Protein Family IF13074
Metagenome
Isolate
167
Members
72
Samples
149
Scaffolds
73.62
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2940295490|2940296327|
- Length
- 84 aa
- Sequence
- MTKYPKGYKILSMNTIGKYVKEKRKSVGLTQEEFALRAGLGLRFVRELEQGKETVRLDKVNQALAMFGMEAVPGKLTREGVNEE
Sample Types
Isolate
10.8%
Metagenome
89.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.4%
Blattidae
19.7%
Kalotermitidae
15.5%
Unclassified
8.5%
Termopsidae
5.6%
Rhinotermitidae
4.2%
Passalidae
4.2%
Hodotermitidae
1.4%
Armadillidiidae
1.4%
Taxonomy
Archaea
1
Bacteria
145
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 3 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 4 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 5 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 6 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 10 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 11 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 20 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 24 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 30 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 31 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 34 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 35 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 36 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 37 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 38 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 39 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 40 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 41 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 42 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 43 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 44 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 45 | 2609459943 | Bacteroides reticulotermitis JCM 10512 | Isolate | Rhinotermitidae |
| 46 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 47 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 48 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 49 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 50 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 51 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 52 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 53 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 54 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 55 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 56 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 57 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 58 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 59 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 60 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 61 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 62 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 63 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 64 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 65 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 66 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 67 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 68 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 69 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 70 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 71 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 72 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_160976 | 3300042611 | Bacteria | 1959 |
| 2 | Ga0466703_332216 | 3300042636 | Bacteria | 16803 |
| 3 | Ga0466727_243239 | 3300042655 | Bacteria | 9605 |
| 4 | Ga0123356_11848965 | 3300010049 | Bacteria | 751 |
| 5 | Ga0123356_12797781 | 3300010049 | Unclassified | 611 |
| 6 | Ga0123353_12123403 | 3300010167 | Bacteria | 683 |
| 7 | Ga0160465_100019 | 3300012803 | Bacteria | 275855 |
| 8 | Ga0466706_230149 | 3300042599 | Bacteria | 5852 |
| 9 | Ga0466707_333299 | 3300042601 | Unclassified | 2365 |
| 10 | Ga0466707_342901 | 3300042601 | Bacteria | 1585 |
| 11 | Ga0466719_372214 | 3300042606 | Bacteria | 1697 |
| 12 | Ga0466722_061701 | 3300042609 | Bacteria | 1536 |
| 13 | Ga0068302_10416814 | 3300005071 | Bacteria | 735 |
| 14 | Ga0466697_255645 | 3300042611 | Archaea | 1274 |
| 15 | Ga0466710_380712 | 3300042613 | Bacteria | 1644 |
| 16 | Ga0466711_012102 | 3300042615 | Unclassified | 10498 |
| 17 | Ga0466715_272480 | 3300042616 | Bacteria | 5909 |
| 18 | Ga0466718_065423 | 3300042617 | Bacteria | 1220 |
| 19 | Ga0466726_178981 | 3300042619 | Bacteria | 3251 |
| 20 | Ga0466731_422244 | 3300042622 | Bacteria | 1115 |
| 21 | Ga0466704_320307 | 3300042643 | Bacteria | 5503 |
| 22 | Ga0123356_10082843 | 3300010049 | Bacteria | 3038 |
| 23 | Ga0123356_10094417 | 3300010049 | Bacteria | 2856 |
| 24 | Ga0123356_10972256 | 3300010049 | Bacteria | 1019 |
| 25 | Ga0123353_11076928 | 3300010167 | Unclassified | 1070 |
| 26 | Ga0123354_10293465 | 3300010882 | Bacteria | 1553 |
| 27 | Ga0466700_276213 | 3300042600 | Bacteria | 4382 |
| 28 | Ga0466707_400659 | 3300042601 | Bacteria | 2609 |
| 29 | Ga0466713_001898 | 3300042602 | Bacteria | 3338 |
| 30 | 2227070165 | 2225789003 | Unclassified | 575 |
| 31 | 2227549663 | 2225789004 | Bacteria | 2868 |
| 32 | JGI24702J35022_10185873 | 3300002462 | Bacteria | 1183 |
| 33 | JGI24705J35276_11429548 | 3300002504 | Bacteria | 536 |
| 34 | Ga0466697_097682 | 3300042611 | Bacteria | 1448 |
| 35 | Ga0466694_239687 | 3300042594 | Bacteria | 1472 |
| 36 | Ga0466696_157558 | 3300042596 | Bacteria | 3839 |
| 37 | Ga0466729_287352 | 3300042621 | Bacteria | 1618 |
| 38 | Ga0466735_011420 | 3300042624 | Bacteria | 1565 |
| 39 | Ga0466730_045067 | 3300042625 | Bacteria | 3424 |
| 40 | Ga0466704_082775 | 3300042643 | Bacteria | 14516 |
| 41 | Ga0466708_149232 | 3300042652 | Bacteria | 9752 |
| 42 | Ga0123355_10001452 | 3300009826 | Bacteria | 32952 |
| 43 | Ga0123356_12986679 | 3300010049 | Unclassified | 591 |
| 44 | Ga0123356_13138353 | 3300010049 | Bacteria | 576 |
| 45 | Ga0123353_12174339 | 3300010167 | Bacteria | 672 |
| 46 | Ga0123354_10126204 | 3300010882 | Bacteria | 3267 |
| 47 | Ga0466706_166307 | 3300042599 | Bacteria | 7905 |
| 48 | Ga0466707_174399 | 3300042601 | Bacteria | 9055 |
| 49 | Ga0466707_217444 | 3300042601 | Bacteria | 37606 |
| 50 | Ga0466717_298062 | 3300042604 | Bacteria | 2148 |
| 51 | Ga0466716_352133 | 3300042605 | Bacteria | 1024 |
| 52 | JGI24705J35276_11619931 | 3300002504 | Bacteria | 599 |
| 53 | JGI24699J35502_11134191 | 3300002509 | Bacteria | 50084 |
| 54 | JGI24696J40584_12698660 | 3300002834 | Unclassified | 736 |
| 55 | JGI24696J40584_12895147 | 3300002834 | Bacteria | 1152 |
| 56 | Ga0466735_113931 | 3300042624 | Bacteria | 2478 |
| 57 | Ga0466703_186397 | 3300042636 | Bacteria | 2118 |
| 58 | Ga0466703_321275 | 3300042636 | Bacteria | 2454 |
| 59 | Ga0466704_575613 | 3300042643 | Bacteria | 21883 |
| 60 | Ga0466724_67482 | 3300042649 | Bacteria | 5860 |
| 61 | Ga0466725_124543 | 3300042654 | Bacteria | 2819 |
| 62 | Ga0466727_282043 | 3300042655 | Bacteria | 2664 |
| 63 | Ga0123357_10147821 | 3300009784 | Unclassified | 2863 |
| 64 | Ga0466707_163289 | 3300042601 | Bacteria | 1886 |
| 65 | Ga0466707_368913 | 3300042601 | Bacteria | 2720 |
| 66 | IMNBL1DRAFT_c0000664 | 3300000062 | Bacteria | 27514 |
| 67 | IMNBL1DRAFT_c0001037 | 3300000062 | Bacteria | 21542 |
| 68 | JGI24702J35022_10027239 | 3300002462 | Unclassified | 3075 |
| 69 | JGI24702J35022_10032569 | 3300002462 | Bacteria | 2790 |
| 70 | JGI24702J35022_10035525 | 3300002462 | Bacteria | 2665 |
| 71 | Ga0466705_394319 | 3300042612 | Bacteria | 1563 |
| 72 | Ga0466711_378009 | 3300042615 | Bacteria | 1555 |
| 73 | Ga0466715_038885 | 3300042616 | Bacteria | 12607 |
| 74 | Ga0466726_464370 | 3300042619 | Bacteria | 3902 |
| 75 | Ga0160455_100268 | 3300012837 | Bacteria | 37862 |
| 76 | Ga0466694_400350 | 3300042594 | Bacteria | 1749 |
| 77 | Ga0466731_077297 | 3300042622 | Bacteria | 2669 |
| 78 | Ga0466735_094012 | 3300042624 | Bacteria | 1265 |
| 79 | Ga0123356_10386359 | 3300010049 | Bacteria | 1534 |
| 80 | Ga0466701_050667 | 3300042598 | Bacteria | 7196 |
| 81 | Ga0466707_210439 | 3300042601 | Bacteria | 2150 |
| 82 | Ga0466717_226440 | 3300042604 | Bacteria | 1203 |
| 83 | 2227507964 | 2225789004 | Bacteria | 18801 |
| 84 | 2227607688 | 2225789004 | Bacteria | 2286 |
| 85 | IMNBL1DRAFT_c0038412 | 3300000062 | Unclassified | 1647 |
| 86 | JGI24696J40584_12831787 | 3300002834 | Unclassified | 932 |
| 87 | JGI24696J40584_12927544 | 3300002834 | Bacteria | 1427 |
| 88 | Ga0466697_228570 | 3300042611 | Bacteria | 1173 |
| 89 | Ga0466732_317795 | 3300042656 | Bacteria | 1596 |
| 90 | Ga0466710_387245 | 3300042613 | Bacteria | 5913 |
| 91 | Ga0466726_260872 | 3300042619 | Bacteria | 2464 |
| 92 | Ga0466656_085533 | 3300042550 | Bacteria | 4656 |
| 93 | Ga0466693_367037 | 3300042592 | Bacteria | 1781 |
| 94 | Ga0466731_024557 | 3300042622 | Bacteria | 1533 |
| 95 | Ga0466708_043653 | 3300042652 | Bacteria | 9633 |
| 96 | Ga0466725_065740 | 3300042654 | Bacteria | 5726 |
| 97 | Ga0466725_402089 | 3300042654 | Bacteria | 1349 |
| 98 | Ga0123356_10077486 | 3300010049 | Bacteria | 3135 |
| 99 | Ga0123356_12223334 | 3300010049 | Bacteria | 686 |
| 100 | Ga0123353_10579101 | 3300010167 | Bacteria | 1611 |
| 101 | Ga0123353_12085236 | 3300010167 | Bacteria | 691 |
| 102 | Ga0123354_10159887 | 3300010882 | Bacteria | 2681 |
| 103 | Ga0123354_10664639 | 3300010882 | Unclassified | 739 |
| 104 | Ga0466701_028509 | 3300042598 | Bacteria | 3824 |
| 105 | Ga0466717_060903 | 3300042604 | Bacteria | 1139 |
| 106 | Ga0466717_129966 | 3300042604 | Bacteria | 3155 |
| 107 | JGI24695J34938_10175823 | 3300002450 | Bacteria | 884 |
| 108 | JGI24702J35022_11020117 | 3300002462 | Unclassified | 514 |
| 109 | Ga0466711_268824 | 3300042615 | Bacteria | 2347 |
| 110 | Ga0466715_167940 | 3300042616 | Bacteria | 11594 |
| 111 | Ga0415639_045139 | 3300038395 | Bacteria | 15120 |
| 112 | Ga0466731_141303 | 3300042622 | Unclassified | 1204 |
| 113 | Ga0466734_082008 | 3300042623 | Bacteria | 2102 |
| 114 | Ga0466735_012121 | 3300042624 | Unclassified | 1682 |
| 115 | Ga0466735_235645 | 3300042624 | Bacteria | 1058 |
| 116 | Ga0123353_10270205 | 3300010167 | Bacteria | 2620 |
| 117 | Ga0123353_10947516 | 3300010167 | Bacteria | 1165 |
| 118 | Ga0466706_107430 | 3300042599 | Bacteria | 1533 |
| 119 | Ga0466706_257822 | 3300042599 | Bacteria | 1422 |
| 120 | Ga0466716_404303 | 3300042605 | Bacteria | 4305 |
| 121 | IMNBL1DRAFT_c0015491 | 3300000062 | Bacteria | 3307 |
| 122 | IMNBL1DRAFT_c0022496 | 3300000062 | Unclassified | 2492 |
| 123 | IMNBL1DRAFT_c0109376 | 3300000062 | Bacteria | 735 |
| 124 | JGI24702J35022_10039208 | 3300002462 | Bacteria | 2528 |
| 125 | Ga0068305_10022371 | 3300005083 | Bacteria | 13358 |
| 126 | Ga0466710_051755 | 3300042613 | Bacteria | 1236 |
| 127 | Ga0466690_215146 | 3300042590 | Bacteria | 4689 |
| 128 | Ga0466696_209891 | 3300042596 | Bacteria | 3353 |
| 129 | Ga0466735_126619 | 3300042624 | Bacteria | 1979 |
| 130 | Ga0466735_155287 | 3300042624 | Unclassified | 1006 |
| 131 | Ga0466702_292699 | 3300042635 | Bacteria | 2823 |
| 132 | Ga0466709_174613 | 3300042648 | Bacteria | 56197 |
| 133 | Ga0466708_163650 | 3300042652 | Bacteria | 19190 |
| 134 | Ga0466725_205332 | 3300042654 | Bacteria | 1116 |
| 135 | Ga0123357_10043947 | 3300009784 | Unclassified | 6067 |
| 136 | Ga0123357_10919496 | 3300009784 | Unclassified | 561 |
| 137 | Ga0123356_10065262 | 3300010049 | Unclassified | 3406 |
| 138 | Ga0123356_10513217 | 3300010049 | Unclassified | 1356 |
| 139 | Ga0123356_13200552 | 3300010049 | Bacteria | 570 |
| 140 | Ga0123353_10958444 | 3300010167 | Bacteria | 1156 |
| 141 | Ga0123354_11037209 | 3300010882 | Bacteria | 525 |
| 142 | Ga0466701_080892 | 3300042598 | Bacteria | 3915 |
| 143 | Ga0466707_140125 | 3300042601 | Bacteria | 2124 |
| 144 | Ga0466721_327951 | 3300042608 | Bacteria | 1879 |
| 145 | Ga0466722_076418 | 3300042609 | Bacteria | 1933 |
| 146 | 2227566740 | 2225789004 | Bacteria | 546 |
| 147 | JGI24702J35022_10000991 | 3300002462 | Bacteria | 17791 |
| 148 | JGI24702J35022_10616552 | 3300002462 | Bacteria | 672 |
| 149 | JGI24696J40584_12343264 | 3300002834 | Bacteria | 533 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01381 | HTH_3 | Helix-turn-helix | 20 | 62 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.