in IMG/M |
3300003432|JGI20214J51088_11136397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 514 | Open in IMG/M |
3300003541|JGI20214J51650_10050614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2757 | Open in IMG/M |
3300003910|JGI26437J51864_10003935 | All Organisms → cellular organisms → Bacteria | 3348 | Open in IMG/M |
3300004154|Ga0066603_10520546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 561 | Open in IMG/M |
3300004242|Ga0066601_10065591 | Not Available | 1257 | Open in IMG/M |
3300004282|Ga0066599_100294850 | Not Available | 952 | Open in IMG/M |
3300006224|Ga0079037_100060723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3010 | Open in IMG/M |
3300006224|Ga0079037_100959546 | Not Available | 845 | Open in IMG/M |
3300006224|Ga0079037_101130219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 778 | Open in IMG/M |
3300006387|Ga0079069_1403229 | Not Available | 735 | Open in IMG/M |
3300006593|Ga0079081_1270252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 1449 | Open in IMG/M |
3300006930|Ga0079303_10061378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1351 | Open in IMG/M |
3300006930|Ga0079303_10098538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1100 | Open in IMG/M |
3300006930|Ga0079303_10104972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 1069 | Open in IMG/M |
3300006930|Ga0079303_10534783 | Not Available | 509 | Open in IMG/M |
3300009053|Ga0105095_10247650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
3300009085|Ga0105103_10309000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 863 | Open in IMG/M |
3300009085|Ga0105103_10378729 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
3300009153|Ga0105094_10417582 | Not Available | 777 | Open in IMG/M |
3300009165|Ga0105102_10921946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 505 | Open in IMG/M |
3300009169|Ga0105097_10349701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 819 | Open in IMG/M |
3300009171|Ga0105101_10164006 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300009179|Ga0115028_10762397 | Not Available | 748 | Open in IMG/M |
3300009658|Ga0116188_1131813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 952 | Open in IMG/M |
3300009664|Ga0116146_1002545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SCADC | 16044 | Open in IMG/M |
3300009666|Ga0116182_1428253 | Not Available | 516 | Open in IMG/M |
3300009667|Ga0116147_1014570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5064 | Open in IMG/M |
3300009667|Ga0116147_1211393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 756 | Open in IMG/M |
3300009669|Ga0116148_1000150 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 89074 | Open in IMG/M |
3300009673|Ga0116185_1109243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1361 | Open in IMG/M |
3300009675|Ga0116149_1001252 | All Organisms → cellular organisms → Bacteria | 31124 | Open in IMG/M |
3300009676|Ga0116187_1030869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3139 | Open in IMG/M |
3300009676|Ga0116187_1043795 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2487 | Open in IMG/M |
3300009685|Ga0116142_10374691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 690 | Open in IMG/M |
3300009689|Ga0116186_1044209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2557 | Open in IMG/M |
3300009693|Ga0116141_10002355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 16209 | Open in IMG/M |
3300009704|Ga0116145_1022326 | All Organisms → cellular organisms → Bacteria | 3481 | Open in IMG/M |
3300009714|Ga0116189_1073638 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
3300009714|Ga0116189_1096740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 1188 | Open in IMG/M |
3300009767|Ga0116161_1425131 | Not Available | 511 | Open in IMG/M |
3300009771|Ga0116155_10210109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 814 | Open in IMG/M |
3300009776|Ga0116154_10189159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 903 | Open in IMG/M |
3300010355|Ga0116242_10184507 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
3300010429|Ga0116241_10355013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1165 | Open in IMG/M |
3300019202|Ga0179947_1009324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 1528 | Open in IMG/M |
3300019206|Ga0179943_1137753 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 1443 | Open in IMG/M |
3300019221|Ga0179941_1217314 | Not Available | 975 | Open in IMG/M |
3300019222|Ga0179957_1107103 | Not Available | 961 | Open in IMG/M |
3300019226|Ga0179934_1227635 | Not Available | 714 | Open in IMG/M |
3300020814|Ga0214088_1098542 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
3300020814|Ga0214088_1573740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 725 | Open in IMG/M |
3300020814|Ga0214088_1824096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4848 | Open in IMG/M |
3300024056|Ga0124853_1081960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 3309 | Open in IMG/M |
3300025613|Ga0208461_1143813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 590 | Open in IMG/M |
3300025638|Ga0208198_1031410 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
3300025686|Ga0209506_1122918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 768 | Open in IMG/M |
3300025689|Ga0209407_1160349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 636 | Open in IMG/M |
3300025692|Ga0209744_1255873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 506 | Open in IMG/M |
3300025720|Ga0208197_1001530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 22697 | Open in IMG/M |
3300025730|Ga0209606_1017537 | All Organisms → cellular organisms → Bacteria | 4257 | Open in IMG/M |
3300025739|Ga0209745_1035447 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
3300025762|Ga0208040_1306676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 505 | Open in IMG/M |
3300025859|Ga0209096_1021360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3402 | Open in IMG/M |
3300025978|Ga0210092_1005185 | Not Available | 1600 | Open in IMG/M |
3300026250|Ga0209612_1063418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 1139 | Open in IMG/M |
3300027713|Ga0209286_1205758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 707 | Open in IMG/M |
3300027715|Ga0208665_10061128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1116 | Open in IMG/M |
3300027715|Ga0208665_10174442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 675 | Open in IMG/M |
3300027723|Ga0209703_1054690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1552 | Open in IMG/M |
3300027818|Ga0209706_10243358 | Not Available | 863 | Open in IMG/M |
3300027841|Ga0209262_10169082 | Not Available | 1052 | Open in IMG/M |
3300027871|Ga0209397_10019152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2100 | Open in IMG/M |
3300027871|Ga0209397_10461875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 627 | Open in IMG/M |
3300027885|Ga0209450_10007209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5815 | Open in IMG/M |
3300027885|Ga0209450_10055596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2467 | Open in IMG/M |
3300027885|Ga0209450_10394921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1008 | Open in IMG/M |
3300027890|Ga0209496_10295929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
3300027897|Ga0209254_10279352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1289 | Open in IMG/M |
3300027899|Ga0209668_10969890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
3300027900|Ga0209253_10033058 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4331 | Open in IMG/M |
3300027972|Ga0209079_10142044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 822 | Open in IMG/M |
3300027979|Ga0209705_10012793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4579 | Open in IMG/M |
(restricted) 3300028568|Ga0255345_1223066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 737 | Open in IMG/M |
3300028724|Ga0307338_118306 | Not Available | 624 | Open in IMG/M |
3300028725|Ga0307342_115115 | Not Available | 776 | Open in IMG/M |
3300028727|Ga0307344_119528 | Not Available | 704 | Open in IMG/M |
3300028752|Ga0307346_105119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 1459 | Open in IMG/M |
3300028753|Ga0307336_119214 | Not Available | 672 | Open in IMG/M |
3300028756|Ga0307341_118859 | Not Available | 703 | Open in IMG/M |
3300028907|Ga0302252_1011605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2176 | Open in IMG/M |
3300029626|Ga0307330_113677 | Not Available | 699 | Open in IMG/M |
3300029799|Ga0311022_13297631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 501 | Open in IMG/M |
3300032164|Ga0315283_10929673 | Not Available | 924 | Open in IMG/M |
3300032397|Ga0315287_11522931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 755 | Open in IMG/M |
3300032897|Ga0335071_10924416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 820 | Open in IMG/M |
3300033406|Ga0316604_10252796 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300033413|Ga0316603_12056608 | Not Available | 540 | Open in IMG/M |
3300033414|Ga0316619_11743566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 563 | Open in IMG/M |
3300033418|Ga0316625_100049681 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
3300033418|Ga0316625_101577907 | Not Available | 625 | Open in IMG/M |
3300033419|Ga0316601_100494866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 1171 | Open in IMG/M |
3300033433|Ga0326726_10023988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5304 | Open in IMG/M |
3300033433|Ga0326726_10352728 | All Organisms → cellular organisms → Bacteria | 1389 | Open in IMG/M |
3300033480|Ga0316620_10470593 | Not Available | 1154 | Open in IMG/M |
3300033481|Ga0316600_10046087 | All Organisms → cellular organisms → Bacteria | 2423 | Open in IMG/M |
3300033483|Ga0316629_10866304 | Not Available | 699 | Open in IMG/M |
3300033487|Ga0316630_12145098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 515 | Open in IMG/M |
3300033513|Ga0316628_103400034 | Not Available | 576 | Open in IMG/M |
3300033521|Ga0316616_103367753 | Not Available | 602 | Open in IMG/M |
3300033557|Ga0316617_100273346 | Not Available | 1409 | Open in IMG/M |
3300034123|Ga0370479_0244116 | Not Available | 517 | Open in IMG/M |
3300034158|Ga0370507_0333948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 | 510 | Open in IMG/M |
3300034169|Ga0370480_0000215 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 26576 | Open in IMG/M |
3300034169|Ga0370480_0003780 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 5670 | Open in IMG/M |
3300034194|Ga0370499_0060792 | Not Available | 907 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 36.80% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 11.20% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 9.60% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 5.60% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 4.80% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 4.00% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 4.00% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 3.20% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 3.20% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 3.20% |
Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 2.40% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.60% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.60% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.60% |
Hydrocarbon Resource Environments | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments | 1.60% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.80% |
Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 0.80% |
Anaerobic Digester | Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Anaerobic) → Activated Sludge → Anaerobic Digester | 0.80% |
Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 0.80% |
Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 0.80% |
Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 0.80% |
Wastewater Bioreactor | Engineered → Bioremediation → Terephthalate → Wastewater → Unclassified → Wastewater Bioreactor | 0.80% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000032 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
3300000313 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Cattail | Environmental | Open in IMG/M |
3300000506 | Anaerobic digester microbial communities from Northern Denmark, sample from Soeholt sludge | Engineered | Open in IMG/M |
3300001096 | Wastewater bioreactor microbial communities from Singapore -Terephthalate degrading community TA Sludge | Engineered | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
3300003910 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW | Environmental | Open in IMG/M |
3300004154 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 | Environmental | Open in IMG/M |
3300004242 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006387 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Oil_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300006593 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gly_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009655 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG | Engineered | Open in IMG/M |
3300009658 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG | Engineered | Open in IMG/M |
3300009664 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG | Engineered | Open in IMG/M |
3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
3300009667 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG | Engineered | Open in IMG/M |
3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
3300009673 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG | Engineered | Open in IMG/M |
3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
3300009676 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaG | Engineered | Open in IMG/M |
3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
3300009689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG | Engineered | Open in IMG/M |
3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
3300009704 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG | Engineered | Open in IMG/M |
3300009710 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC113_MetaG | Engineered | Open in IMG/M |
3300009714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG | Engineered | Open in IMG/M |
3300009767 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG | Engineered | Open in IMG/M |
3300009771 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG | Engineered | Open in IMG/M |
3300009776 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG | Engineered | Open in IMG/M |
3300010355 | AD_USDVca | Engineered | Open in IMG/M |
3300010429 | AD_USRAca | Engineered | Open in IMG/M |
3300019202 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA5_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019203 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR2_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019206 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_STIC08_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019221 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC048_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019222 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR4_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019226 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC055_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300025613 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025638 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025686 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025692 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes) | Environmental | Open in IMG/M |
3300025720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025730 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025739 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes) | Environmental | Open in IMG/M |
3300025762 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025859 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025978 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026250 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027715 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes) | Environmental | Open in IMG/M |
3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028568 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant20 | Engineered | Open in IMG/M |
3300028724 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Gln1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300028725 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_His1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300028727 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Arg1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300028752 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Lys1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300028753 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Glu1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300028756 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Pro2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300028907 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_RA_Leu | Engineered | Open in IMG/M |
3300029626 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Ser1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300029799 | Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119 | Engineered | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033406 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CT | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
3300033481 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CT | Environmental | Open in IMG/M |
3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300034123 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15 | Environmental | Open in IMG/M |
3300034158 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18 | Environmental | Open in IMG/M |
3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
Draft_00278375 | 3300000032 | Hydrocarbon Resource Environments | MQTVYPRYTLAERLVLSVISIVTWPVEHFLGWVRRKVVVDPIPSSGRR* |
Draft_04429043 | 3300000032 | Hydrocarbon Resource Environments | MQTVHPRYTLAERLILTVFTMVTWPVEHFLGWVRRKSVVDPVPAADRH* |
WSSedB1CaDRAFT_100278891 | 3300000313 | Wetland | MQTVYPRYTLAERMVLRFITVIIWPVERLAGWVRHKVAADLVPSGNR |
Soeholt_100213631 | 3300000506 | Anaerobic Digester | MQTVYPRYTMAERLVLAVIAVVTWPVERFLGWVRRKVAIDMAPSADHR* |
JGI11944J13513_10033709 | 3300001096 | Wastewater Bioreactor | MQTVYPRYTMAERLVLAVVAVVTWPAARFLGWVRRKAAAGPAP |
JGIcombinedJ13530_1006229531 | 3300001213 | Wetland | TVYPRYTLAERLVLSVVSIVTWPVEHFLGWVRRKVVADPIPSPGRR* |
JGI11641J44799_100030602 | 3300002961 | Wetland | MQTVYPRYTLAERLVLSVIAIVTWPVEHFLGWVRRKVVVDLAPSSDRR* |
JGI20214J51088_111363972 | 3300003432 | Wetland | MQTVYPRYTLAERLVLSVITIITWPVEHFLSWARRKVVVE |
JGI20214J51650_100506143 | 3300003541 | Wetland | MQTVYPRYTLAERMVLRFITVIIWPVERLAGWIRHKVAADLVPSGNRR* |
JGI26437J51864_100039354 | 3300003910 | Freshwater Lake Sediment | MQTVYPRYTLAERLVLSVIAIVTWPVEHFLGWVRRKVVVDLIPSARRR* |
Ga0066603_105205461 | 3300004154 | Freshwater | MQTVYPRYTLAERLVLSVISIVTWPVEHFLGWVRRKVVVDLIPSSDRR* |
Ga0066601_100655911 | 3300004242 | Freshwater | MQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRKVVVDLAPSTDRR* |
Ga0066599_1002948501 | 3300004282 | Freshwater | EMQTVYPRYTLAERMVLTVITIVTWPVEHFLGWIRRKVVVDLIPSSDRR* |
Ga0079037_1000607234 | 3300006224 | Freshwater Wetlands | MQTVHPRYTLAERLILAVFTMVTWPVEHFLGWVRRKAVFDLVPTADRR* |
Ga0079037_1009595462 | 3300006224 | Freshwater Wetlands | MTTGSLIEEQTMQTVHPRYTLAERLVLAVVTMITWPVEHFLGWVRRKVVVDLVPTADRR* |
Ga0079037_1011302191 | 3300006224 | Freshwater Wetlands | MQTVYPRYTLAERMVLAVITIVTWPVEHFLGWVRRKVVVDLIPSARRR* |
Ga0079069_14032292 | 3300006387 | Anaerobic Digestor Sludge | SFSPEYPMQTVYPRYTMAERLVLAVIAVVTWPVERFLGWVRRKVAIDMAPSADHR* |
Ga0079081_12702523 | 3300006593 | Anaerobic Digestor Sludge | FSPEYPMQTVYPRYTMAERLVLAVIAVVTWPVERFLGWVRRKVAIDMAPSADHR* |
Ga0079303_100613783 | 3300006930 | Deep Subsurface | MQTVYPRYTLAERLVLSVISIVTWPVEHFLGWVRRKVVVDLIPSSGRR* |
Ga0079303_100985382 | 3300006930 | Deep Subsurface | MQTVHPRYTLAERLVLAVVTMITWPVEHFLGWVRRKVVVDLVPTADRR* |
Ga0079303_101049722 | 3300006930 | Deep Subsurface | MQTVHPRYTLAERLILAVFTMVTWPVEHFLGWVRRKAVVDLVPTADRR* |
Ga0079303_105347832 | 3300006930 | Deep Subsurface | MQTVYPRYTLAERMVLTVITIVTWPVEHFLGWVRRKVVVDLIPSARRR* |
Ga0105095_102476501 | 3300009053 | Freshwater Sediment | VMQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRKVVVDLAPSTDRR* |
Ga0105103_103090001 | 3300009085 | Freshwater Sediment | MQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRK |
Ga0105103_103787292 | 3300009085 | Freshwater Sediment | MQTVYPRYTLAERLVLSVIAIVTWPVEHFLGWVRRKVVVDLIPSSDRR* |
Ga0105094_104175822 | 3300009153 | Freshwater Sediment | MQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRKVVVDLIPSSDRR* |
Ga0105102_109219461 | 3300009165 | Freshwater Sediment | MQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRKVVVD |
Ga0105097_103497011 | 3300009169 | Freshwater Sediment | MQTVYPRYTLAERLVLSVIAIVTWPVEHFLGWVRRKVVVDL |
Ga0105101_101640062 | 3300009171 | Freshwater Sediment | MQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWGRIIKKNNLAPSTDRR* |
Ga0115028_107623972 | 3300009179 | Wetland | LREEQAMQTVHPRYTLAERLILAVFTMVTWPVEHFLGWVRRKAVVDLVPTADRR* |
Ga0116190_10567802 | 3300009655 | Anaerobic Digestor Sludge | MAERLVLAVVALITWPVERFLGWARRRVAGDMAPSAHRR* |
Ga0116188_11318131 | 3300009658 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLILAVVAAVIWPAERFLGWVRRKIASDPAPSARCR* |
Ga0116146_100254510 | 3300009664 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAVVALITWPVERFLGWARRRVAGDMAPSAHRR* |
Ga0116182_14282531 | 3300009666 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAVIAVASWPVERFLGWVRRKVAVDMAPSADHR* |
Ga0116147_10145706 | 3300009667 | Anaerobic Digestor Sludge | MQTVQPRYTMAERLVLAVVALITWPVERFLGWARRRVAGDMAPSAHRR* |
Ga0116147_12113932 | 3300009667 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAVVALITWPVERLLGWAHRRVIVGMAPSSERR* |
Ga0116148_100015028 | 3300009669 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLILAVVAAVTWPVERFLGWARRKIAPDPAPSADRS* |
Ga0116185_11092433 | 3300009673 | Anaerobic Digestor Sludge | PMQTVYPRYTMAERLILAVVAAVIWPAERFLGWVRRKIASDPAPSARCR* |
Ga0116149_100125224 | 3300009675 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLILAVVAAVTWPVERFLGWARRKIAPDPAPAADRS* |
Ga0116187_10308694 | 3300009676 | Anaerobic Digestor Sludge | MQTVQPRYTMAERLVLAVVALMIWPIERFLGWARRKVIAGMAPSSERR* |
Ga0116187_10437955 | 3300009676 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAVIAVATWPVERFLGWVRRKVAIDMAPSADHR* |
Ga0116142_103746912 | 3300009685 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAVVAVVTWPVERFLGWVRRKVAVDLAPSADRR* |
Ga0116186_10442091 | 3300009689 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAVIAVATWPVERFLGWVRRKVAIDMAPSA |
Ga0116141_100023554 | 3300009693 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAVIAVVTWPVERYLGWVRRKVAIDMAPSADHR* |
Ga0116145_10223265 | 3300009704 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLILAVVAAVIWPAERFLGWVRR |
Ga0116192_10949042 | 3300009710 | Anaerobic Digestor Sludge | MAERLVLAVVALMIWPIERFLGWARRKVIAGMAPSSERR* |
Ga0116189_10736383 | 3300009714 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLILPVVAAVTWPVERFLGWARRKIAPDPAPSADRS* |
Ga0116189_10967401 | 3300009714 | Anaerobic Digestor Sludge | RPMQTVYPRYTMAERLILAVVAAVIWPAERFLGWVRRKIASDPAPSARCR* |
Ga0116161_14251311 | 3300009767 | Anaerobic Digestor Sludge | MAERLVLAVIAVATWPIERFLGWVRRKVAIDMAPSADHR* |
Ga0116155_102101092 | 3300009771 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAIAAVVTWPVERFLGWVRRTVAVDPAPSADRR* |
Ga0116154_101891592 | 3300009776 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAVVAVATWPVERFLGWVRRKVVVDLAPSADRR* |
Ga0116242_101845073 | 3300010355 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLILAVVAAVTWPVERFLGWVRRKIAPDPAPSADRS* |
Ga0116241_103550132 | 3300010429 | Anaerobic Digestor Sludge | MQTIYPRYTMAERLVLAFVAVVTWPVERFLGWVRRKVAVDPAPSADRR* |
Ga0179947_10093241 | 3300019202 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAVIAVVTWPVERFLGWVRRKVAIDMAPSADHR |
Ga0179955_10442381 | 3300019203 | Anaerobic Digestor Sludge | ERLVLAVVALITWPVERLLGWAHRRVIVGMAPSSERR |
Ga0179943_11377531 | 3300019206 | Anaerobic Digestor Sludge | PEYPMQTVYPRYTMAERLVLAVIAVVTWPVERFLGWVRRKVAIDMAPSADHR |
Ga0179941_12173142 | 3300019221 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAVIAVATWPVERFLGWVRRKVAIDMAPSADHR |
Ga0179957_11071031 | 3300019222 | Anaerobic Digestor Sludge | SGSFSPEYPMQTVYPRYTMAERLVLAVIAVVTWPVERFLGWVRRKVAIDMAPSADHR |
Ga0179934_12276352 | 3300019226 | Anaerobic Digestor Sludge | PRYTMAERLVLAVIAVATWPVERFLGWVRRKVAIDMAPSADHR |
Ga0214088_10985423 | 3300020814 | Granular Sludge | MQTDYPRYTMAERLILAVVAAVTWPAERFLGWVRRKIAADPAPSARRR |
Ga0214088_15737401 | 3300020814 | Granular Sludge | MQTVYPRYTMAERLVLAVVAVVTWPVERFLGWVRRKVAVDLAPSADRR |
Ga0214088_18240963 | 3300020814 | Granular Sludge | MQTVYPRYTMAERLVLAFVAVVTWPVERFLGWVRRKVAVDPAPSADRR |
Ga0124853_10819608 | 3300024056 | Freshwater Wetlands | MQTVHPRYTLAERLILAVFTMVTWPVEHFLGWVRRKAVVDLVPTADRR |
Ga0208461_11438132 | 3300025613 | Anaerobic Digestor Sludge | MQTVQPRYTMAERLVLAVVALITWPVERFLGWARRR |
Ga0208198_10314103 | 3300025638 | Anaerobic Digestor Sludge | MQTVQPRYTMAERLVLAVVALITWPVERFLGWARRRVAGDMAPSAHRR |
Ga0209506_11229182 | 3300025686 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLILAVVAAVIWPAERFLGWVRRKIASDPAPSARCR |
Ga0209407_11603491 | 3300025689 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAVVALITWPVERLLGWAHRRVIVGMAPSSERR |
Ga0209744_12558731 | 3300025692 | Arctic Peat Soil | EMQTVYPRYTLAERMVLTVIAIVTWPVEHFIGWVRRKVVVDLAPSTDRR |
Ga0208197_10015302 | 3300025720 | Anaerobic Digestor Sludge | MQTVQPRYTMAERLVLAVVALMIWPIERFLGWARRKVIAGMAPSSERR |
Ga0209606_10175375 | 3300025730 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLILAVVAAVTWPVERFLGWARRKIA |
Ga0209745_10354473 | 3300025739 | Arctic Peat Soil | MQTVYPRYTLAERMVLTVIAIVTWPVEHFIGWVRRKVVVDLAPSTDRR |
Ga0208040_13066761 | 3300025762 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAVIAVATWPVERFLGWVRRKVAIDMAP |
Ga0209096_10213602 | 3300025859 | Anaerobic Digestor Sludge | MQTVYPRYTMAERLVLAVVAAVTWPVERFLGWARRKIAPDPAPSADRS |
Ga0210092_10051852 | 3300025978 | Natural And Restored Wetlands | MQTVYPRYTLAERLVLSVIAIVTWPVEHFLGWVRRKVVVDLAPSSDRR |
Ga0209612_10634181 | 3300026250 | Anaerobic Biogas Reactor | MQTVYPRYTMAERLVLAVIAVVTWPVERFLGWVRRKVAID |
Ga0209286_12057582 | 3300027713 | Freshwater Sediment | MQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRKVVVDLVPTADRH |
Ga0208665_100611282 | 3300027715 | Deep Subsurface | MQTVHPRYTLAERLVLAVVTMITWPVEHFLGWVRRKVVVDLVPTADRR |
Ga0208665_101744421 | 3300027715 | Deep Subsurface | MQTVYPRYTLAERMVLTVITIVTWPVEHFLGWIRRKVVVDLIPS |
Ga0209703_10546903 | 3300027723 | Freshwater Sediment | MQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRKVVVDLAPSTDRR |
Ga0209706_102433582 | 3300027818 | Freshwater Sediment | RGTGSLREEYVMQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRKVVVDLAPSTDRR |
Ga0209262_101690822 | 3300027841 | Freshwater | MQTVYPRYTLAERLVLSVISIVTWPVEHFLGWVRRKVVVDLIPSSDRR |
Ga0209397_100191523 | 3300027871 | Wetland | MQTVHPRYTLAERLILAVFTMVTWPVEHFLGWVRRKAVFDLVPTADRR |
Ga0209397_104618752 | 3300027871 | Wetland | MQTVYPRYTLAERLVLSVISIVTWPVEHFLGWVRRKVVVDLIPSSGRR |
Ga0209450_100072096 | 3300027885 | Freshwater Lake Sediment | MQTVYPRYTLAERLVLSVIAIVTWPVEHFLGWVRRKVVVDLIPSARRR |
Ga0209450_100555963 | 3300027885 | Freshwater Lake Sediment | MQTVYPRYTLAERMVLTVITIVTWPVEHFLGWIRRKVVVDLIPSSDRR |
Ga0209450_103949212 | 3300027885 | Freshwater Lake Sediment | MQTVYPRYTLAERMVLTVITIVTWPVEHFLGWVRRKVVVDLIPSARRR |
Ga0209496_102959292 | 3300027890 | Wetland | MTTGSLIEEQTMQTVHPRYTLAERLVLAVVTMITWPVEHFLGWVRRKVVVDLVPTADRR |
Ga0209254_102793522 | 3300027897 | Freshwater Lake Sediment | MQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWARRKVVVDLIPSTDRR |
Ga0209668_109698901 | 3300027899 | Freshwater Lake Sediment | MQTVYPRYTLAERLVLSVIAIVTWPVEHFLGWVRRKVVVDLIPSSDRS |
Ga0209253_100330581 | 3300027900 | Freshwater Lake Sediment | MQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRKVVVDLVPSTDRR |
Ga0209079_101420441 | 3300027972 | Freshwater Sediment | MQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRKVVVDLIPSSDRR |
Ga0209705_100127931 | 3300027979 | Freshwater Sediment | MQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRKVVVDLAPSSDRR |
(restricted) Ga0255345_12230663 | 3300028568 | Wastewater | MQTVYPRYTMAERLVLAVIAVASWPVERFLGWVRRKVAVDMA |
Ga0307338_1183061 | 3300028724 | Anaerobic Digestor Sludge | YTMAERLVLAVIAVVTWPVERFLGWVRRKVAIDMAPSADHR |
Ga0307342_1151152 | 3300028725 | Anaerobic Digestor Sludge | VYPRYTMAERLVLAVIAVVTWPVERFLGWVRRKVAIDMAPSADHR |
Ga0307344_1195281 | 3300028727 | Anaerobic Digestor Sludge | TVYPRYTMAERLVLAVIAVVTWPVERFLGWVRRKVAIDMAPSADHR |
Ga0307346_1051191 | 3300028752 | Anaerobic Digestor Sludge | GSFSPEYPMQTVYPRYTMAERLVLAVIAVVTWPVERFLGWVRRKVAIDMAPSADHR |
Ga0307336_1192142 | 3300028753 | Anaerobic Digestor Sludge | SPEYPMQTVYPRYTMAERLVLAVIAVVTWPVERFLGWVRRKVAIDMAPSADHR |
Ga0307341_1188591 | 3300028756 | Anaerobic Digestor Sludge | TMAERLVLAVIAVVTWPVERFLGWVRRKVAIDMAPSADHR |
Ga0302252_10116053 | 3300028907 | Activated Sludge | MQTVYPRYTMAERLVLAVVAVATWPVERFLGWVRRKVVVDLAPSADRR |
Ga0307330_1136772 | 3300029626 | Anaerobic Digestor Sludge | SFSPEYPMQTVYPRYTMAERLVLAVIAVVTWPVERFLGWVRRKVAIDMAPSADHR |
Ga0311022_132976312 | 3300029799 | Anaerobic Digester Digestate | MHPVYPRYTMAERLVLAVVAVVTWPIERFLGWVRR |
Ga0315283_109296731 | 3300032164 | Sediment | VYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRKVVVDLAPSARRR |
Ga0315287_115229312 | 3300032397 | Sediment | MQTVYPRYTLAERMVLTVIAIVTWPVDHFLGWVRRKVVVDLAPSTDRR |
Ga0335071_109244161 | 3300032897 | Soil | MQTVYPRYTLAERMVLSLVTVVTWPVERFLGWLRHKAAADLVPSANRR |
Ga0316604_102527961 | 3300033406 | Soil | LREEQDMQTVYPRYTLAERLVLSVISIVTWPVEHLLGWVRHKVVVDLIPSSGRR |
Ga0316603_120566081 | 3300033413 | Soil | MQTVYPRYTLAERIVLTVITIVTWPVEHFLGWVRRKVVVDLIPSARRR |
Ga0316619_117435661 | 3300033414 | Soil | MQTVHPRYTLAERLVLAVVTMITWPVEHFLGWARRKVAVDLVPTADRR |
Ga0316625_1000496813 | 3300033418 | Soil | MQTVHPRYTLAERLVLAVVTMITWPVEHFLGWVRRKVVVDLVP |
Ga0316625_1015779071 | 3300033418 | Soil | TVYPRYTLAERMVLTVITIVTWPVEHFLGWVRRKVVVDLIPSARRR |
Ga0316601_1004948661 | 3300033419 | Soil | YPRYTLAERLVLSVISIVTWPVEHFLGWVRRKVVVDLIPSSGRR |
Ga0326726_100239883 | 3300033433 | Peat Soil | MQTVYPRYTLAERMVLGLIMAITWPVERVVSWIRRKVAADLVPSANRR |
Ga0326726_103527283 | 3300033433 | Peat Soil | MQTVYPRYTLAERMILSLVTVVTWPVERFLGWLRHKVAADLVPSANRR |
Ga0316620_104705931 | 3300033480 | Soil | MQTVHPRYTLAERLVLAVVTMITWPVEHFLGWARRKVVVDLVPSDNRR |
Ga0316600_100460871 | 3300033481 | Soil | MQTVYPRYTLAERMVLAVITIVTWPVEHFLGWVRRKVVVDLIPTDRRR |
Ga0316629_108663042 | 3300033483 | Soil | QTVYPRYTLAERLVLSVISIVTWPVEHFLGWVRRKVVVDLIPSARRR |
Ga0316630_121450982 | 3300033487 | Soil | MQTVYPRYTLAERMVLTVITIVTWPVEHFLGWVRRK |
Ga0316628_1034000341 | 3300033513 | Soil | MQTVHPRYTLAERLVLAVVTMICWPVEHFLGWARRKVAVDLVPTADRR |
Ga0316616_1033677531 | 3300033521 | Soil | MQTVHPRYTLAERLVLAVVTMITWPVEHFLGWARRKVAVDLVPTANRR |
Ga0316617_1002733462 | 3300033557 | Soil | MQTVYPRYTLAERMVLTVITIVTWPVEHFLGWVRRKVVVDLIPTDRRR |
Ga0370479_0244116_31_177 | 3300034123 | Untreated Peat Soil | MQTVYPRYTLAERMVLTVITIVTWPVEHFLGWVRRKAVVDLAPSTDRR |
Ga0370507_0333948_395_508 | 3300034158 | Untreated Peat Soil | MQTVYPRYTLAERLVLSVISIVTWPVEHFLGWARRKVV |
Ga0370480_0000215_136_282 | 3300034169 | Untreated Peat Soil | MQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRKVVVDLAPSTDHR |
Ga0370480_0003780_929_1075 | 3300034169 | Untreated Peat Soil | MQTVYPRYTLAERMVLTVIAIVTWPVEHFLGWVRRKAVVDLAPSTDRR |
Ga0370499_0060792_554_700 | 3300034194 | Untreated Peat Soil | MQTVYPRYTLAERLVLSVISIVTWPVEHFLGWARRKVVVDLIPSSGRR |
⦗Top⦘ |