NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300029893

3300029893: Fracture fluid microbial communities from borehole on the 26 level of Beatrix Gold Mine, Welkom, South Africa - Be326_2012_MF



Overview

Basic Information
IMG/M Taxon OID3300029893 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0133327 | Gp0288271 | Ga0246236
Sample NameFracture fluid microbial communities from borehole on the 26 level of Beatrix Gold Mine, Welkom, South Africa - Be326_2012_MF
Sequencing StatusPermanent Draft
Sequencing CenterPrinceton University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size178112486
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria3
Not Available2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2
All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → Fibrobacteria → unclassified Fibrobacteria → Fibrobacteria bacterium GUT311

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFracture Fluid Microbial Communities From Borehole On The 26 Level Of Beatrix Gold Mine, Welkom, South Africa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracture Fluid → Fracture Fluid Microbial Communities From Borehole On The 26 Level Of Beatrix Gold Mine, Welkom, South Africa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)terrestrial biome → borehole → fracking liquid
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationSouth Africa: Welkom
CoordinatesLat. (o)-28.232288Long. (o)26.794365Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000388Metagenome / Metatranscriptome1201Y
F015419Metagenome / Metatranscriptome255Y
F016728Metagenome / Metatranscriptome245Y
F039988Metagenome162N
F043249Metagenome / Metatranscriptome156Y
F048673Metagenome / Metatranscriptome148Y
F062883Metagenome130Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0246236_1000056All Organisms → cellular organisms → Bacteria143041Open in IMG/M
Ga0246236_1003070All Organisms → cellular organisms → Bacteria6514Open in IMG/M
Ga0246236_1003237Not Available6178Open in IMG/M
Ga0246236_1010227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2115Open in IMG/M
Ga0246236_1010296All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → Fibrobacteria → unclassified Fibrobacteria → Fibrobacteria bacterium GUT312099Open in IMG/M
Ga0246236_1012757All Organisms → cellular organisms → Bacteria1723Open in IMG/M
Ga0246236_1013462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1642Open in IMG/M
Ga0246236_1042643Not Available644Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0246236_1000056Ga0246236_10000562F043249MPKIVGTRERIHQPFYDSLVRVDGSTDLRVTPVNGFGALTARTQLFVRQGADQSISNLSTGGFFPSDQTFVVLAVRVWTYFRFNLEGIANVTPAQVSDRVMRVHKLYHQAENQLFWELSAGDKPQLVTFTAYTPFAGGLDGFFADSRLPRANNGVPTSAALMRLARPILIPPRQGFKVIAVASAIGAGAGTSFIDQVNGVDENGANNPDDITKDVKYLIDGIHSRDVL
Ga0246236_1003070Ga0246236_10030705F039988MYFLLCNFYCFIMKVLKCRLENYNDRKDGTVSVKLDSLLEVKDSDIAEIRGLRGNIAIVAITDVVDVLLADVKVSDILEHMPEDPFKDTKLTPSQQQRRDLYVIQKMQLGRKPTKEEQAKFYIERMRKLHEQNLEEISELEGGII
Ga0246236_1003237Ga0246236_100323716F015419MEYKVQITDEAGNVQQYVVSRSSSSEDKSLNDFILEALRISEDKRKLPLKIQCPNGLEVYPKLKMKFKNFGNPLLEDELESLHITW
Ga0246236_1010227Ga0246236_10102273F048673MRTLAMLLILVAIAASQPHHWLAVLMAAIAHCMGT
Ga0246236_1010296Ga0246236_10102963F016728VCVTCVWAGVDSLWEQEKLEARKMLENAAESHTSGARFVGKPFDLED
Ga0246236_1012757Ga0246236_10127573F000388MKVIKVTREYFETEDEKVYFFEPLEKEISVEDMQKIVDANEKLVKELKDNEHC
Ga0246236_1013462Ga0246236_10134622F048673MRTFAMLLILVAIAASQPHHWLTVLMAVIARCIGR
Ga0246236_1042643Ga0246236_10426432F062883IELWSKVKAKATLERKTMREAIFEGLRWYITPREAPTTSQKKKGKKKG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.