


| Basic Information | |
|---|---|
| Family ID | F048673 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 148 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MRTFAMLLILVAIAASQPHHWLSVVMAAIAHLLGR |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 148 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.27 % |
| % of genes near scaffold ends (potentially truncated) | 3.38 % |
| % of genes from short scaffolds (< 2000 bps) | 60.81 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.919 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (9.460 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.135 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (50.676 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 50.79% β-sheet: 0.00% Coil/Unstructured: 49.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 148 Family Scaffolds |
|---|---|---|
| PF01807 | zf-CHC2 | 11.49 |
| PF13155 | Toprim_2 | 10.81 |
| PF00436 | SSB | 5.41 |
| PF04002 | RadC | 3.38 |
| PF01656 | CbiA | 2.03 |
| PF04014 | MazE_antitoxin | 2.03 |
| PF02604 | PhdYeFM_antitox | 1.35 |
| PF02768 | DNA_pol3_beta_3 | 1.35 |
| PF08240 | ADH_N | 0.68 |
| PF07690 | MFS_1 | 0.68 |
| PF10040 | CRISPR_Cas6 | 0.68 |
| PF13208 | TerB_N | 0.68 |
| PF01555 | N6_N4_Mtase | 0.68 |
| PF00196 | GerE | 0.68 |
| PF12696 | TraG-D_C | 0.68 |
| PF01145 | Band_7 | 0.68 |
| PF08666 | SAF | 0.68 |
| PF08305 | NPCBM | 0.68 |
| PF00534 | Glycos_transf_1 | 0.68 |
| PF07681 | DoxX | 0.68 |
| PF08818 | DUF1801 | 0.68 |
| PF13280 | WYL | 0.68 |
| PF08388 | GIIM | 0.68 |
| PF00271 | Helicase_C | 0.68 |
| PF00712 | DNA_pol3_beta | 0.68 |
| PF12728 | HTH_17 | 0.68 |
| PF01980 | TrmO | 0.68 |
| PF13784 | Fic_N | 0.68 |
| PF01408 | GFO_IDH_MocA | 0.68 |
| PF02683 | DsbD | 0.68 |
| PF01551 | Peptidase_M23 | 0.68 |
| PF01022 | HTH_5 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
|---|---|---|---|
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 11.49 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 5.41 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 5.41 |
| COG2003 | DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motif | Replication, recombination and repair [L] | 3.38 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 2.03 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.35 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.35 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.68 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.68 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.68 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.68 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.68 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.92 % |
| Unclassified | root | N/A | 6.08 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001213|JGIcombinedJ13530_100512015 | Not Available | 541 | Open in IMG/M |
| 3300001380|JGI1356J14229_10009589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6648 | Open in IMG/M |
| 3300005529|Ga0070741_10028026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8101 | Open in IMG/M |
| 3300005657|Ga0073903_10364579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 640 | Open in IMG/M |
| 3300005659|Ga0073900_10171981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 985 | Open in IMG/M |
| 3300005827|Ga0074478_1598373 | Not Available | 591 | Open in IMG/M |
| 3300005831|Ga0074471_10904073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 837 | Open in IMG/M |
| 3300005836|Ga0074470_10336730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 29623 | Open in IMG/M |
| 3300005836|Ga0074470_10906451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5513 | Open in IMG/M |
| 3300005836|Ga0074470_10938425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 934 | Open in IMG/M |
| 3300005892|Ga0075275_1000293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 7106 | Open in IMG/M |
| 3300005901|Ga0075274_1030739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 767 | Open in IMG/M |
| 3300005902|Ga0075273_10007684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1752 | Open in IMG/M |
| 3300005961|Ga0075157_10237685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 704 | Open in IMG/M |
| 3300005982|Ga0075156_10085916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1775 | Open in IMG/M |
| 3300006033|Ga0075012_10322969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1043 | Open in IMG/M |
| 3300006417|Ga0069787_10006297 | All Organisms → cellular organisms → Bacteria | 112990 | Open in IMG/M |
| 3300006417|Ga0069787_10010280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 27715 | Open in IMG/M |
| 3300006417|Ga0069787_10021833 | All Organisms → cellular organisms → Bacteria | 37008 | Open in IMG/M |
| 3300006417|Ga0069787_10069330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1825 | Open in IMG/M |
| 3300006865|Ga0073934_10001553 | All Organisms → cellular organisms → Bacteria | 54206 | Open in IMG/M |
| 3300006865|Ga0073934_10006757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 16448 | Open in IMG/M |
| 3300006865|Ga0073934_10137657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1766 | Open in IMG/M |
| 3300006917|Ga0075472_10073391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1644 | Open in IMG/M |
| 3300007072|Ga0073932_1000078 | All Organisms → cellular organisms → Bacteria | 240419 | Open in IMG/M |
| 3300007072|Ga0073932_1047983 | Not Available | 2292 | Open in IMG/M |
| 3300007216|Ga0103961_1172114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3807 | Open in IMG/M |
| 3300007351|Ga0104751_1003924 | All Organisms → cellular organisms → Bacteria | 20394 | Open in IMG/M |
| 3300007351|Ga0104751_1048244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2083 | Open in IMG/M |
| 3300007521|Ga0105044_10015506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 10296 | Open in IMG/M |
| 3300007614|Ga0102946_1000148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 23864 | Open in IMG/M |
| 3300007986|Ga0100380_10085459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1995 | Open in IMG/M |
| 3300008002|Ga0100390_10320124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 754 | Open in IMG/M |
| 3300009131|Ga0115027_11894786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 502 | Open in IMG/M |
| 3300009157|Ga0105092_10102276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1573 | Open in IMG/M |
| 3300009179|Ga0115028_10359055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1006 | Open in IMG/M |
| 3300009179|Ga0115028_10402687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 962 | Open in IMG/M |
| 3300009179|Ga0115028_10576111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 836 | Open in IMG/M |
| 3300009179|Ga0115028_11541560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 566 | Open in IMG/M |
| 3300009295|Ga0103747_10152109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 614 | Open in IMG/M |
| 3300009540|Ga0073899_10367612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1069 | Open in IMG/M |
| 3300009685|Ga0116142_10093949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1642 | Open in IMG/M |
| 3300009687|Ga0116144_10213451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1025 | Open in IMG/M |
| 3300009711|Ga0116166_1000013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 157559 | Open in IMG/M |
| 3300009711|Ga0116166_1000666 | All Organisms → cellular organisms → Bacteria | 32449 | Open in IMG/M |
| 3300009868|Ga0130016_10001746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 44584 | Open in IMG/M |
| 3300009868|Ga0130016_10002589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 36245 | Open in IMG/M |
| 3300009868|Ga0130016_10136564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2007 | Open in IMG/M |
| 3300009868|Ga0130016_10483832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 797 | Open in IMG/M |
| 3300010293|Ga0116204_1003547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8120 | Open in IMG/M |
| 3300010293|Ga0116204_1122809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 884 | Open in IMG/M |
| 3300010357|Ga0116249_10266876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1584 | Open in IMG/M |
| 3300010412|Ga0136852_11183917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 726 | Open in IMG/M |
| 3300011391|Ga0137331_1014172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 764 | Open in IMG/M |
| 3300011413|Ga0137333_1000885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7730 | Open in IMG/M |
| 3300011419|Ga0137446_1082733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 750 | Open in IMG/M |
| 3300011431|Ga0137438_1099581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 884 | Open in IMG/M |
| 3300011438|Ga0137451_1252847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 555 | Open in IMG/M |
| 3300012018|Ga0119867_1141482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 642 | Open in IMG/M |
| 3300012174|Ga0137338_1076610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 724 | Open in IMG/M |
| 3300012174|Ga0137338_1115025 | Not Available | 591 | Open in IMG/M |
| 3300012179|Ga0137334_1000634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6083 | Open in IMG/M |
| 3300012228|Ga0137459_1127882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 743 | Open in IMG/M |
| 3300012228|Ga0137459_1260310 | Not Available | 500 | Open in IMG/M |
| 3300012231|Ga0137465_1238679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 539 | Open in IMG/M |
| 3300012533|Ga0138256_10458390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1040 | Open in IMG/M |
| 3300012533|Ga0138256_10746071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 760 | Open in IMG/M |
| 3300012956|Ga0154020_10142294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2285 | Open in IMG/M |
| 3300012956|Ga0154020_10166353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2071 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10045847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2989 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10442868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 576 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10453582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 567 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10434838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 734 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10521313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 649 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10064638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3007 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10727880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 583 | Open in IMG/M |
| (restricted) 3300013136|Ga0172370_10291724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 949 | Open in IMG/M |
| 3300013315|Ga0173609_10839339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1215 | Open in IMG/M |
| 3300013793|Ga0119894_1001294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2880 | Open in IMG/M |
| 3300014303|Ga0075358_1118302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 542 | Open in IMG/M |
| 3300014309|Ga0075317_1113353 | Not Available | 605 | Open in IMG/M |
| 3300014309|Ga0075317_1187386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 503 | Open in IMG/M |
| 3300014863|Ga0180060_1061083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 530 | Open in IMG/M |
| 3300014868|Ga0180088_1100955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 523 | Open in IMG/M |
| 3300014885|Ga0180063_1022192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1739 | Open in IMG/M |
| 3300015360|Ga0163144_10050859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7367 | Open in IMG/M |
| 3300018059|Ga0184615_10057194 | Not Available | 2174 | Open in IMG/M |
| 3300018465|Ga0190269_11422374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 565 | Open in IMG/M |
| 3300020048|Ga0207193_1064433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3651 | Open in IMG/M |
| 3300020198|Ga0194120_10017818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7551 | Open in IMG/M |
| 3300020198|Ga0194120_10461495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 582 | Open in IMG/M |
| 3300020213|Ga0163152_10007797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 11586 | Open in IMG/M |
| 3300021604|Ga0226835_1000044 | All Organisms → cellular organisms → Bacteria | 266802 | Open in IMG/M |
| 3300021604|Ga0226835_1000130 | All Organisms → cellular organisms → Bacteria | 135578 | Open in IMG/M |
| 3300022554|Ga0212093_1000167 | All Organisms → cellular organisms → Bacteria | 267385 | Open in IMG/M |
| 3300025017|Ga0210022_1004259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 8306 | Open in IMG/M |
| 3300025115|Ga0209835_1008235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 3958 | Open in IMG/M |
| 3300025124|Ga0210058_1158922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 827 | Open in IMG/M |
| 3300025161|Ga0209381_1154310 | Not Available | 725 | Open in IMG/M |
| 3300025310|Ga0209172_10000016 | All Organisms → cellular organisms → Bacteria | 572055 | Open in IMG/M |
| 3300025310|Ga0209172_10016342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 5676 | Open in IMG/M |
| 3300025525|Ga0208244_106344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2668 | Open in IMG/M |
| 3300025631|Ga0209204_1000896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 30410 | Open in IMG/M |
| 3300025631|Ga0209204_1000905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 30271 | Open in IMG/M |
| 3300025631|Ga0209204_1006882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6786 | Open in IMG/M |
| 3300025784|Ga0209200_1303912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 524 | Open in IMG/M |
| 3300025982|Ga0208139_1002386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1942 | Open in IMG/M |
| 3300026010|Ga0207999_1018806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → unclassified Anaerolineales → Anaerolineales bacterium | 649 | Open in IMG/M |
| 3300026135|Ga0209939_1000442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7453 | Open in IMG/M |
| 3300026282|Ga0209053_1022122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1358 | Open in IMG/M |
| 3300026516|Ga0209573_1001139 | All Organisms → cellular organisms → Bacteria | 43587 | Open in IMG/M |
| 3300027705|Ga0209063_1073524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1234 | Open in IMG/M |
| 3300027722|Ga0209819_10069082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1222 | Open in IMG/M |
| 3300027776|Ga0209277_10009715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4432 | Open in IMG/M |
| 3300027776|Ga0209277_10052905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1843 | Open in IMG/M |
| 3300027786|Ga0209812_10325831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 674 | Open in IMG/M |
| 3300027819|Ga0209514_10001174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 47569 | Open in IMG/M |
| 3300027850|Ga0209591_10377251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 997 | Open in IMG/M |
| 3300027851|Ga0209066_10014575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6907 | Open in IMG/M |
| 3300027851|Ga0209066_10020033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5577 | Open in IMG/M |
| 3300027885|Ga0209450_11294704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 501 | Open in IMG/M |
| 3300027890|Ga0209496_10338615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 765 | Open in IMG/M |
| 3300028804|Ga0268298_10000730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 41492 | Open in IMG/M |
| 3300028804|Ga0268298_10003408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 16292 | Open in IMG/M |
| 3300028804|Ga0268298_10044772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2957 | Open in IMG/M |
| 3300028804|Ga0268298_10094148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1801 | Open in IMG/M |
| 3300028804|Ga0268298_10278260 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 875 | Open in IMG/M |
| 3300028804|Ga0268298_10496107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 595 | Open in IMG/M |
| 3300029893|Ga0246236_1010227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2115 | Open in IMG/M |
| 3300029893|Ga0246236_1013462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1642 | Open in IMG/M |
| 3300029990|Ga0311336_10491247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1039 | Open in IMG/M |
| 3300031521|Ga0311364_11702509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 621 | Open in IMG/M |
| 3300031902|Ga0302322_102204930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 678 | Open in IMG/M |
| 3300032156|Ga0315295_10692552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1029 | Open in IMG/M |
| 3300032173|Ga0315268_10000085 | All Organisms → cellular organisms → Bacteria | 104172 | Open in IMG/M |
| 3300032173|Ga0315268_10175576 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 2041 | Open in IMG/M |
| 3300032173|Ga0315268_10584133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1107 | Open in IMG/M |
| 3300032173|Ga0315268_10650915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1048 | Open in IMG/M |
| 3300032173|Ga0315268_12347597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 547 | Open in IMG/M |
| 3300033233|Ga0334722_10314208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1140 | Open in IMG/M |
| 3300033418|Ga0316625_100333776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1103 | Open in IMG/M |
| 3300033488|Ga0316621_10289929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1071 | Open in IMG/M |
| 3300033488|Ga0316621_10663463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 750 | Open in IMG/M |
| 3300033521|Ga0316616_102914910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 645 | Open in IMG/M |
| 3300033521|Ga0316616_103703025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 576 | Open in IMG/M |
| 3300034128|Ga0370490_0077178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 1088 | Open in IMG/M |
| 3300034157|Ga0370506_098957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → unclassified Anaerolineaceae → Anaerolineaceae bacterium | 650 | Open in IMG/M |
| 3300034158|Ga0370507_0188310 | Not Available | 667 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 9.46% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 6.08% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 6.08% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.41% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 4.73% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 4.05% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 4.05% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 3.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.38% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 3.38% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 3.38% |
| Aquifer | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer | 2.70% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 2.70% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 2.70% |
| Enhanced Biological Phosphorus Removal Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Activated Sludge → Enhanced Biological Phosphorus Removal Bioreactor | 2.70% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.03% |
| Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 2.03% |
| Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 2.03% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.03% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.03% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.03% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.35% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 1.35% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.35% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.35% |
| Fracture Fluid | Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracture Fluid | 1.35% |
| Deep Subsurface Aquifer | Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer | 1.35% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 1.35% |
| Active Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Active Sludge | 1.35% |
| Wastewater Treatment | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment | 1.35% |
| Anaerobic Bioreactor Biomass | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Bioreactor Biomass | 1.35% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.68% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.68% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.68% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.68% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.68% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Serpentinite Rock And Fluid | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid | 0.68% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.68% |
| Wastewater | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater | 0.68% |
| Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 0.68% |
| Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001380 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005657 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_bulk | Engineered | Open in IMG/M |
| 3300005659 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Kit | Engineered | Open in IMG/M |
| 3300005827 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.188_CBA | Environmental | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005892 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_305 | Environmental | Open in IMG/M |
| 3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
| 3300005902 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_102 | Environmental | Open in IMG/M |
| 3300005961 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 B green DNA | Engineered | Open in IMG/M |
| 3300005982 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA | Engineered | Open in IMG/M |
| 3300006033 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 | Environmental | Open in IMG/M |
| 3300006417 | Combined Assembly of Gp0110018, Gp0110022, Gp0110020 | Engineered | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007072 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG | Environmental | Open in IMG/M |
| 3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007351 | Combined Assembly of Gp0115775, Gp0115815 | Environmental | Open in IMG/M |
| 3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
| 3300007614 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MG | Environmental | Open in IMG/M |
| 3300007986 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-04 | Environmental | Open in IMG/M |
| 3300008002 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-14 | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009295 | Microbial communities of wastewater sludge from Singapore - Sludge5_b2_February | Environmental | Open in IMG/M |
| 3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009711 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR2_MetaG | Engineered | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300011391 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT163_2 | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300012018 | Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR) | Engineered | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012533 | Active sludge microbial communities from wastewater in Klosterneuburg, Austria - KNB2014incub_MG | Engineered | Open in IMG/M |
| 3300012956 | Active sludge microbial communities from wastewater, Klosterneuburg, Austria - Klosneuvirus_20160825_MG | Engineered | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013136 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11.5m | Environmental | Open in IMG/M |
| 3300013315 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B | Engineered | Open in IMG/M |
| 3300013793 | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - WX_AS_meta | Engineered | Open in IMG/M |
| 3300014303 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014309 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014863 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10D | Environmental | Open in IMG/M |
| 3300014868 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10D | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020213 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP8.IB-2 | Environmental | Open in IMG/M |
| 3300021604 | Anaerobic ammonium oxidizing microbial communities from anammox membrane bioreactor (MBR) in UC Berkley, California, United States - LAC_MetaG_1 | Engineered | Open in IMG/M |
| 3300022554 | Dewar_combined assembly | Environmental | Open in IMG/M |
| 3300025017 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-20 (SPAdes) | Environmental | Open in IMG/M |
| 3300025115 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025124 | Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300025161 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Dewar Creek DC9 2012 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025525 | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_5A (SPAdes) | Environmental | Open in IMG/M |
| 3300025631 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNMR2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025784 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025982 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 (SPAdes) | Environmental | Open in IMG/M |
| 3300026010 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026135 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026282 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - Reactor 1_7/15/2010_ DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026516 | Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor_6/25/2014_ DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027705 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit (SPAdes) | Engineered | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027776 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027786 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027819 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027850 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes) | Environmental | Open in IMG/M |
| 3300027851 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028804 | Activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt | Engineered | Open in IMG/M |
| 3300029893 | Fracture fluid microbial communities from borehole on the 26 level of Beatrix Gold Mine, Welkom, South Africa - Be326_2012_MF | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
| 3300034157 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18 | Environmental | Open in IMG/M |
| 3300034158 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_18 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ13530_1005120152 | 3300001213 | Wetland | MRTLAILFFLIAIAASQPHHWLLVVMAFIARTLGA* |
| JGI1356J14229_100095897 | 3300001380 | Groundwater | MSILAMLLILVAVAASQPYHWFSLVMASIAHCLGG* |
| Ga0070741_1002802611 | 3300005529 | Surface Soil | MRTLALLLILVAIAASQPHDWLSVVIASLAHCLGK* |
| Ga0073903_103645792 | 3300005657 | Activated Sludge | MIMRTFALLLILVAIAASQPHHWLSEIMAAIAHCIGR* |
| Ga0073900_101719812 | 3300005659 | Activated Sludge | MRTLAMLLILVAIAANQPYHWLSIIVAFIAQLLGG* |
| Ga0074478_15983732 | 3300005827 | Sediment (Intertidal) | MRTFALLLVLVAIAASQPHHWLSVIVAAIAHILGM* |
| Ga0074471_109040733 | 3300005831 | Sediment (Intertidal) | MRTLAFLLILVAFAASQPNYWLSVVMASIAHLLGR* |
| Ga0074470_103367308 | 3300005836 | Sediment (Intertidal) | MRTFAMLLILVAIAASQPHHWLAVILAAIARCIGK* |
| Ga0074470_109064512 | 3300005836 | Sediment (Intertidal) | MRTFALLLILVAIAASQPHHWLSVSVAAIAHILGR* |
| Ga0074470_109384252 | 3300005836 | Sediment (Intertidal) | MRTFALLLVLVAIAASQPHHWLSVIMAAIAHILGM* |
| Ga0075275_10002939 | 3300005892 | Rice Paddy Soil | MRTLALLLILVAIAASQPHHLLLAVMAAIARLSGM* |
| Ga0075274_10307392 | 3300005901 | Rice Paddy Soil | MRTLALLLILVAIAASQPHHLLLALMAAIARLSGM* |
| Ga0075273_100076845 | 3300005902 | Rice Paddy Soil | MRTLALLLILVALASSQPRHLLLALMAAIARLSGM* |
| Ga0075157_102376852 | 3300005961 | Wastewater Effluent | MRTLAFLLILVAIAASQPNYWLSVVMASIAHLLGR* |
| Ga0075156_100859162 | 3300005982 | Wastewater Effluent | MRTFALLLILVAIAASQPHHWLSEIMAAIARCIGK* |
| Ga0075012_103229691 | 3300006033 | Watersheds | MRTFALLLILVAIAASQPHHWLSVIMVAIIRRIGK* |
| Ga0069787_1000629718 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | MRTFALLLILVAIAASQPHHWLAVCMAAIAQCLGH* |
| Ga0069787_1001028016 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | MRTFAMLLILVAIAASQPHHWLSAIMVAIARCIGR* |
| Ga0069787_1002183319 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | MRTFAMLLILVAIAASEPHHWLTVLMAAIAHCIGK* |
| Ga0069787_100693302 | 3300006417 | Enhanced Biological Phosphorus Removal Bioreactor | MRTFAFLLIMVAIAASQPHHWLAVCMAAIAHCLGR* |
| Ga0073934_1000155357 | 3300006865 | Hot Spring Sediment | MRTFAMLLILVAIAASQPHHWLTVLMAAIVRCIGK* |
| Ga0073934_1000675712 | 3300006865 | Hot Spring Sediment | MRTLAILLILVAIAASQPHHWLAVLMAAIAHCICR* |
| Ga0073934_101376574 | 3300006865 | Hot Spring Sediment | MIMRTFALILILVAIAASEPHHWLTVIIAAIVRCIGK* |
| Ga0075472_100733913 | 3300006917 | Aqueous | MKTFAWLLILVAIAASQPQHWLAVSMAAIAHILGK* |
| Ga0073932_100007845 | 3300007072 | Hot Spring Sediment | MRTFAMLLILVAIAASRRSRSVFLRGQPHHWLTVLMAAIAHCIGK* |
| Ga0073932_10479833 | 3300007072 | Hot Spring Sediment | MRTLAILLILVAIAASQPHHWLSVILAAIAHLLGR* |
| Ga0103961_11721142 | 3300007216 | Freshwater Lake | MKTLAMLLILVAIATSQPHRWLVVLMAAIAHCLGN* |
| Ga0104751_10039248 | 3300007351 | Deep Subsurface Aquifer | MRTLAMLLILVAIAASQPHRWLSVAVAFITHLLGA* |
| Ga0104751_10482444 | 3300007351 | Deep Subsurface Aquifer | MRTFAMLLILVAIAASQPHHWLTVLMAAIAHCIGK* |
| Ga0105044_100155065 | 3300007521 | Freshwater | MRTLAMLLILVAIAASQPNHWLSVVMASIAHLLGR* |
| Ga0102946_10001488 | 3300007614 | Soil | MRTYAFILILVAIAASQPHHWLSAVMTAITHCMGR* |
| Ga0100380_100854594 | 3300007986 | Aquifer | MRTLAAFLVLIAIAASQPHHWLGIALAALAHCLGG* |
| Ga0100390_103201242 | 3300008002 | Aquifer | MIMRTLAAFLVLIAIAASQPHHWLGIALAALAHCLGG* |
| Ga0115027_118947861 | 3300009131 | Wetland | MRTLAMLLILVAIAASQPHHWLAVLMVAIARCIGR* |
| Ga0105092_101022763 | 3300009157 | Freshwater Sediment | MRTLALILILVAIAASQPHHWFLTVMTSLTHCLGS* |
| Ga0115028_103590551 | 3300009179 | Wetland | MRTYALLLILIAIAASQPHHWLLVVMEFIARILGV* |
| Ga0115028_104026871 | 3300009179 | Wetland | QIMRTFAMLLILVAIAASQPHYWLSVVLAAIAHLLGR* |
| Ga0115028_105761112 | 3300009179 | Wetland | MRTYAFILILIAIAASQPHHWLLVVMAFIARILGA* |
| Ga0115028_115415601 | 3300009179 | Wetland | MIMRTFALLLVLVAIAASQPHHWLAVIVAAIAHILDK* |
| Ga0103747_101521092 | 3300009295 | Wastewater Sludge | MRTFAMLLILVAIVASQPHHWLTVLMAAIAHCIGR* |
| Ga0073899_103676122 | 3300009540 | Activated Sludge | MRTLATLLILVAIAASQPHHWLAVLMAAIASCIGR* |
| Ga0116142_100939491 | 3300009685 | Anaerobic Digestor Sludge | MRTFAMLLILVAIAASQPHHWLAVLMAAIASCIGR* |
| Ga0116144_102134513 | 3300009687 | Anaerobic Digestor Sludge | MRTFAMLLILVAIAASQPHHWLTVLMAAIARCIGR* |
| Ga0116166_1000013138 | 3300009711 | Anaerobic Digestor Sludge | MRTLALILILVAIAASQPYHWLGSFLADLAHLLGA* |
| Ga0116166_100066631 | 3300009711 | Anaerobic Digestor Sludge | MSMRTYAWLLILVAIAASQPQHWLGSFLAALARLLGE* |
| Ga0130016_100017465 | 3300009868 | Wastewater | MSMRTLALLLILVAIAASQPYHWLGSFLAVLAHLLGA* |
| Ga0130016_1000258916 | 3300009868 | Wastewater | MRTLALLLILVAIAASQPHHWLSAVMAALAHCLGG* |
| Ga0130016_101365642 | 3300009868 | Wastewater | MSMKTHALILILVAIAASQPQHWLGSFLATLAHLLGA* |
| Ga0130016_104838322 | 3300009868 | Wastewater | RMSMRTFAWLLILVAIAVSQPHLWLGSFLAPLAHFLGA* |
| Ga0116204_100354713 | 3300010293 | Anoxic Lake Water | MRTLATLLILVAIAASQPHHWLAVVMAAIANCMGN* |
| Ga0116204_11228092 | 3300010293 | Anoxic Lake Water | MKTLAFLLILVAIAASQPHHWLSVVLAAIAHYLGN* |
| Ga0116249_102668762 | 3300010357 | Anaerobic Digestor Sludge | MRTFAMLLILVAIAASQPHHWLAVLMAAIAHCIGK* |
| Ga0136852_111839172 | 3300010412 | Mangrove Sediment | MRTFAILLILVAIAASQPHHWLSVVVAAITHCIGR* |
| Ga0137331_10141722 | 3300011391 | Soil | MRTLALLLILVAIAASQPNHWLSVVMASIAHLLGR* |
| Ga0137333_10008856 | 3300011413 | Soil | MIMRTFALLLVLVAIAASQPHHWLALIVAAIAQILGR* |
| Ga0137446_10827332 | 3300011419 | Soil | MRTLAMLLILVAIAASQPNHWLSVVMASIAHFLGR* |
| Ga0137438_10995812 | 3300011431 | Soil | MIMRTFALLLVLVAIAASQPHQWLSGIVAAIAHILGM* |
| Ga0137451_12528471 | 3300011438 | Soil | MRTLAMLLILVAIAVSQPNHWLSVVMASIALTLGR* |
| Ga0119867_11414822 | 3300012018 | Activated Sludge | MRTFAFLLILVAIAASQPHHWLSAIMVAIAHCIGR* |
| Ga0137338_10766102 | 3300012174 | Soil | MIMRTFALLLVLVAIAASQPHHWLSVIMAAIAHILGS* |
| Ga0137338_11150251 | 3300012174 | Soil | MIMRTFALLLILVAIAASQPHHWLALIMAAIAHILGR* |
| Ga0137334_10006347 | 3300012179 | Soil | MIMRTFALLLVLVAIAASQPHHWLSAIMAAIAHILGS* |
| Ga0137459_11278821 | 3300012228 | Soil | RRMIMRTFALLLVLVAIAASQPHHWLALIVAAIAQILGR* |
| Ga0137459_12603102 | 3300012228 | Soil | MIMRTFALLLILVAIAASQPYHWLSLIMAAIAHILGR* |
| Ga0137465_12386792 | 3300012231 | Soil | MIMKTLALLLILVAIAASQPHHWLAVIMAAIARCIGK* |
| Ga0138256_104583902 | 3300012533 | Active Sludge | MIMRTFALLLIMVAIAASQPHHWLSEIMAAIARCIGK* |
| Ga0138256_107460712 | 3300012533 | Active Sludge | MRTFAFLLILVAIAASQPHHWLAVCMAAIAHCLGS* |
| Ga0154020_101422943 | 3300012956 | Active Sludge | MIMRTFALLLILVAIAASQPHHWLSEIMAAIARCIGK* |
| Ga0154020_101663532 | 3300012956 | Active Sludge | MRTLAMLLILVAIAASQPYHWLSVVMASIARLLGR* |
| (restricted) Ga0172368_100458471 | 3300013123 | Freshwater | MRTFALLLILVAIAASQPHYWLSVVLAAIAHLRRR* |
| (restricted) Ga0172368_104428682 | 3300013123 | Freshwater | MRTFALLLILVAIAASQPHHWLSVILATIAHLLGR* |
| (restricted) Ga0172368_104535821 | 3300013123 | Freshwater | MKTFAWLLVLIAIAASQPQHWLGSFLAILAHLLGA* |
| (restricted) Ga0172367_104348382 | 3300013126 | Freshwater | MRTFALLLILVAIAASQPHHWLSVVLAAIAHLLGR* |
| (restricted) Ga0172367_105213132 | 3300013126 | Freshwater | MRTFALLLILVTIAASQPHYWLSVVLAAIAHLLGR* |
| (restricted) Ga0172373_100646385 | 3300013131 | Freshwater | MRTFAILLILVAIAASQPHHWLAVVMAAIAHCLGN* |
| (restricted) Ga0172373_107278801 | 3300013131 | Freshwater | MIMRTFALLLILVAIAASQPHHWLSEIMAAIARCIGR* |
| (restricted) Ga0172370_102917242 | 3300013136 | Freshwater | MRTFALLLILVAIAASQPHYWLSVVLAAIAHLLGR* |
| Ga0173609_108393392 | 3300013315 | Sediment | MRTFAMLLILVAIADSQPHYWLSVVLADIAHLLGR* |
| Ga0119894_10012941 | 3300013793 | Wastewater | MRTLATLLILVAIAASQPHHWLAVLMAAIAHCIGK* |
| Ga0075358_11183021 | 3300014303 | Natural And Restored Wetlands | MRTYAFLLILIAIAASQPHQWLLVVMAFIARILGA* |
| Ga0075317_11133531 | 3300014309 | Natural And Restored Wetlands | MIMRTFATLLILVAIAASQPHHWLSVILAAIAHMVGK* |
| Ga0075317_11873861 | 3300014309 | Natural And Restored Wetlands | MRTFALLLILVAIAASQPHHWLSVVLATITHLLGR* |
| Ga0180060_10610832 | 3300014863 | Soil | MRTFALLLVLVAIAASQPHHWLSVIVTAIAHILGM* |
| Ga0180088_11009552 | 3300014868 | Soil | MRTFALLLILVAIAASQPHHWLAVIVAAIAHILGM* |
| Ga0180063_10221922 | 3300014885 | Soil | MRTFALLLILVAIAASQPHHWLSVIVAAITHCMGR* |
| Ga0163144_100508598 | 3300015360 | Freshwater Microbial Mat | MRTLAMLLTLVAIAASQPNHWLSVVMASIAHLLGR* |
| Ga0184615_100571943 | 3300018059 | Groundwater Sediment | MRTFALLLILVAIAASQPHHWLAVILAAIAHILGR |
| Ga0190269_114223742 | 3300018465 | Soil | MRTFALLLILVAIAASQPHQWLILMLQSILHCISS |
| Ga0207193_10644332 | 3300020048 | Freshwater Lake Sediment | MRTLAMLLILVAIAASQPHQWLSVVMASIAHLLGR |
| Ga0194120_1001781813 | 3300020198 | Freshwater Lake | MRTLATLLILVAIAASQPHHWLAVVMAAIANCMGN |
| Ga0194120_104614952 | 3300020198 | Freshwater Lake | MRTFAMLLILVAIAASQPHYWLTVIMVAIARCIGR |
| Ga0163152_1000779712 | 3300020213 | Freshwater Microbial Mat | MRTLAMLLTLVAIAASQPNHWLSVVMASIAHLLGR |
| Ga0226835_100004480 | 3300021604 | Anaerobic Bioreactor Biomass | MRTLAWLLILVALAASQPQHWLGSFLAALAHLLGA |
| Ga0226835_100013075 | 3300021604 | Anaerobic Bioreactor Biomass | MRTFAWLLILVAIAVSQPHHWLGSFLATLAHLLGA |
| Ga0212093_1000167154 | 3300022554 | Hot Spring Sediment | MRTFAMLLILVAIAASRRSRSVFLRGQPHHWLTVLMAAIAHCIGK |
| Ga0210022_10042598 | 3300025017 | Aquifer | MRTLAAFLVLIAIAASQPHHWLGIALAALAHCLGG |
| Ga0209835_10082352 | 3300025115 | Anoxic Lake Water | MKTLAFLLILVAIAASQPHHWLSVVLAAIAHYLGN |
| Ga0210058_11589222 | 3300025124 | Aquifer | MIMRTLAAFLVLIAIAASQPHHWLGIALAALAHCLGG |
| Ga0209381_11543102 | 3300025161 | Hot Spring Sediment | MRTLAILLILVAIAASQPHHWLSVILAAIAHLLGR |
| Ga0209172_10000016186 | 3300025310 | Hot Spring Sediment | MRTFAMLLILVAIAASQPHHWLTVLMAAIVRCIGK |
| Ga0209172_100163423 | 3300025310 | Hot Spring Sediment | MRTLAILLILVAIAASQPHHWLAVLMAAIAHCICR |
| Ga0208244_1063442 | 3300025525 | Serpentinite Rock And Fluid | MRTFAMLLILVAIAASQPHHWLAVLMAAIARCIGR |
| Ga0209204_100089615 | 3300025631 | Anaerobic Digestor Sludge | MRTFAWLLILVAIAASQPQHWLGNFLAVLARLLGG |
| Ga0209204_100090533 | 3300025631 | Anaerobic Digestor Sludge | MRTLALILILVAIAASQPYHWLGSFLADLAHLLGA |
| Ga0209204_10068826 | 3300025631 | Anaerobic Digestor Sludge | MRTYAWLLILVAIAASQPQHWLGSFLAALARLLGE |
| Ga0209200_13039122 | 3300025784 | Anaerobic Digestor Sludge | MRTFAMLLILVAIAASQPHHWLAVLMAAIASCIGR |
| Ga0208139_10023862 | 3300025982 | Rice Paddy Soil | MRTLALLLILVAIAASQPHHLLLAVMAAIARLSGM |
| Ga0207999_10188062 | 3300026010 | Rice Paddy Soil | MRTLALLLILVAIAASQPHHLLLALMAAIARLSGM |
| Ga0209939_10004428 | 3300026135 | Soil | MRTYAFILILVAIAASQPHHWLSAVMTAITHCMGR |
| Ga0209053_10221222 | 3300026282 | Wastewater Treatment | MRTFAMLLILVAIAASQPHHWLTVLMAAIARCIGR |
| Ga0209573_10011396 | 3300026516 | Wastewater Treatment | MRTFAVLLILVAIAASQPHHWLAVCMAAIAHCLGR |
| Ga0209063_10735242 | 3300027705 | Activated Sludge | MRTFAMLLILVAIAASQPNYWLSVVMASIAHLLGR |
| Ga0209819_100690822 | 3300027722 | Freshwater Sediment | MRTLALILILVAIAASQPHHWFLTVMTSLTHCLGS |
| Ga0209277_100097156 | 3300027776 | Wastewater Effluent | MRTLAFLLILVAIAASQPNYWLSVVMASIAHLLGR |
| Ga0209277_100529052 | 3300027776 | Wastewater Effluent | MIMRTFALLLILVAIAASQPHHWLSEIMAAIARCIGK |
| Ga0209812_103258312 | 3300027786 | Wastewater Effluent | MRTLAFLLILVAIAASQPNHWLSVVMASIAHLLGR |
| Ga0209514_1000117419 | 3300027819 | Groundwater | MSILAMLLILVAVAASQPYHWFSLVMASIAHCLGG |
| Ga0209591_103772512 | 3300027850 | Freshwater | MRTLAMLLILVAIAASQPNHWLSVVMASIAHLLGR |
| Ga0209066_100145755 | 3300027851 | Watersheds | MRTFALLLILVAIAASQPHHWLSVIMVAIIRRIGK |
| Ga0209066_100200336 | 3300027851 | Watersheds | MRTFAMLLILVAIAASQPHHWLTVLMAAIAHCIGK |
| Ga0209450_112947041 | 3300027885 | Freshwater Lake Sediment | MRTFALLLILVAIAASQPHHWLSVVLAAIAHLLGR |
| Ga0209496_103386152 | 3300027890 | Wetland | MRTLAMLLILVAIAASQPHHWLTVIMVAIAHCIGK |
| Ga0268298_1000073038 | 3300028804 | Activated Sludge | MRTFAMLLILVAIAASQPHHWLSAIMAAIARCIGR |
| Ga0268298_100034082 | 3300028804 | Activated Sludge | MRTFAILLILVAIAASQPHHWLTVVLAASAQCMGH |
| Ga0268298_100447724 | 3300028804 | Activated Sludge | MRTLAMLLILVAIAASQPYHWLSVVMASIARLLGR |
| Ga0268298_100941482 | 3300028804 | Activated Sludge | MRTFAMLLILVAIAASQPHHWLAVLMAAIAHCIGR |
| Ga0268298_102782602 | 3300028804 | Activated Sludge | MRTFAMLLILVAIAASQPHHWLTVIMVAIAHCIGK |
| Ga0268298_104961072 | 3300028804 | Activated Sludge | IMRTFATLLILVAIAASQPHHWLTVLMAAIAHCIGR |
| Ga0246236_10102273 | 3300029893 | Fracture Fluid | MRTLAMLLILVAIAASQPHHWLAVLMAAIAHCMGT |
| Ga0246236_10134622 | 3300029893 | Fracture Fluid | MRTFAMLLILVAIAASQPHHWLTVLMAVIARCIGR |
| Ga0311336_104912472 | 3300029990 | Fen | MRTLAMLLILVAIAASQPNHWLSVVMASIAHFLGR |
| Ga0311364_117025092 | 3300031521 | Fen | MRTLTFMLILVAIAASQPHHWLSVIMATLVHFLGA |
| Ga0302322_1022049302 | 3300031902 | Fen | MRTFALLLVLVAIAASQPQHWLSLIVAAIAHILGR |
| Ga0315295_106925522 | 3300032156 | Sediment | MRTLAMLLILVAIAASQPYHWLSVVMASIAHTLGR |
| Ga0315268_1000008519 | 3300032173 | Sediment | MRTLAMLLILVAVAVSQPYHWLSVAMASIAHCLGR |
| Ga0315268_101755762 | 3300032173 | Sediment | MRTLAMLLILVAIAASQPNHWLSVVMASIAHILGR |
| Ga0315268_105841332 | 3300032173 | Sediment | MRTIALLLILVAIAASQPFYWLGSFLALLTHLLNG |
| Ga0315268_106509152 | 3300032173 | Sediment | MRTYAFILILIAIAASQPHHWLLLVMAFIARTLGV |
| Ga0315268_123475972 | 3300032173 | Sediment | MRTFAMLLILVAIAASQPHHWLSVVMAAIAHLLGR |
| Ga0334722_103142081 | 3300033233 | Sediment | MRTLAMLLFLTAIAASQPHTWLTALMAFLARMPGG |
| Ga0316625_1003337761 | 3300033418 | Soil | ERSPIMRTYAFILILIAIAASQPHHWLLVVITFIARTLGV |
| Ga0316621_102899292 | 3300033488 | Soil | MRTLATLLILVAIAASQPHHWLSVVMATIAHILGR |
| Ga0316621_106634632 | 3300033488 | Soil | MRTLAFLLILVAIAASQPHHWLSVVMAAIAHLLGR |
| Ga0316616_1029149102 | 3300033521 | Soil | MRTYAFILILIAIAASQPHHWLLVVMAFIARILGV |
| Ga0316616_1037030252 | 3300033521 | Soil | MRTFALLLILVAIAASQPHHWLAIIMAAIARCMGR |
| Ga0370490_0077178_482_589 | 3300034128 | Untreated Peat Soil | MRTFALFLVLIAIAASQPHHWLTALMAFIARTLGV |
| Ga0370506_098957_240_347 | 3300034157 | Untreated Peat Soil | MRTLAMLLILVAIAASQPNHWLSVVMASVAHLLGR |
| Ga0370507_0188310_468_575 | 3300034158 | Untreated Peat Soil | MRTYALLLILIAIAASQPHHWLLVVMEFIARILGV |
| ⦗Top⦘ |