Protein Family IF13949
Metagenome
Isolate
246
Members
98
Samples
199
Scaffolds
375.72
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|8065497608|8065499733|
- Length
- 375 aa
- Sequence
- MLFNVYPLYDIEPVKAQGSYLWDTKGDRYLDLYGGHAVISVGHTHPHYVAALTDQLSKISFYSNSVKVSMQEELATKLGALSGYTDYALFLCNSGAEANENALKLASFHNGRTKVVSFKKSFHGRTAGAVAVTDNPAIVAPINYNEHVTFLPYNDVEAAQNGITDETCAVIVEGIQGVGGINVASDEFLQALRRRCDETGAILILDSVQCGYGRSGQFFSHQFSGIDPDLITMAKGMGNGFPIGGVLISPKFKATYGMLGTTFGGNHLACRAAIAVLDIMKEESLIDNAAKVGEHLMKGIEQIGGYKELRGRGLMIGIEYDFPVETLRNSLLFDHHIFTGVAGKHTLRLLPSLALRIEEADVFLEALSKEVKVVS
Sample Types
Isolate
19.1%
Metagenome
80.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
33.3%
Termitidae
22.6%
Kalotermitidae
15.1%
Unclassified
7.5%
Rhinotermitidae
5.4%
Termopsidae
4.3%
Passalidae
3.2%
Apidae
2.2%
Hydrophilidae
2.2%
Hodotermitidae
1.1%
Elmidae
1.1%
Bombycidae
1.1%
Tenebrionidae
1.1%
Taxonomy
Archaea
0
Bacteria
244
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 2 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 3 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 4 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 5 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 6 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 7 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 16 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 23 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 24 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 25 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 26 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 27 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 28 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 36 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 39 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 42 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 43 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 44 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 45 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 46 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 47 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 48 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 49 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 50 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 51 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 52 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 53 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 54 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 55 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 56 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 57 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 58 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 59 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 60 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 61 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 62 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 63 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 64 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 65 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 66 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 67 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 68 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 69 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 70 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 71 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 72 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 73 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 74 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 75 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 76 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 77 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 78 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 79 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 80 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 81 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 82 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 83 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 84 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 85 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 86 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 87 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 88 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 89 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 90 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 91 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 92 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 93 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 94 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 95 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 96 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 97 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 98 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_061316 | 3300042659 | Bacteria | 145079 |
| 2 | Ga0466733_210265 | 3300042659 | Bacteria | 1699 |
| 3 | Ga0466705_448736 | 3300042612 | Bacteria | 6019 |
| 4 | Ga0466711_006554 | 3300042615 | Bacteria | 9234 |
| 5 | Ga0466711_137330 | 3300042615 | Bacteria | 35994 |
| 6 | Ga0466656_311475 | 3300042550 | Bacteria | 2351 |
| 7 | Ga0466693_175882 | 3300042592 | Bacteria | 1816 |
| 8 | Ga0466696_028061 | 3300042596 | Bacteria | 36603 |
| 9 | Ga0466696_186658 | 3300042596 | Bacteria | 14592 |
| 10 | Ga0466706_110068 | 3300042599 | Bacteria | 33466 |
| 11 | Ga0466706_169288 | 3300042599 | Bacteria | 28222 |
| 12 | Ga0466706_187394 | 3300042599 | Bacteria | 4318 |
| 13 | Ga0466713_035202 | 3300042602 | Bacteria | 9215 |
| 14 | Ga0466722_169207 | 3300042609 | Bacteria | 3201 |
| 15 | Ga0466722_263608 | 3300042609 | Bacteria | 34147 |
| 16 | Ga0466704_233224 | 3300042643 | Bacteria | 19918 |
| 17 | Ga0466708_014247 | 3300042652 | Bacteria | 21773 |
| 18 | Ga0466708_154124 | 3300042652 | Bacteria | 1823 |
| 19 | Ga0466708_330262 | 3300042652 | Bacteria | 27220 |
| 20 | Ga0466727_190108 | 3300042655 | Bacteria | 14426 |
| 21 | IMNBL1DRAFT_c0040947 | 3300000062 | Bacteria | 1561 |
| 22 | JGI24702J35022_10062011 | 3300002462 | Bacteria | 2001 |
| 23 | Ga0466711_025258 | 3300042615 | Bacteria | 45468 |
| 24 | Ga0466715_149956 | 3300042616 | Bacteria | 15041 |
| 25 | Ga0466715_332096 | 3300042616 | Bacteria | 3103 |
| 26 | Ga0466715_455874 | 3300042616 | Bacteria | 3637 |
| 27 | Ga0466715_613283 | 3300042616 | Bacteria | 7780 |
| 28 | Ga0466723_023805 | 3300042618 | Bacteria | 54844 |
| 29 | Ga0466723_078652 | 3300042618 | Bacteria | 2412 |
| 30 | Ga0466692_052543 | 3300042591 | Unclassified | 1930 |
| 31 | Ga0466691_108850 | 3300042593 | Bacteria | 6164 |
| 32 | Ga0466694_277648 | 3300042594 | Bacteria | 3016 |
| 33 | Ga0123355_10007783 | 3300009826 | Bacteria | 16124 |
| 34 | Ga0466706_091938 | 3300042599 | Bacteria | 5178 |
| 35 | Ga0466706_203302 | 3300042599 | Bacteria | 74431 |
| 36 | Ga0466713_143155 | 3300042602 | Bacteria | 188721 |
| 37 | Ga0466717_135245 | 3300042604 | Bacteria | 2450 |
| 38 | Ga0466716_012780 | 3300042605 | Bacteria | 10330 |
| 39 | Ga0466729_206962 | 3300042621 | Bacteria | 5639 |
| 40 | Ga0466735_059475 | 3300042624 | Bacteria | 3292 |
| 41 | Ga0466735_098762 | 3300042624 | Bacteria | 2308 |
| 42 | Ga0466703_024117 | 3300042636 | Bacteria | 4423 |
| 43 | Ga0466703_046692 | 3300042636 | Bacteria | 10487 |
| 44 | Ga0466703_198032 | 3300042636 | Bacteria | 3979 |
| 45 | Ga0466704_589446 | 3300042643 | Bacteria | 8974 |
| 46 | Ga0466727_080326 | 3300042655 | Bacteria | 10492 |
| 47 | Ga0466733_053401 | 3300042659 | Bacteria | 4199 |
| 48 | Ga0466733_084365 | 3300042659 | Bacteria | 13107 |
| 49 | Ga0466733_135375 | 3300042659 | Bacteria | 4055 |
| 50 | Ga0466715_019255 | 3300042616 | Bacteria | 20255 |
| 51 | Ga0466691_009362 | 3300042593 | Bacteria | 25845 |
| 52 | Ga0466696_183745 | 3300042596 | Bacteria | 2576 |
| 53 | Ga0466713_081773 | 3300042602 | Bacteria | 94516 |
| 54 | Ga0466713_119741 | 3300042602 | Bacteria | 23414 |
| 55 | Ga0466714_010700 | 3300042603 | Bacteria | 109081 |
| 56 | Ga0466716_154470 | 3300042605 | Bacteria | 9230 |
| 57 | Ga0466716_244016 | 3300042605 | Bacteria | 6074 |
| 58 | Ga0466719_516946 | 3300042606 | Bacteria | 3721 |
| 59 | Ga0466719_525073 | 3300042606 | Bacteria | 16045 |
| 60 | Ga0466703_086970 | 3300042636 | Bacteria | 15652 |
| 61 | Ga0466703_122215 | 3300042636 | Bacteria | 2213 |
| 62 | Ga0466704_050220 | 3300042643 | Bacteria | 8094 |
| 63 | Ga0466704_384670 | 3300042643 | Bacteria | 3587 |
| 64 | Ga0466708_016632 | 3300042652 | Bacteria | 33440 |
| 65 | Ga0466708_224946 | 3300042652 | Bacteria | 22929 |
| 66 | Ga0466725_021095 | 3300042654 | Bacteria | 3798 |
| 67 | Ga0466727_108549 | 3300042655 | Bacteria | 17021 |
| 68 | JGI24702J35022_10014193 | 3300002462 | Bacteria | 4397 |
| 69 | JGI24705J35276_12238515 | 3300002504 | Bacteria | 24729 |
| 70 | Ga0466733_123170 | 3300042659 | Bacteria | 64337 |
| 71 | Ga0466715_270340 | 3300042616 | Unclassified | 11644 |
| 72 | Ga0466723_108082 | 3300042618 | Bacteria | 9241 |
| 73 | Ga0466728_278489 | 3300042620 | Bacteria | 5380 |
| 74 | Ga0466728_325649 | 3300042620 | Bacteria | 7234 |
| 75 | Ga0466728_399272 | 3300042620 | Bacteria | 209367 |
| 76 | Ga0466690_177855 | 3300042590 | Bacteria | 9617 |
| 77 | Ga0466706_031307 | 3300042599 | Bacteria | 5508 |
| 78 | Ga0466706_203102 | 3300042599 | Bacteria | 35690 |
| 79 | Ga0466707_160373 | 3300042601 | Bacteria | 6916 |
| 80 | Ga0466713_008449 | 3300042602 | Bacteria | 4908 |
| 81 | Ga0466716_074953 | 3300042605 | Bacteria | 6010 |
| 82 | Ga0466716_245123 | 3300042605 | Bacteria | 2622 |
| 83 | Ga0466716_370868 | 3300042605 | Bacteria | 19469 |
| 84 | Ga0466719_061154 | 3300042606 | Bacteria | 6149 |
| 85 | Ga0466722_043264 | 3300042609 | Bacteria | 4667 |
| 86 | Ga0466731_407173 | 3300042622 | Bacteria | 1235 |
| 87 | Ga0466704_406582 | 3300042643 | Bacteria | 13152 |
| 88 | Ga0466709_011326 | 3300042648 | Bacteria | 23746 |
| 89 | 2226991485 | 2225789003 | Bacteria | 7193 |
| 90 | IMNBL1DRAFT_c0002288 | 3300000062 | Bacteria | 13463 |
| 91 | Ga0068305_10304430 | 3300005083 | Bacteria | 4660 |
| 92 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 93 | Ga0466705_422055 | 3300042612 | Bacteria | 15480 |
| 94 | Ga0466711_480067 | 3300042615 | Bacteria | 1926 |
| 95 | Ga0466715_358298 | 3300042616 | Bacteria | 8462 |
| 96 | Ga0466715_485052 | 3300042616 | Bacteria | 31199 |
| 97 | Ga0466723_028729 | 3300042618 | Bacteria | 46525 |
| 98 | Ga0466723_366064 | 3300042618 | Bacteria | 2316 |
| 99 | Ga0466726_462384 | 3300042619 | Bacteria | 2840 |
| 100 | Ga0466728_016460 | 3300042620 | Bacteria | 9793 |
| 101 | Ga0466692_016162 | 3300042591 | Bacteria | 24466 |
| 102 | Ga0466696_037357 | 3300042596 | Bacteria | 3080 |
| 103 | Ga0466699_342042 | 3300042597 | Bacteria | 2579 |
| 104 | Ga0123353_10561871 | 3300010167 | Bacteria | 1643 |
| 105 | Ga0123353_10788391 | 3300010167 | Bacteria | 1315 |
| 106 | Ga0466706_025187 | 3300042599 | Bacteria | 51793 |
| 107 | Ga0466716_411427 | 3300042605 | Bacteria | 2179 |
| 108 | Ga0466719_176856 | 3300042606 | Bacteria | 5125 |
| 109 | Ga0466722_033577 | 3300042609 | Bacteria | 6386 |
| 110 | Ga0466703_097578 | 3300042636 | Bacteria | 6295 |
| 111 | Ga0466709_270482 | 3300042648 | Bacteria | 5513 |
| 112 | Ga0466727_101626 | 3300042655 | Bacteria | 3487 |
| 113 | Ga0466727_249898 | 3300042655 | Bacteria | 3004 |
| 114 | Ga0072941_1313972 | 3300005201 | Bacteria | 2265 |
| 115 | Ga0466705_236020 | 3300042612 | Bacteria | 47478 |
| 116 | Ga0466705_317509 | 3300042612 | Bacteria | 8974 |
| 117 | Ga0466705_319150 | 3300042612 | Bacteria | 11105 |
| 118 | Ga0466711_111925 | 3300042615 | Bacteria | 13247 |
| 119 | Ga0466715_170026 | 3300042616 | Bacteria | 29950 |
| 120 | Ga0466718_129949 | 3300042617 | Bacteria | 1472 |
| 121 | Ga0466726_081284 | 3300042619 | Bacteria | 1883 |
| 122 | Ga0466728_059095 | 3300042620 | Bacteria | 40129 |
| 123 | Ga0466656_071707 | 3300042550 | Bacteria | 2419 |
| 124 | Ga0123355_10196571 | 3300009826 | Bacteria | 2956 |
| 125 | Ga0123353_10212114 | 3300010167 | Bacteria | 3036 |
| 126 | Ga0466713_041042 | 3300042602 | Bacteria | 19187 |
| 127 | Ga0466713_047004 | 3300042602 | Bacteria | 5910 |
| 128 | Ga0466713_048535 | 3300042602 | Bacteria | 16951 |
| 129 | Ga0466714_082006 | 3300042603 | Bacteria | 191145 |
| 130 | Ga0466729_291406 | 3300042621 | Bacteria | 1771 |
| 131 | Ga0466735_023729 | 3300042624 | Bacteria | 7648 |
| 132 | Ga0466735_221859 | 3300042624 | Bacteria | 3793 |
| 133 | Ga0466703_050871 | 3300042636 | Bacteria | 2778 |
| 134 | Ga0466703_087213 | 3300042636 | Bacteria | 7693 |
| 135 | Ga0466703_103094 | 3300042636 | Bacteria | 14416 |
| 136 | Ga0466709_092167 | 3300042648 | Bacteria | 4550 |
| 137 | Ga0466724_26359 | 3300042649 | Bacteria | 8789 |
| 138 | Ga0466725_004387 | 3300042654 | Bacteria | 1523 |
| 139 | 2227230799 | 2225789004 | Bacteria | 7362 |
| 140 | JGI24702J35022_10000190 | 3300002462 | Bacteria | 32930 |
| 141 | Ga0068305_10054066 | 3300005083 | Bacteria | 9316 |
| 142 | Ga0466697_057024 | 3300042611 | Bacteria | 4695 |
| 143 | Ga0466733_024711 | 3300042659 | Bacteria | 63451 |
| 144 | Ga0466705_497927 | 3300042612 | Bacteria | 2266 |
| 145 | Ga0466711_161163 | 3300042615 | Bacteria | 17839 |
| 146 | Ga0466726_100246 | 3300042619 | Bacteria | 3005 |
| 147 | Ga0466728_024229 | 3300042620 | Bacteria | 24563 |
| 148 | Ga0466690_180282 | 3300042590 | Bacteria | 25954 |
| 149 | Ga0466690_336420 | 3300042590 | Bacteria | 10674 |
| 150 | Ga0466693_373583 | 3300042592 | Bacteria | 2036 |
| 151 | Ga0466691_150789 | 3300042593 | Bacteria | 10260 |
| 152 | Ga0466696_163360 | 3300042596 | Bacteria | 29150 |
| 153 | Ga0123353_10162835 | 3300010167 | Bacteria | 3550 |
| 154 | Ga0466701_074493 | 3300042598 | Bacteria | 3597 |
| 155 | Ga0466707_012653 | 3300042601 | Bacteria | 5114 |
| 156 | Ga0466707_022305 | 3300042601 | Bacteria | 2445 |
| 157 | Ga0466707_331024 | 3300042601 | Bacteria | 15223 |
| 158 | Ga0466713_058555 | 3300042602 | Bacteria | 16728 |
| 159 | Ga0466716_114092 | 3300042605 | Bacteria | 13384 |
| 160 | Ga0466719_087024 | 3300042606 | Bacteria | 2862 |
| 161 | Ga0466722_208412 | 3300042609 | Bacteria | 6722 |
| 162 | Ga0466730_025713 | 3300042625 | Bacteria | 3722 |
| 163 | Ga0466704_486621 | 3300042643 | Bacteria | 6328 |
| 164 | Ga0466704_584060 | 3300042643 | Bacteria | 9421 |
| 165 | Ga0466725_333563 | 3300042654 | Bacteria | 10015 |
| 166 | 2227560738 | 2225789004 | Bacteria | 14473 |
| 167 | IMNBL1DRAFT_c0000168 | 3300000062 | Bacteria | 58839 |
| 168 | JGI24702J35022_10000615 | 3300002462 | Bacteria | 21682 |
| 169 | JGI24702J35022_10137018 | 3300002462 | Bacteria | 1363 |
| 170 | Ga0068302_10387241 | 3300005071 | Bacteria | 1704 |
| 171 | Ga0068305_10032167 | 3300005083 | Bacteria | 15858 |
| 172 | Ga0466697_225439 | 3300042611 | Bacteria | 1325 |
| 173 | Ga0466733_012253 | 3300042659 | Bacteria | 22612 |
| 174 | Ga0466733_050761 | 3300042659 | Bacteria | 17441 |
| 175 | Ga0466711_514729 | 3300042615 | Bacteria | 3137 |
| 176 | Ga0466726_088502 | 3300042619 | Bacteria | 5659 |
| 177 | Ga0466726_382673 | 3300042619 | Bacteria | 11863 |
| 178 | Ga0466729_051045 | 3300042621 | Bacteria | 12078 |
| 179 | Ga0415639_017098 | 3300038395 | Bacteria | 1236 |
| 180 | Ga0466691_010037 | 3300042593 | Bacteria | 10367 |
| 181 | Ga0466691_060905 | 3300042593 | Bacteria | 24431 |
| 182 | Ga0466696_163519 | 3300042596 | Bacteria | 6387 |
| 183 | Ga0466696_353529 | 3300042596 | Bacteria | 7911 |
| 184 | Ga0123356_10030209 | 3300010049 | Bacteria | 5071 |
| 185 | Ga0466706_177210 | 3300042599 | Bacteria | 1703 |
| 186 | Ga0466707_172209 | 3300042601 | Bacteria | 2142 |
| 187 | Ga0466713_062703 | 3300042602 | Bacteria | 41012 |
| 188 | Ga0466714_077607 | 3300042603 | Bacteria | 5030 |
| 189 | Ga0466722_222321 | 3300042609 | Bacteria | 2985 |
| 190 | Ga0466709_028246 | 3300042648 | Bacteria | 8755 |
| 191 | Ga0466727_049307 | 3300042655 | Bacteria | 7513 |
| 192 | Ga0466727_267683 | 3300042655 | Bacteria | 8892 |
| 193 | 2227549628 | 2225789004 | Bacteria | 15100 |
| 194 | IMNBL1DRAFT_c0005060 | 3300000062 | Bacteria | 7677 |
| 195 | JGI24702J35022_10019767 | 3300002462 | Bacteria | 3663 |
| 196 | JGI24702J35022_10053053 | 3300002462 | Bacteria | 2162 |
| 197 | JGI24699J35502_11134161 | 3300002509 | Bacteria | 40857 |
| 198 | Ga0068305_10011192 | 3300005083 | Bacteria | 12110 |
| 199 | Ga0068305_10754363 | 3300005083 | Bacteria | 1525 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00202 | Aminotran_3 | Aminotransferase class-III | 11 | 369 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.