Protein Family IF13492
Metagenome
Isolate
430
Members
289
Samples
210
Scaffolds
235.7
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|641736255|641740887|
- Length
- 282 aa
- Sequence
- MGGNNILPVKNAGRFCLIQNYDKIKSMAQRKLPSYRQTGGEERMQRRILVVDDEQPIADILKFNLEKEGYEVICAYDGGTAVELAFSEKPDLILLDLMLPVKDGMDVCREVRGKLNTPIIMLTAKDTEIDKVLGLEMGADDYVTKPFGTRELLARVKAHLRRQIKSEAAPEVAKEEPQGIRLDTLFIDTDMYVVYKDGDPLDLTHREFELIYYLAKHPSKVMTREHLLQAVWGYEYFGDVRTVDVTIRRLREKIETDPSKPEYIVTRRGLGYMMRSGKSGGF
Sample Types
Isolate
50.9%
Metagenome
49.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.3%
Apidae
15.0%
Drosophilidae
10.5%
Termitidae
9.8%
Blattidae
4.1%
Scarabaeidae
3.8%
Kalotermitidae
3.8%
Tenebrionidae
3.4%
Halictidae
3.4%
Elmidae
2.6%
Pyralidae
2.3%
Rhinotermitidae
1.5%
Termopsidae
1.5%
Passalidae
1.1%
Formicidae
1.1%
Bombycidae
1.1%
Culicidae
0.8%
Dytiscidae
0.8%
Noctuidae
0.8%
Armadillidiidae
0.8%
Penaeidae
0.4%
Portunidae
0.4%
Gomphidae
0.4%
Nephropidae
0.4%
Ocypodidae
0.4%
Libellulidae
0.4%
Hydrophilidae
0.4%
Cerambycidae
0.4%
Eresidae
0.4%
Curculionidae
0.4%
Rhaphidophoridae
0.4%
Euphausiidae
0.4%
Calliphoridae
0.4%
Vespidae
0.4%
Hodotermitidae
0.4%
Taxonomy
Archaea
0
Bacteria
400
Eukaryota
0
Viruses
0
Unclassified
30
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 2 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 3 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 4 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 5 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 6 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 7 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 8 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 9 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 10 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 11 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 12 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 13 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 14 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 15 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 16 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 17 | 2758568504 | Lactobacillus bombicola ESL0245 | Isolate | Unclassified |
| 18 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 19 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 20 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 21 | 2820459456 | Unclassified Firmicutes Lab288P3bin148 | Isolate | Unclassified |
| 22 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 23 | 2651870343 | Fructobacillus sp. EFB-N1 | Isolate | Apidae |
| 24 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 25 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 26 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 27 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 28 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 29 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 30 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 33 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 34 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 35 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 36 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 37 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 38 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 39 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 40 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 41 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 42 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 43 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 44 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 45 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 46 | 2758568505 | Lactobacillus bombicola ESL0225 | Isolate | Unclassified |
| 47 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 48 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 49 | 2820249082 | Unclassified Firmicutes Th196P3bin69 | Isolate | Unclassified |
| 50 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 51 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 52 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 53 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 56 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 57 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 58 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 59 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 60 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 61 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 62 | 8012112996 | Staphylococcus muscae ATCC 49910 | Isolate | |
| 63 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 64 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 65 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 66 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 67 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 68 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 69 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 70 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 71 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 72 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 73 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 74 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 75 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 76 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 77 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 78 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 79 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 80 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 81 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 82 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 83 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 84 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 85 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 86 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 87 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 88 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 89 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 90 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 91 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 92 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 93 | 2820252425 | Unclassified Firmicutes Th196P3bin6 | Isolate | Unclassified |
| 94 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 95 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 96 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 97 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 98 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 99 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 100 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 101 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 102 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 103 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 104 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 105 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 106 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 107 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 108 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 109 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 110 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 111 | 3300007088 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 4 gut | Metagenome | Drosophilidae |
| 112 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 113 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 114 | 2834540479 | Leuconostoc citreum DmW_111 | Isolate | Drosophilidae |
| 115 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 116 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 117 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 118 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 119 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 120 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 121 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 122 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 123 | 2675903377 | Apilactobacillus kunkeei AR114 | Isolate | Unclassified |
| 124 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 125 | 2799112229 | Lactobacillus sp. ESL0413 | Isolate | Unclassified |
| 126 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 127 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 128 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 129 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 130 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 131 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 132 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 133 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 134 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 135 | 8017440191 | Lactobacillus bombicola L5-31 | Isolate | Apidae |
| 136 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 137 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 138 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 139 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 140 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 141 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 142 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 143 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 144 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 145 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 146 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 147 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 148 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 149 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 150 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 151 | 2958885890 | Lactobacillus sp. ESL0234 | Isolate | Apidae |
| 152 | 2961465228 | Lactobacillus sp. ESL0233 | Isolate | Apidae |
| 153 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 154 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 155 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 156 | 2756170272 | Convivina intestini DSM 28795 | Isolate | Unclassified |
| 157 | 2758568507 | Lactobacillus bombicola ESL0237 | Isolate | Unclassified |
| 158 | 2758568508 | Lactobacillus bombicola ESL0236 | Isolate | Unclassified |
| 159 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 160 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 161 | 2820594669 | Unclassified Firmicutes Emb289P1bin61 | Isolate | Unclassified |
| 162 | 2820606014 | Unclassified Firmicutes Emb289P1bin49 | Isolate | Unclassified |
| 163 | 2820683647 | Unclassified Firmicutes Co191P1bin82 | Isolate | Unclassified |
| 164 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 165 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 166 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 167 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 168 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 169 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 170 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 171 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 172 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 173 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 174 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 175 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 176 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 177 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 178 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 179 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 180 | 2968368220 | Lactobacillus bombicola OCC3 | Isolate | Apidae |
| 181 | 2971062614 | Lactobacillus bombicola BI-4G | Isolate | Apidae |
| 182 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 183 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 184 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 185 | 8112490586 | Staphylococcus muscae CCM 4175 | Isolate | |
| 186 | 2896402965 | Weissella diestrammenae KACC 16890 | Isolate | Rhaphidophoridae |
| 187 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 188 | 2917496769 | Staphylococcus muscae DSM 7068 | Isolate | Unclassified |
| 189 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 190 | 2882334426 | Lactobacillus sp. 2-3 | Isolate | Unclassified |
| 191 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 192 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 193 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 194 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 195 | 2740892557 | Staphylococcus sp. JDR108L-110-1 | Isolate | Unclassified |
| 196 | 2758568509 | Lactobacillus bombicola ESL0234 | Isolate | Unclassified |
| 197 | 2758568510 | Lactobacillus bombicola ESL0233 | Isolate | Unclassified |
| 198 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 199 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 200 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 201 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 202 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 203 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 204 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 205 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 206 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 207 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 208 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 209 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 210 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 211 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 212 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 213 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 214 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 215 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 216 | 2877522083 | Apilactobacillus bombintestini BHWM-4 | Isolate | Apidae |
| 217 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 218 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 219 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 220 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 221 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 222 | 2758568506 | Lactobacillus bombicola ESL0230 | Isolate | Unclassified |
| 223 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 224 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 225 | 2799112220 | Lactobacillus sp. ESL0411 | Isolate | Unclassified |
| 226 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 227 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 228 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 229 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 230 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 231 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 232 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 233 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 234 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 235 | 8012942269 | Mammaliicoccus lentus UD i2 | Isolate | Tenebrionidae |
| 236 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 237 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 238 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 239 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 240 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 241 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 242 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 243 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 244 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 245 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 246 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 247 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 248 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 249 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 250 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 251 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 252 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 253 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 254 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 255 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 256 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 257 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 258 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 259 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 260 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 261 | 2758568501 | Lactobacillus bombicola ESL0228 | Isolate | Unclassified |
| 262 | 2758568502 | Lactobacillus bombicola ESL0247 | Isolate | Unclassified |
| 263 | 2758568503 | Lactobacillus bombicola ESL0246 | Isolate | Unclassified |
| 264 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 265 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 266 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 267 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 268 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 269 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 270 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 271 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 272 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 273 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 274 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 275 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 276 | 8004832522 | Lactobacillus sp. ESL0236 | Isolate | Apidae |
| 277 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 278 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 279 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 280 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 281 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 282 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 283 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 284 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 285 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 286 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 287 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 288 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 289 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562378_2321 | 3300056814 | Bacteria | 16256 |
| 2 | Ga0160445_101243 | 3300012847 | Bacteria | 7689 |
| 3 | Ga0255572_1001208 | 3300026175 | Bacteria | 38415 |
| 4 | Ga0415639_009749 | 3300038395 | Bacteria | 20493 |
| 5 | Ga0415639_058235 | 3300038395 | Bacteria | 6225 |
| 6 | Ga0466715_267475 | 3300042616 | Bacteria | 78084 |
| 7 | Ga0123357_10224045 | 3300009784 | Bacteria | 2079 |
| 8 | Ga0123355_10037424 | 3300009826 | Bacteria | 7890 |
| 9 | Ga0123355_10068710 | 3300009826 | Bacteria | 5698 |
| 10 | Ga0123356_10465102 | 3300010049 | Bacteria | 1415 |
| 11 | Ga0123353_10042558 | 3300010167 | Bacteria | 7184 |
| 12 | Ga0123353_10055776 | 3300010167 | Bacteria | 6322 |
| 13 | Ga0466735_089493 | 3300042624 | Bacteria | 2670 |
| 14 | Ga0466725_016700 | 3300042654 | Bacteria | 1824 |
| 15 | Ga0466707_414168 | 3300042601 | Bacteria | 25705 |
| 16 | Ga0466719_517119 | 3300042606 | Bacteria | 1021 |
| 17 | IMNBL1DRAFT_c0000598 | 3300000062 | Bacteria | 28960 |
| 18 | IMNBL1DRAFT_c0013061 | 3300000062 | Bacteria | 3753 |
| 19 | JGI24703J35330_11623053 | 3300002501 | Bacteria | 1461 |
| 20 | Ga0530661_005362 | 3300056564 | Bacteria | 3785 |
| 21 | Ga0562379_0005 | 3300056790 | Bacteria | 2649770 |
| 22 | Ga0562379_0006 | 3300056790 | Bacteria | 2459409 |
| 23 | Ga0562377_0641 | 3300056842 | Bacteria | 52294 |
| 24 | Ga0562376_0004 | 3300056857 | Bacteria | 3026470 |
| 25 | Ga0415639_076623 | 3300038395 | Bacteria | 3434 |
| 26 | Ga0123357_10427562 | 3300009784 | Bacteria | 1174 |
| 27 | Ga0123355_10091961 | 3300009826 | Unclassified | 4807 |
| 28 | Ga0123355_10127593 | 3300009826 | Unclassified | 3927 |
| 29 | Ga0123356_10045902 | 3300010049 | Bacteria | 4065 |
| 30 | Ga0123353_10000587 | 3300010167 | Bacteria | 44450 |
| 31 | Ga0123353_10191314 | 3300010167 | Bacteria | 3229 |
| 32 | Ga0123353_10296464 | 3300010167 | Bacteria | 2472 |
| 33 | Ga0123353_10813726 | 3300010167 | Bacteria | 1287 |
| 34 | Ga0123353_11179726 | 3300010167 | Bacteria | 1007 |
| 35 | Ga0123354_10309359 | 3300010882 | Bacteria | 1479 |
| 36 | Ga0466734_140079 | 3300042623 | Bacteria | 3531 |
| 37 | Ga0466724_40032 | 3300042649 | Bacteria | 8701 |
| 38 | Ga0466727_215734 | 3300042655 | Bacteria | 27407 |
| 39 | Ga0466701_021689 | 3300042598 | Bacteria | 144748 |
| 40 | Ga0466706_138228 | 3300042599 | Unclassified | 3002 |
| 41 | Ga0466707_126663 | 3300042601 | Bacteria | 75061 |
| 42 | Ga0466707_332300 | 3300042601 | Bacteria | 1724 |
| 43 | Ga0466713_155845 | 3300042602 | Unclassified | 168359 |
| 44 | Ga0466697_036687 | 3300042611 | Bacteria | 2000 |
| 45 | 2227080776 | 2225789004 | Unclassified | 183011 |
| 46 | IMNBL1DRAFT_c0000229 | 3300000062 | Bacteria | 49083 |
| 47 | Ga0072940_1264544 | 3300005200 | Bacteria | 6541 |
| 48 | Ga0105005_1112206 | 3300007505 | Unclassified | 2426 |
| 49 | Ga0466733_209395 | 3300042659 | Bacteria | 8489 |
| 50 | Ga0530661_000022 | 3300056564 | Bacteria | 194089 |
| 51 | Ga0562377_0032 | 3300056842 | Bacteria | 719749 |
| 52 | Ga0562374_0165 | 3300057007 | Unclassified | 152624 |
| 53 | Ga0466690_380404 | 3300042590 | Bacteria | 2415 |
| 54 | Ga0466690_398342 | 3300042590 | Bacteria | 11708 |
| 55 | Ga0466693_257359 | 3300042592 | Bacteria | 2308 |
| 56 | Ga0466711_437333 | 3300042615 | Bacteria | 1902 |
| 57 | Ga0123355_10497986 | 3300009826 | Bacteria | 1505 |
| 58 | Ga0123353_10052461 | 3300010167 | Bacteria | 6513 |
| 59 | Ga0123353_10249228 | 3300010167 | Bacteria | 2752 |
| 60 | Ga0466704_130710 | 3300042643 | Bacteria | 3829 |
| 61 | Ga0466704_567071 | 3300042643 | Unclassified | 5947 |
| 62 | Ga0466706_139548 | 3300042599 | Bacteria | 5004 |
| 63 | Ga0466706_216995 | 3300042599 | Bacteria | 1097 |
| 64 | Ga0466714_126800 | 3300042603 | Bacteria | 4902 |
| 65 | Ga0466716_359933 | 3300042605 | Bacteria | 3352 |
| 66 | Ga0466719_541131 | 3300042606 | Bacteria | 9048 |
| 67 | 2227605177 | 2225789004 | Bacteria | 12323 |
| 68 | IMNBL1DRAFT_c0003296 | 3300000062 | Bacteria | 10497 |
| 69 | JGI24702J35022_10001022 | 3300002462 | Bacteria | 17516 |
| 70 | JGI24702J35022_10002843 | 3300002462 | Bacteria | 10480 |
| 71 | JGI24705J35276_12220619 | 3300002504 | Unclassified | 2280 |
| 72 | Ga0068302_10014565 | 3300005071 | Bacteria | 5314 |
| 73 | Ga0562379_0011 | 3300056790 | Bacteria | 1623141 |
| 74 | Ga0562379_0039 | 3300056790 | Bacteria | 641946 |
| 75 | Ga0562379_0429 | 3300056790 | Bacteria | 90757 |
| 76 | Ga0562375_0729 | 3300056856 | Bacteria | 58270 |
| 77 | Ga0466693_273738 | 3300042592 | Bacteria | 1280 |
| 78 | Ga0466711_193898 | 3300042615 | Bacteria | 3839 |
| 79 | Ga0466715_637226 | 3300042616 | Bacteria | 117449 |
| 80 | Ga0123355_10031403 | 3300009826 | Bacteria | 8618 |
| 81 | Ga0123355_10191652 | 3300009826 | Bacteria | 3009 |
| 82 | Ga0123355_10239634 | 3300009826 | Bacteria | 2572 |
| 83 | Ga0123356_10007093 | 3300010049 | Bacteria | 11231 |
| 84 | Ga0123353_10042601 | 3300010167 | Bacteria | 7181 |
| 85 | Ga0123354_10100444 | 3300010882 | Bacteria | 3915 |
| 86 | Ga0160454_100033 | 3300012798 | Bacteria | 266490 |
| 87 | Ga0160471_102416 | 3300012812 | Bacteria | 3113 |
| 88 | Ga0466731_002319 | 3300042622 | Bacteria | 1200 |
| 89 | Ga0466702_244404 | 3300042635 | Bacteria | 50690 |
| 90 | Ga0466706_163402 | 3300042599 | Bacteria | 3931 |
| 91 | Ga0466719_442117 | 3300042606 | Bacteria | 1740 |
| 92 | Ga0466697_031650 | 3300042611 | Bacteria | 3001 |
| 93 | AglaG_contig22322 | 2084038013 | Bacteria | 9147 |
| 94 | 2227502402 | 2225789004 | Bacteria | 19221 |
| 95 | IMNBGM34_c000648 | 3300000036 | Bacteria | 8543 |
| 96 | JGI24700J35501_10926977 | 3300002508 | Unclassified | 6550 |
| 97 | Ga0063521_1000086 | 3300003973 | Bacteria | 78064 |
| 98 | Ga0063521_1012261 | 3300003973 | Unclassified | 2068 |
| 99 | Ga0068305_10268814 | 3300005083 | Bacteria | 2687 |
| 100 | Ga0466705_100624 | 3300042612 | Bacteria | 26262 |
| 101 | Ga0562378_0674 | 3300056814 | Unclassified | 50623 |
| 102 | Ga0562377_0018 | 3300056842 | Bacteria | 1087840 |
| 103 | Ga0562375_0015 | 3300056856 | Bacteria | 1028412 |
| 104 | Ga0562375_0188 | 3300056856 | Bacteria | 178390 |
| 105 | Ga0562376_4907 | 3300056857 | Unclassified | 9937 |
| 106 | Ga0160455_100978 | 3300012837 | Bacteria | 10361 |
| 107 | Ga0466715_474279 | 3300042616 | Bacteria | 9744 |
| 108 | Ga0466715_552953 | 3300042616 | Bacteria | 12941 |
| 109 | Ga0466726_305593 | 3300042619 | Bacteria | 14036 |
| 110 | Ga0466728_455520 | 3300042620 | Bacteria | 9482 |
| 111 | Ga0123355_10063447 | 3300009826 | Bacteria | 5958 |
| 112 | Ga0123355_10652840 | 3300009826 | Bacteria | 1227 |
| 113 | Ga0123353_10012256 | 3300010167 | Bacteria | 12168 |
| 114 | Ga0123353_10031321 | 3300010167 | Bacteria | 8236 |
| 115 | Ga0123353_10197328 | 3300010167 | Bacteria | 3171 |
| 116 | Ga0123353_11295791 | 3300010167 | Bacteria | 946 |
| 117 | Ga0123354_10200785 | 3300010882 | Unclassified | 2193 |
| 118 | Ga0123354_10223904 | 3300010882 | Bacteria | 1989 |
| 119 | Ga0466704_288241 | 3300042643 | Bacteria | 1113 |
| 120 | Ga0466727_346481 | 3300042655 | Bacteria | 130939 |
| 121 | Ga0466706_101186 | 3300042599 | Bacteria | 14190 |
| 122 | Ga0466716_370072 | 3300042605 | Bacteria | 4756 |
| 123 | JGI24702J35022_10051854 | 3300002462 | Bacteria | 2186 |
| 124 | JGI24705J35276_12208339 | 3300002504 | Bacteria | 1770 |
| 125 | JGI24705J35276_12235608 | 3300002504 | Bacteria | 6728 |
| 126 | Ga0068305_10166261 | 3300005083 | Bacteria | 2732 |
| 127 | Ga0074278_154531 | 3300005721 | Unclassified | 8802 |
| 128 | Ga0105005_1103670 | 3300007505 | Unclassified | 2408 |
| 129 | Ga0466697_252736 | 3300042611 | Unclassified | 1659 |
| 130 | Ga0562379_0009 | 3300056790 | Bacteria | 1927879 |
| 131 | Ga0562379_0035 | 3300056790 | Bacteria | 679259 |
| 132 | Ga0562379_4241 | 3300056790 | Bacteria | 7699 |
| 133 | Ga0562375_0057 | 3300056856 | Bacteria | 447120 |
| 134 | Ga0562374_0143 | 3300057007 | Bacteria | 173981 |
| 135 | Ga0562374_0186 | 3300057007 | Unclassified | 135189 |
| 136 | Ga0562374_0303 | 3300057007 | Unclassified | 93348 |
| 137 | Ga0466693_394352 | 3300042592 | Bacteria | 1741 |
| 138 | Ga0466726_372855 | 3300042619 | Bacteria | 1939 |
| 139 | Ga0123357_10066397 | 3300009784 | Bacteria | 4811 |
| 140 | Ga0123357_10268609 | 3300009784 | Bacteria | 1787 |
| 141 | Ga0123355_10015012 | 3300009826 | Bacteria | 12148 |
| 142 | Ga0123355_10029474 | 3300009826 | Bacteria | 8884 |
| 143 | Ga0123355_10252627 | 3300009826 | Bacteria | 2479 |
| 144 | Ga0123355_10364985 | 3300009826 | Bacteria | 1898 |
| 145 | Ga0123355_10502381 | 3300009826 | Bacteria | 1495 |
| 146 | Ga0123355_10521536 | 3300009826 | Bacteria | 1453 |
| 147 | Ga0123353_10167748 | 3300010167 | Bacteria | 3488 |
| 148 | Ga0466724_54918 | 3300042649 | Bacteria | 5503 |
| 149 | Ga0466706_110813 | 3300042599 | Bacteria | 17325 |
| 150 | Ga0466722_048005 | 3300042609 | Bacteria | 1923 |
| 151 | Ga0562379_0033 | 3300056790 | Bacteria | 743383 |
| 152 | Ga0562375_0211 | 3300056856 | Bacteria | 162868 |
| 153 | Ga0562376_4997 | 3300056857 | Unclassified | 9638 |
| 154 | Ga0562374_0010 | 3300057007 | Bacteria | 1930599 |
| 155 | Ga0562374_0011 | 3300057007 | Bacteria | 1900075 |
| 156 | Ga0466696_424705 | 3300042596 | Bacteria | 1285 |
| 157 | Ga0466726_338088 | 3300042619 | Bacteria | 7910 |
| 158 | Ga0466729_043508 | 3300042621 | Bacteria | 9393 |
| 159 | Ga0123355_10000703 | 3300009826 | Bacteria | 45383 |
| 160 | Ga0123356_10988702 | 3300010049 | Bacteria | 1012 |
| 161 | Ga0123356_11379081 | 3300010049 | Bacteria | 866 |
| 162 | Ga0123353_10039180 | 3300010167 | Bacteria | 7457 |
| 163 | Ga0123353_10231969 | 3300010167 | Bacteria | 2877 |
| 164 | Ga0123354_10099308 | 3300010882 | Bacteria | 3951 |
| 165 | Ga0123354_10270647 | 3300010882 | Unclassified | 1673 |
| 166 | Ga0160466_102951 | 3300012809 | Bacteria | 3022 |
| 167 | Ga0466704_322254 | 3300042643 | Bacteria | 25270 |
| 168 | Ga0466725_117025 | 3300042654 | Bacteria | 6063 |
| 169 | Ga0466706_006037 | 3300042599 | Unclassified | 2141 |
| 170 | Ga0466706_152143 | 3300042599 | Bacteria | 5079 |
| 171 | Ga0466714_133724 | 3300042603 | Bacteria | 18444 |
| 172 | HBC_ctgsDRAFT_1000060 | 3300000333 | Bacteria | 27539 |
| 173 | JGI24695J34938_10065846 | 3300002450 | Unclassified | 1529 |
| 174 | Ga0072941_1044336 | 3300005201 | Bacteria | 15623 |
| 175 | Ga0074278_113112 | 3300005721 | Unclassified | 3433 |
| 176 | Ga0105005_1007168 | 3300007505 | Bacteria | 2503 |
| 177 | Ga0466705_127490 | 3300042612 | Bacteria | 6710 |
| 178 | Ga0466733_027686 | 3300042659 | Bacteria | 32514 |
| 179 | Ga0562379_1501 | 3300056790 | Unclassified | 26182 |
| 180 | Ga0562376_2169 | 3300056857 | Bacteria | 24570 |
| 181 | Ga0562374_0008 | 3300057007 | Bacteria | 1999653 |
| 182 | Ga0562374_0520 | 3300057007 | Bacteria | 62981 |
| 183 | Ga0160441_100217 | 3300012825 | Bacteria | 57415 |
| 184 | Ga0415639_064670 | 3300038395 | Bacteria | 2136 |
| 185 | Ga0415639_105292 | 3300038395 | Bacteria | 3438 |
| 186 | Ga0466692_003593 | 3300042591 | Bacteria | 3777 |
| 187 | Ga0466693_000112 | 3300042592 | Bacteria | 4099 |
| 188 | Ga0123356_10236486 | 3300010049 | Bacteria | 1895 |
| 189 | Ga0123356_10447408 | 3300010049 | Bacteria | 1439 |
| 190 | Ga0123356_10514587 | 3300010049 | Bacteria | 1354 |
| 191 | Ga0123353_10103457 | 3300010167 | Bacteria | 4590 |
| 192 | Ga0123353_10190037 | 3300010167 | Bacteria | 3242 |
| 193 | Ga0123353_10290140 | 3300010167 | Bacteria | 2505 |
| 194 | Ga0123354_10151323 | 3300010882 | Bacteria | 2810 |
| 195 | Ga0123354_10198454 | 3300010882 | Bacteria | 2216 |
| 196 | Ga0160464_103214 | 3300012805 | Bacteria | 2463 |
| 197 | Ga0466730_095391 | 3300042625 | Unclassified | 4961 |
| 198 | Ga0466703_088727 | 3300042636 | Bacteria | 8092 |
| 199 | Ga0466700_079203 | 3300042600 | Bacteria | 57895 |
| 200 | Ga0466719_166180 | 3300042606 | Bacteria | 1544 |
| 201 | Ga0466722_040195 | 3300042609 | Bacteria | 4739 |
| 202 | Ga0466722_045557 | 3300042609 | Bacteria | 252817 |
| 203 | Ga0466697_011659 | 3300042611 | Bacteria | 4229 |
| 204 | 2211957112 | 2209111004 | Unclassified | 18391 |
| 205 | JGI24702J35022_10153408 | 3300002462 | Bacteria | 1294 |
| 206 | JGI24703J35330_11748707 | 3300002501 | Bacteria | 27424 |
| 207 | Ga0068302_10052571 | 3300005071 | Unclassified | 6273 |
| 208 | Ga0074278_119900 | 3300005721 | Unclassified | 4900 |
| 209 | Ga0104047_1120807 | 3300007088 | Bacteria | 1348 |
| 210 | Ga0105005_1117592 | 3300007505 | Unclassified | 2431 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00072 | GO:0000160 | phosphorelay signal transduction system | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.