Protein Family IF13933

Metagenome Isolate
173 Members
138 Samples
75 Scaffolds
296.22 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|8062747827|8062750340|
Length
332 aa
Sequence
MRTWQQSATDVDLALSGLAVVLAWWSNLLSTKESSLMNQTATGTARVKRGMAEMLKGGVIMDVVTPDQARIAEDAGAVAVMALERVPADIRAQGGVSRMSDPDMIDGIIEAVSIPVMAKARIGHFVEAQVLQSLGVDYIDESEVLTPADYANHIDKWQFTVPFVCGANNLGEALRRITEGAAMIRSKGEAGTGDVSNATTHMRQIRQEIRRLQNLPEDELFVAAKGLQAPYELVKEVAELGKLPVVLFTAGGIATPADAAMMMQLGAEGVFVGSGIFKSGNPAERAAAIVKATTFHDDPDVIAKVSRGLGEAMVGINVDDIPVPHRLAERGW

📊 Sample Types

Isolate 56.6%
Metagenome 43.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 27.3%
Termitidae 19.7%
Formicidae 14.4%
Blattidae 6.8%
Kalotermitidae 3.0%
Elmidae 3.0%
Tenebrionidae 3.0%
Scarabaeidae 2.3%
Cambaridae 2.3%
Culicidae 2.3%
Armadillidiidae 2.3%
Termopsidae 1.5%
Apidae 1.5%
Ixodidae 0.8%
Curculionidae 0.8%
Hydrophilidae 0.8%
Cimicidae 0.8%
Pyralidae 0.8%
Passalidae 0.8%
Pentatomidae 0.8%
Thomisidae 0.8%
Hodotermitidae 0.8%
Siricidae 0.8%
Noctuidae 0.8%
Drosophilidae 0.8%
Cerambycidae 0.8%
Reduviidae 0.8%

🌳 Taxonomy

Archaea 1
Bacteria 160
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2821316722 Unclassified Actinobacteria Lab288P1bin78 Isolate Unclassified
2 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
3 2856966858 Pseudonocardia sp. Ae263_Ps1 Isolate Formicidae
4 2862075925 Corynebacterium lactis S064 Isolate Ixodidae
5 2896955351 Streptomyces sp. GF20 Isolate Termitidae
6 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
7 2515154100 Streptomyces sp. MspMP-M5 Isolate Unclassified
8 2515154104 Streptomyces sp. KhCrAH-244 Isolate Unclassified
9 2590828840 Clostridium sp. 2 Isolate Termitidae
10 2675903497 Pseudonocardia sp. EC080610-09 Isolate Formicidae
11 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
14 649989992 Pseudonocardia sp. P1 Isolate Formicidae
15 8053361298 Streptomyces formicae 1H-GS9 Isolate Unclassified
16 8073544309 Actinomadura sp. RB99 Isolate Termitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
19 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
20 2820849606 Unclassified Actinobacteria Lab288P3bin39 Isolate Unclassified
21 2820889385 Unclassified Actinobacteria Lab288P1bin133 Isolate Unclassified
22 2820926697 Unclassified Actinobacteria Emb289P3bin125 Isolate Unclassified
23 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
24 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
25 2505679068 Isoptericola variabilis 225 Isolate Unclassified
26 2671180625 Pseudonocardia sp. EC080619-01 Isolate Formicidae
27 2675903013 Rhodococcus triatomae DSM 44892 Isolate Unclassified
28 2820476618 Unclassified Firmicutes Lab288P1bin80 Isolate Unclassified
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
31 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
32 8062637095 Yimella sp. cx-51 Isolate Cambaridae
33 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
34 8077783556 Streptomyces sp. PLM4 Isolate Formicidae
35 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
36 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
37 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
38 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
39 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
40 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
41 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
42 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
43 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
44 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
45 2900368070 Nocardia aurantia RB56 Isolate Termitidae
46 2912749649 Streptomyces sp. GS7 Isolate Termitidae
47 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
48 2940413413 Paenibacillus sp. PastH-3 Isolate Blattidae
49 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
50 2818991478 Micromonospora palomenae DSM 102131 Isolate Pentatomidae
51 8062747827 Yimella sp. cx-51 Isolate Cambaridae
52 3006461590 Streptomyces sp. RB5 Isolate Termitidae
53 3006667155 Streptomyces sp. SID9727 Isolate
54 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
55 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
56 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
57 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
58 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
59 2859977607 Pseudonocardia sp. Ae707_Ps1 Isolate Formicidae
60 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
61 2900354037 Nocardia macrotermitis RB20 Isolate Termitidae
62 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
63 2504756063 Isoptericola variabilis J5 Isolate Unclassified
64 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
65 2648501322 Streptomyces sp. SA3_actF Isolate Unclassified
66 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
67 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
68 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
69 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
70 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
71 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
72 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
73 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
74 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
75 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
76 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
77 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
78 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
79 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
80 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
81 2856671350 Pseudonocardia sp. Ae356_Ps1 Isolate Formicidae
82 2856947901 Pseudonocardia sp. Ae168_Ps1 Isolate Formicidae
83 2864899338 Mycobacteroides chelonae S00154 Isolate Elmidae
84 2873196663 Streptomyces capitiformicae 1H-SSA4 Isolate Formicidae
85 2908241010 Streptomyces sp. HF10 Isolate Termitidae
86 2912817845 Streptomyces griseus SID164 Isolate
87 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
88 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
89 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
90 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
91 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
92 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
93 3006468911 Streptomyces sp. RB17 Isolate Termitidae
94 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
95 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
96 2820803007 Unclassified Actinobacteria Th196P3bin61 Isolate Unclassified
97 2820842553 Unclassified Actinobacteria Lab288P4bin104 Isolate Unclassified
98 2820929059 Unclassified Actinobacteria Emb289P3bin110 Isolate Unclassified
99 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
100 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
101 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
102 2862784999 Streptomyces sp. M41 Isolate Unclassified
103 2863397684 Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) Isolate Unclassified
104 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
105 2909412500 Yimella sp. cx-573 Isolate Cambaridae
106 2931425734 Nocardioides sp. J2M5 Isolate
107 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
108 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
109 2515154106 Streptomyces sp. FxanaD5 Isolate Unclassified
110 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
111 2718217924 Pseudonocardia sp. HH130630-07 Isolate Formicidae
112 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
113 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
114 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
115 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
116 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
117 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
118 2820863028 Unclassified Actinobacteria Lab288P3bin164 Isolate Unclassified
119 2852016966 Micromonospora polyrhachis DSM 45886 Isolate Unclassified
120 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
121 2523533511 Streptomyces sp. Sv. ACTE SirexAA-E Isolate Siricidae
122 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
123 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
124 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
125 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
126 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
127 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
128 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
129 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
130 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
131 2545824723 Rhodococcus rhodnii LMG 5362 Isolate Reduviidae
132 2547132081 Streptomyces sp. S4 Isolate Formicidae
133 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
134 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
135 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
136 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
137 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
138 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0105005_1014416 3300007505 Bacteria 3742
2 Ga0466734_153413 3300042623 Bacteria 1278
3 Ga0466735_082822 3300042624 Bacteria 1725
4 Ga0466724_36962 3300042649 Bacteria 194212
5 Ga0466705_184144 3300042612 Bacteria 2043
6 Ga0466705_245540 3300042612 Bacteria 8406
7 Ga0562378_0031 3300056814 Bacteria 530809
8 Ga0562378_0051 3300056814 Bacteria 353762
9 Ga0562375_3767 3300056856 Unclassified 13275
10 Ga0123355_10003999 3300009826 Bacteria 21338
11 Ga0123353_10000305 3300010167 Unclassified 61052
12 Ga0123354_10023960 3300010882 Bacteria 9628
13 Ga0466703_068290 3300042636 Bacteria 26944
14 Ga0466725_354586 3300042654 Bacteria 1356
15 Ga0160469_100364 3300012824 Bacteria 24577
16 Ga0160445_101693 3300012847 Bacteria 5855
17 2227477123 2225789004 Bacteria 4598
18 2227580177 2225789004 Bacteria 13433
19 Ga0466713_024505 3300042602 Bacteria 1253
20 Ga0123356_10006054 3300010049 Bacteria 12272
21 Ga0123353_10000582 3300010167 Unclassified 44621
22 Ga0466730_035355 3300042625 Bacteria 1396
23 Ga0466693_249120 3300042592 Bacteria 5725
24 Ga0123357_10008613 3300009784 Bacteria 12765
25 Ga0466710_256256 3300042613 Bacteria 1662
26 Ga0466730_035606 3300042625 Unclassified 2958
27 Ga0466730_087211 3300042625 Bacteria 1337
28 Ga0466704_384191 3300042643 Bacteria 24599
29 Ga0160435_1001031 3300012857 Bacteria 7385
30 Ga0466705_170146 3300042612 Bacteria 4018
31 Ga0562378_0001 3300056814 Bacteria 3579584
32 JGI24703J35330_11550389 3300002501 Unclassified 1225
33 Ga0466707_335480 3300042601 Bacteria 2633
34 Ga0123357_10003855 3300009784 Bacteria 17390
35 Ga0123357_10027971 3300009784 Bacteria 7625
36 Ga0123355_10000640 3300009826 Bacteria 47434
37 Ga0123356_10026243 3300010049 Bacteria 5473
38 Ga0123356_10081746 3300010049 Bacteria 3057
39 Ga0123353_10009462 3300010167 Bacteria 13464
40 Ga0123354_10448742 3300010882 Unclassified 1047
41 Ga0466718_033385 3300042617 Bacteria 11692
42 Ga0466718_055884 3300042617 Bacteria 2221
43 Ga0160456_101609 3300012820 Bacteria 5125
44 Ga0562378_0006 3300056814 Bacteria 1902205
45 Ga0562376_4013 3300056857 Bacteria 13424
46 Ga0466701_067340 3300042598 Bacteria 9194
47 Ga0123357_10188410 3300009784 Unclassified 2386
48 Ga0123355_10004286 3300009826 Bacteria 20738
49 Ga0123355_10009017 3300009826 Bacteria 15120
50 Ga0160454_100140 3300012798 Bacteria 86992
51 Ga0466718_157683 3300042617 Bacteria 1510
52 Ga0160458_103465 3300012832 Bacteria 1988
53 Ga0466656_025163 3300042550 Bacteria 3383
54 Ga0562377_0092 3300056842 Bacteria 331889
55 Ga0562377_1311 3300056842 Unclassified 27170
56 Ga0562375_1158 3300056856 Bacteria 38813
57 JGI24695J34938_10001696 3300002450 Bacteria 18208
58 JGI24695J34938_10006978 3300002450 Bacteria 6696
59 Ga0068302_10067333 3300005071 Bacteria 2705
60 Ga0160466_100045 3300012809 Bacteria 162746
61 Ga0466725_206287 3300042654 Bacteria 1427
62 Ga0160452_101698 3300012834 Unclassified 5834
63 JGI24695J34938_10017190 3300002450 Bacteria 3654
64 Ga0466701_017520 3300042598 Bacteria 1467
65 Ga0466706_076035 3300042599 Bacteria 1410
66 Ga0466707_083762 3300042601 Unclassified 1865
67 Ga0123355_10190159 3300009826 Archaea 3026
68 Ga0123356_10000027 3300010049 Bacteria 165240
69 Ga0123356_10034041 3300010049 Unclassified 4765
70 Ga0123356_10058376 3300010049 Unclassified 3598
71 Ga0466715_026465 3300042616 Bacteria 99999
72 Ga0466735_048391 3300042624 Bacteria 1466
73 Ga0466724_62062 3300042649 Bacteria 4662
74 Ga0466724_62237 3300042649 Bacteria 10420
75 Ga0160470_100245 3300012813 Bacteria 40981

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01680 SOR_SNZ SOR/SNZ family 45 250 0.99
PF05690 ThiG Thiazole biosynthesis protein ThiG 224 293 0.86

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.