Protein Family IF14295
Metagenome
Isolate
153
Members
57
Samples
127
Scaffolds
285.48
Avg Length
Representative Sequence
- ID
- iso_pu_archaea|2773857687|2774160642|
- Length
- 325 aa
- Sequence
- MSTESENGKKSQSLSLFLGCVAPNRYPGIELASRQVMKDLGVDLHELEGASCCPAPGVFKSFDKTAWLTMASRNIVLSERMGMDLLTVCNGCYGSLGEANLTLMHDPGCKDKVNKNLSEVGLEYKGSAKVRHIIEFLEKDIGPQAIKDKVTVPLDGIKVAVHYGCHMIRPSKEKEGLGSAENPRFFDALVDATGAKSVDYEEKMMCCGAGGGARSAFLATTLKMTEKKLVVLQKDGFDCIVDACPFCHLQFDSGQIQLNKEGKDYRIPVLHYSQLLGLAFGYSPKELGIQMNMTTNPAFEEKITALQEKAKEKAQDKAQEKAKEA
Sample Types
Isolate
16.3%
Metagenome
83.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.4%
Unclassified
32.1%
Passalidae
5.4%
Termopsidae
5.4%
Rhinotermitidae
3.6%
Blattidae
3.6%
Kalotermitidae
1.8%
Kiwaidae
1.8%
Taxonomy
Archaea
106
Bacteria
17
Eukaryota
0
Viruses
0
Unclassified
30
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 2 | 2773857682 | Unclassified Methanosarcinaceae Lab288P3bin112 | Isolate | Unclassified |
| 3 | 2773857688 | Unclassified Methanomassiliicoccaceae Nt197P3bin45 | Isolate | Unclassified |
| 4 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 5 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 6 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 2773857689 | Unclassified Methanomassiliicoccaceae Nt197P3bin8 | Isolate | Unclassified |
| 13 | 2756170388 | Methanimicrococcus blatticola DSM 13328 | Isolate | Blattidae |
| 14 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 15 | 2773857677 | Methanoplasma sp. Cu122P5bin30 | Isolate | Unclassified |
| 16 | 2773857685 | Unclassified Methanomassiliicoccaceae Lab288P1bin1 | Isolate | Unclassified |
| 17 | 2773857686 | Unclassified Methanomassiliicoccaceae Lab288P4bin70 | Isolate | Unclassified |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 2773857678 | Unclassified Methanomassiliicoccaceae Co191P4bin17 | Isolate | Unclassified |
| 22 | 2773857680 | Unclassified Methanomassiliicoccaceae Emb289P3bin41 | Isolate | Unclassified |
| 23 | 2608642196 | Candidatus Methanoplasma termitum MpT1 | Isolate | Unclassified |
| 24 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 25 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 26 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 29 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 2773857684 | Unclassified Methanomassiliicoccaceae Lab288P3bin64 | Isolate | Unclassified |
| 32 | 2773857687 | Unclassified Methanosarcinaceae Lab288P3bin190 | Isolate | Unclassified |
| 33 | 2773857690 | Unclassified Methanomassiliicoccaceae Nt197P4bin30 | Isolate | Unclassified |
| 34 | 2773857692 | Unclassified Methanomassiliicoccaceae Th196P3bin2 | Isolate | Unclassified |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 37 | 2773857695 | Unclassified Methanosarcinaceae Th196P4bin37 | Isolate | Unclassified |
| 38 | 2773857696 | Unclassified Methanomassiliicoccaceae Th196P4bin4 | Isolate | Unclassified |
| 39 | 2773857697 | Unclassified Methanomassiliicoccaceae Th196P4bin34 | Isolate | Unclassified |
| 40 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 41 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 44 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 45 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 46 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 47 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 48 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 49 | 2773857681 | Unclassified Methanomassiliicoccaceae Lab288P1bin114 | Isolate | Unclassified |
| 50 | 2698536704 | Methanimicrococcus blatticola PA | Isolate | Blattidae |
| 51 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 52 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 53 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 54 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 55 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 56 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 57 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_231000 | 3300042611 | Archaea | 3083 |
| 2 | Ga0123357_10004075 | 3300009784 | Archaea | 17022 |
| 3 | Ga0123356_10531994 | 3300010049 | Archaea | 1335 |
| 4 | Ga0123353_10004238 | 3300010167 | Unclassified | 18414 |
| 5 | Ga0123353_10024769 | 3300010167 | Unclassified | 9120 |
| 6 | Ga0123353_10084823 | 3300010167 | Archaea | 5100 |
| 7 | Ga0123354_10141658 | 3300010882 | Archaea | 2970 |
| 8 | Ga0466657_170459 | 3300042582 | Archaea | 6071 |
| 9 | 2226985925 | 2225789003 | Unclassified | 8260 |
| 10 | JGI24702J35022_10019831 | 3300002462 | Archaea | 3657 |
| 11 | Ga0466700_201414 | 3300042600 | Archaea | 3168 |
| 12 | Ga0466698_143076 | 3300042610 | Archaea | 2070 |
| 13 | Ga0466729_248535 | 3300042621 | Archaea | 25237 |
| 14 | Ga0466731_322645 | 3300042622 | Archaea | 2449 |
| 15 | Ga0466734_123284 | 3300042623 | Archaea | 24136 |
| 16 | Ga0466727_343392 | 3300042655 | Bacteria | 9154 |
| 17 | Ga0123353_10275757 | 3300010167 | Archaea | 2587 |
| 18 | Ga0123353_10556410 | 3300010167 | Unclassified | 1653 |
| 19 | Ga0466656_144517 | 3300042550 | Unclassified | 7112 |
| 20 | IMNBL1DRAFT_c0000370 | 3300000062 | Unclassified | 38322 |
| 21 | JGI24695J34938_10067124 | 3300002450 | Unclassified | 1510 |
| 22 | JGI24702J35022_10000196 | 3300002462 | Archaea | 32680 |
| 23 | JGI24702J35022_10004393 | 3300002462 | Bacteria | 8382 |
| 24 | JGI24702J35022_10009949 | 3300002462 | Unclassified | 5329 |
| 25 | Ga0123357_10001507 | 3300009784 | Unclassified | 24790 |
| 26 | Ga0466701_087693 | 3300042598 | Bacteria | 4985 |
| 27 | Ga0466734_156363 | 3300042623 | Archaea | 12689 |
| 28 | Ga0123357_10009861 | 3300009784 | Archaea | 12088 |
| 29 | Ga0123355_10376190 | 3300009826 | Unclassified | 1855 |
| 30 | Ga0123356_10192495 | 3300010049 | Archaea | 2072 |
| 31 | Ga0123353_10000138 | 3300010167 | Unclassified | 88507 |
| 32 | Ga0123353_10002903 | 3300010167 | Archaea | 21470 |
| 33 | Ga0123353_10007998 | 3300010167 | Unclassified | 14384 |
| 34 | Ga0123353_10321901 | 3300010167 | Unclassified | 2346 |
| 35 | Ga0157631_114847 | 3300013007 | Unclassified | 1268 |
| 36 | Ga0466656_172838 | 3300042550 | Archaea | 3116 |
| 37 | Ga0466692_195758 | 3300042591 | Bacteria | 233344 |
| 38 | 2227386343 | 2225789004 | Archaea | 27537 |
| 39 | 2227414119 | 2225789004 | Archaea | 26675 |
| 40 | 2227562957 | 2225789004 | Archaea | 2700 |
| 41 | IMNBL1DRAFT_c0012090 | 3300000062 | Unclassified | 3973 |
| 42 | JGI24702J35022_10001283 | 3300002462 | Bacteria | 15645 |
| 43 | JGI24705J35276_12131076 | 3300002504 | Archaea | 1105 |
| 44 | JGI24705J35276_12228751 | 3300002504 | Archaea | 3250 |
| 45 | JGI24705J35276_12233205 | 3300002504 | Archaea | 4709 |
| 46 | Ga0466710_106336 | 3300042613 | Archaea | 4932 |
| 47 | Ga0466718_106575 | 3300042617 | Unclassified | 21457 |
| 48 | Ga0466700_445383 | 3300042600 | Archaea | 6040 |
| 49 | Ga0466707_185769 | 3300042601 | Archaea | 141403 |
| 50 | Ga0466725_427252 | 3300042654 | Bacteria | 1435 |
| 51 | Ga0123356_10081324 | 3300010049 | Bacteria | 3065 |
| 52 | Ga0123356_10469060 | 3300010049 | Archaea | 1410 |
| 53 | Ga0123353_10409000 | 3300010167 | Archaea | 2016 |
| 54 | Ga0415639_022252 | 3300038395 | Archaea | 15795 |
| 55 | Ga0466693_021015 | 3300042592 | Archaea | 6881 |
| 56 | Ga0466693_111780 | 3300042592 | Archaea | 3328 |
| 57 | 2227164135 | 2225789004 | Archaea | 35368 |
| 58 | Ga0466718_013280 | 3300042617 | Archaea | 38509 |
| 59 | Ga0466701_071314 | 3300042598 | Unclassified | 5484 |
| 60 | Ga0466735_055073 | 3300042624 | Archaea | 1535 |
| 61 | Ga0123357_10004648 | 3300009784 | Bacteria | 16197 |
| 62 | Ga0123357_10020825 | 3300009784 | Archaea | 8771 |
| 63 | Ga0123356_10007219 | 3300010049 | Archaea | 11113 |
| 64 | Ga0466657_033723 | 3300042582 | Archaea | 19306 |
| 65 | Ga0466694_358099 | 3300042594 | Archaea | 2161 |
| 66 | Ga0466701_007181 | 3300042598 | Bacteria | 7910 |
| 67 | 2227072445 | 2225789003 | Archaea | 13018 |
| 68 | 2227441893 | 2225789004 | Archaea | 26176 |
| 69 | IMNBL1DRAFT_c0000128 | 3300000062 | Archaea | 67873 |
| 70 | IMNBL1DRAFT_c0003507 | 3300000062 | Unclassified | 10031 |
| 71 | IMNBL1DRAFT_c0012364 | 3300000062 | Archaea | 3907 |
| 72 | IMNBL1DRAFT_c0020724 | 3300000062 | Unclassified | 2652 |
| 73 | JGI24695J34938_10032617 | 3300002450 | Unclassified | 2405 |
| 74 | JGI24696J40584_12960910 | 3300002834 | Unclassified | 9217 |
| 75 | Ga0105524_101220 | 3300007733 | Bacteria | 8691 |
| 76 | Ga0466701_031545 | 3300042598 | Archaea | 1946 |
| 77 | Ga0466701_060969 | 3300042598 | Archaea | 3030 |
| 78 | Ga0466731_096068 | 3300042622 | Bacteria | 2457 |
| 79 | Ga0466734_044844 | 3300042623 | Archaea | 5553 |
| 80 | Ga0466734_145788 | 3300042623 | Archaea | 10907 |
| 81 | Ga0466730_068863 | 3300042625 | Archaea | 2333 |
| 82 | Ga0466697_075214 | 3300042611 | Bacteria | 5850 |
| 83 | Ga0466733_106557 | 3300042659 | Unclassified | 34236 |
| 84 | Ga0123357_10014698 | 3300009784 | Archaea | 10229 |
| 85 | Ga0123357_10066739 | 3300009784 | Archaea | 4796 |
| 86 | Ga0123356_10414289 | 3300010049 | Archaea | 1488 |
| 87 | Ga0123353_10059506 | 3300010167 | Bacteria | 6126 |
| 88 | Ga0123354_10032538 | 3300010882 | Unclassified | 8172 |
| 89 | Ga0157631_101315 | 3300013007 | Bacteria | 9525 |
| 90 | Ga0466657_234262 | 3300042582 | Archaea | 15923 |
| 91 | 2227563507 | 2225789004 | Archaea | 52337 |
| 92 | IMNBL1DRAFT_c0000001 | 3300000062 | Archaea | 477011 |
| 93 | IMNBL1DRAFT_c0002297 | 3300000062 | Archaea | 13430 |
| 94 | IMNBL1DRAFT_c0011209 | 3300000062 | Unclassified | 4207 |
| 95 | Ga0123357_10000175 | 3300009784 | Archaea | 58887 |
| 96 | Ga0466710_121025 | 3300042613 | Archaea | 3753 |
| 97 | Ga0466701_038802 | 3300042598 | Archaea | 2481 |
| 98 | Ga0466734_127851 | 3300042623 | Archaea | 3425 |
| 99 | Ga0466735_034478 | 3300042624 | Archaea | 14875 |
| 100 | Ga0123356_10003706 | 3300010049 | Archaea | 15915 |
| 101 | Ga0123353_10006276 | 3300010167 | Unclassified | 15799 |
| 102 | Ga0123354_10094882 | 3300010882 | Archaea | 4087 |
| 103 | Ga0123354_10332904 | 3300010882 | Archaea | 1381 |
| 104 | Ga0466657_161958 | 3300042582 | Unclassified | 9968 |
| 105 | 2227441895 | 2225789004 | Unclassified | 26074 |
| 106 | IMNBL1DRAFT_c0000133 | 3300000062 | Archaea | 66352 |
| 107 | IMNBL1DRAFT_c0003462 | 3300000062 | Archaea | 10133 |
| 108 | Ga0105524_101332 | 3300007733 | Bacteria | 7449 |
| 109 | Ga0466714_143356 | 3300042603 | Archaea | 3618 |
| 110 | Ga0123356_10063998 | 3300010049 | Archaea | 3438 |
| 111 | Ga0123356_10240574 | 3300010049 | Unclassified | 1881 |
| 112 | Ga0123353_10004040 | 3300010167 | Archaea | 18802 |
| 113 | Ga0123353_11155260 | 3300010167 | Archaea | 1021 |
| 114 | Ga0123354_10012866 | 3300010882 | Archaea | 12959 |
| 115 | Ga0123354_10013311 | 3300010882 | Archaea | 12755 |
| 116 | 2227302994 | 2225789004 | Archaea | 29878 |
| 117 | 2227588507 | 2225789004 | Unclassified | 13044 |
| 118 | IMNBL1DRAFT_c0003495 | 3300000062 | Unclassified | 10062 |
| 119 | JGI24696J40584_12958568 | 3300002834 | Archaea | 4233 |
| 120 | Ga0466726_278304 | 3300042619 | Archaea | 23874 |
| 121 | Ga0466701_070950 | 3300042598 | Bacteria | 10414 |
| 122 | Ga0466707_183549 | 3300042601 | Archaea | 16735 |
| 123 | Ga0466698_176222 | 3300042610 | Archaea | 1747 |
| 124 | Ga0466697_045288 | 3300042611 | Archaea | 10732 |
| 125 | Ga0466697_049645 | 3300042611 | Archaea | 1298 |
| 126 | Ga0466734_100150 | 3300042623 | Archaea | 1621 |
| 127 | Ga0466703_166772 | 3300042636 | Archaea | 23135 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02754 | CCG | Cysteine-rich domain | 159 | 252 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.