Protein Family IF12912
Metagenome
Isolate
178
Members
158
Samples
71
Scaffolds
404.99
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2884492481|2884492541|
- Length
- 425 aa
- Sequence
- MQRKILFNIIYLVSVIKGEEILKRTVITGFGIISSIGSLEKKIVRSLKNGISGIVFSQKMKEYGLYSKVWGKISIKRIKEIPKRFLRFMNLASMYSYLSMKDAIQDSNLYPDIYMKNPRVGMIIGSGSGAAQFYRSIFQIQNNRINKISPYSAIKNMSSSISACLGSFFKIYGINYAISSACSTSANCIGHAYNLISSGEQDIIFAGGGEELSVELASQFDAMRILSVNFNKIPEFSSRAFDKNRDGFVISGGSGIIVLEELNFALSRKANIYAEVIGYGTTCDGNSIIYPSGEGFIRCMNNAIKYIDSSIDYINAHGTSTKIGDIKELNAIKKVFKKSGIPYISSTKSITGHSLGAAGVQEIIYTMLMLKYNFIAPSININNLDFSARNMNIVQKPINKIINIAMSNSFGFGGTNVSLVIKKYS
Sample Types
Isolate
60.1%
Metagenome
39.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Aphididae
27.3%
Apidae
11.3%
Formicidae
10.0%
Termitidae
9.3%
Elmidae
6.7%
Unclassified
6.7%
Sarcophagidae
4.0%
Armadillidiidae
4.0%
Pediculidae
3.3%
Psyllidae
2.7%
Culicidae
2.0%
Aleyrodidae
2.0%
Hydrophilidae
1.3%
Curculionidae
1.3%
Pteromalidae
1.3%
Reduviidae
0.7%
Nephropidae
0.7%
Aphalaridae
0.7%
Daphniidae
0.7%
Hormaphididae
0.7%
Hippoboscidae
0.7%
Stratiomyidae
0.7%
Pseudococcidae
0.7%
Muscidae
0.7%
Palinuridae
0.7%
Taxonomy
Archaea
0
Bacteria
168
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 2 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 3 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 4 | 2884498641 | Buchnera aphidicola BuCicurvipes/3402 | Isolate | Aphididae |
| 5 | 2884500114 | Buchnera aphidicola BuCicuneomaculata/2628 | Isolate | Aphididae |
| 6 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 7 | 637000045 | Buchnera aphidicola Sg | Isolate | Aphididae |
| 8 | 637000338 | Wigglesworthia glossinidia | Isolate | Unclassified |
| 9 | 643348522 | Buchnera aphidicola Tuc7 | Isolate | Aphididae |
| 10 | 644736336 | Candidatus Liberibacter asiaticus psy62 | Isolate | Psyllidae |
| 11 | 649633028 | Candidatus Blochmannia vafer BVAF | Isolate | Formicidae |
| 12 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 13 | 8068953321 | Bartonella apihabitans M0190 | Isolate | Apidae |
| 14 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 15 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 16 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 17 | 3300009531 | Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov | Metagenome | Aphididae |
| 18 | 3300010217 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China - Region2 | Metagenome | Aphididae |
| 19 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 20 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 21 | 2834887098 | Buchnera aphidicola LNK | Isolate | Aphididae |
| 22 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 23 | 2864951976 | Brevundimonas bullata S00223 | Isolate | Elmidae |
| 24 | 2884492481 | Buchnera aphidicola BuCicurtihirsuta/3053 | Isolate | Aphididae |
| 25 | 2884492905 | Buchnera aphidicola BuCipiceae/3303 | Isolate | Aphididae |
| 26 | 2884500535 | Buchnera aphidicola BuCilaricifoliae/3058 | Isolate | Aphididae |
| 27 | 2510065001 | Arsenophonus pediculi ArP | Isolate | Pediculidae |
| 28 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 29 | 2558860197 | Buchnera aphidicola F009 | Isolate | Aphididae |
| 30 | 2751185856 | Bartonella apis BBC0244 | Isolate | Apidae |
| 31 | 2820115951 | Unclassified Proteobacteria Emb289P4bin33 | Isolate | Unclassified |
| 32 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 33 | 643348520 | Buchnera aphidicola 5A | Isolate | Aphididae |
| 34 | 643348521 | Buchnera aphidicola Cc | Isolate | Aphididae |
| 35 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 36 | 650716012 | Buchnera aphidicola Ct | Isolate | Aphididae |
| 37 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 38 | 8073617375 | Bartonella apis W8098 | Isolate | Apidae |
| 39 | 8082291289 | Bartonella apihabitans K-FP28 | Isolate | Apidae |
| 40 | 3300009468 | Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov | Metagenome | Aphididae |
| 41 | 3300009483 | Microbial communities of aphids from Rhus glabra galls in Chiricahua Mtns, AZ, USA - Melaphis rhois NM090294 seqcov | Metagenome | |
| 42 | 3300009534 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Rhopalopisum padi seqcov | Metagenome | |
| 43 | 3300029810 | Ant gut bacterial community from Dolichoderus sp. 4-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC189 | Metagenome | Formicidae |
| 44 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 45 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 46 | 2512047046 | Secondary Endosymbiont of Heteropsylla cubana | Isolate | Psyllidae |
| 47 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 48 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 49 | 2556921669 | Shinella sp. DD12 | Isolate | Daphniidae |
| 50 | 2558860195 | Buchnera aphidicola G002 | Isolate | Aphididae |
| 51 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 52 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 53 | 650377915 | Buchnera aphidicola JF98 | Isolate | Aphididae |
| 54 | 650377916 | Buchnera aphidicola JF99 | Isolate | Aphididae |
| 55 | 8068946563 | Bartonella apihabitans M0187 | Isolate | Apidae |
| 56 | 8076029003 | Erwinia haradaeae ErCipiceae/3303 | Isolate | Aphididae |
| 57 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 58 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 59 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 60 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 61 | 3300009456 | Microbial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov | Metagenome | |
| 62 | 3300009458 | Microbial communities of aphids from Asclepias tuberosa in Tucson, AZ, USA - Aphis nerii NM100509 seqcov | Metagenome | |
| 63 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 64 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 65 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 66 | 3002300227 | Buchnera aphidicola (Nipponaphis monzeni) Nmo | Isolate | Hormaphididae |
| 67 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 68 | 2864866972 | Brevundimonas bullata S00123 | Isolate | Elmidae |
| 69 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 70 | 2751185853 | Bartonella apis BBC0178 | Isolate | Apidae |
| 71 | 2816332302 | Candidatus Liberibacter asiaticus YCPsy | Isolate | Psyllidae |
| 72 | 646564517 | Candidatus Riesia pediculicola USDA | Isolate | Pediculidae |
| 73 | 8068944069 | Bartonella choladocola W8125 | Isolate | Apidae |
| 74 | 8068955631 | Bartonella apihabitans M0280 | Isolate | Apidae |
| 75 | 8073628750 | Bartonella sp. W8167 | Isolate | Apidae |
| 76 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 77 | 3300009479 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcov | Metagenome | Aphididae |
| 78 | 3300009539 | Microbial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcov | Metagenome | Aphididae |
| 79 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 80 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 81 | 2846861257 | Buchnera aphidicola LSU | Isolate | Aphididae |
| 82 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 83 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 84 | 2887836388 | Buchnera aphidicola BuCisplendens/3004 | Isolate | Aphididae |
| 85 | 2510065004 | Arsenophonus melophagi ArM | Isolate | Hippoboscidae |
| 86 | 2718218137 | Buchnera aphidicola (Diuraphis noxia) | Isolate | Aphididae |
| 87 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 88 | 2773858019 | Candidatus Riesia pediculicola HHBH | Isolate | Pediculidae |
| 89 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 90 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 91 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 92 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 93 | 8073624232 | Bartonella sp. W8151 | Isolate | Apidae |
| 94 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 95 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 96 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 97 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 98 | 2884499693 | Buchnera aphidicola BuCikochiana/2762 | Isolate | Aphididae |
| 99 | 2511231206 | Buchnera aphidicola Ak | Isolate | Aphididae |
| 100 | 2521172698 | Candidatus Blochmannia chromaiodes 640 | Isolate | Unclassified |
| 101 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 102 | 2772190787 | Candidatus Riesia pediculicola HHAC | Isolate | Pediculidae |
| 103 | 2772190788 | Candidatus Riesia pediculischaeffi PTSK | Isolate | Pediculidae |
| 104 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 105 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 106 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 107 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 108 | 637000057 | Candidatus Blochmannia pennsylvanicus BPEN | Isolate | Formicidae |
| 109 | 650716016 | Candidatus Moranella endobia PCIT | Isolate | Pseudococcidae |
| 110 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 111 | 8073626464 | Bartonella apis W8152 | Isolate | Apidae |
| 112 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 113 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 114 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 115 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 116 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 117 | 3300029809 | Ant gut bacterial community from Dolichoderus sp. 3-PL2018, Madre de Dios, Puerto Maldonado, Peru - colony JSC188 | Metagenome | Formicidae |
| 118 | 2864934081 | Brevundimonas vesicularis S00192 | Isolate | Elmidae |
| 119 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 120 | 2872745489 | Buchnera aphidicola LSR1 | Isolate | Aphididae |
| 121 | 2884497005 | Buchnera aphidicola BuCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 122 | 2900132049 | Bartonella massiliensis OS09 | Isolate | Unclassified |
| 123 | 2843639003 | Buchnera aphidicola BuCistrobi/3249 | Isolate | Aphididae |
| 124 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 125 | 2558860194 | Buchnera aphidicola USDA | Isolate | Aphididae |
| 126 | 2811995301 | Serratia symbiotica STs Pazieg | Isolate | Aphididae |
| 127 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 128 | 650377917 | Buchnera aphidicola LL01 | Isolate | Aphididae |
| 129 | 8063680480 | Candidatus Liberibacter asiaticus CoFLP | Isolate | Psyllidae |
| 130 | 8067483258 | Ochrobactrum soli MTP-C0764 | Isolate | Muscidae |
| 131 | 8068950955 | Bartonella apihabitans W8097 | Isolate | Apidae |
| 132 | 8073621894 | Bartonella apis W8099 | Isolate | Apidae |
| 133 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 134 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 135 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 136 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 137 | 3300009471 | Microbial communities of aphids from galls on Rhus javanica in Mt Takao, Hachioji, Japan - Schlechtendalia chinensis CVD94-71 seqcov | Metagenome | |
| 138 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 139 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 140 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 141 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 142 | 2833859439 | Arsenophonus endosymbiont of Aleurodicus dispersus ARAD | Isolate | Aleyrodidae |
| 143 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 144 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 145 | 2886876212 | Tokpelaia sp. RhiAcro1 | Isolate | Formicidae |
| 146 | 2558860196 | Buchnera aphidicola W106 | Isolate | Aphididae |
| 147 | 2751185858 | Bartonella apis BBC0122 | Isolate | Apidae |
| 148 | 637000043 | Buchnera aphidicola APS | Isolate | Aphididae |
| 149 | 650377918 | Buchnera aphidicola TLW03 | Isolate | Aphididae |
| 150 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 151 | 8068941587 | Bartonella choladocola B10834H15 | Isolate | Apidae |
| 152 | 8073619611 | Bartonella apis B10834G6 | Isolate | Apidae |
| 153 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 154 | 2984883310 | Serratia symbiotica SCifornacula/2912 | Isolate | Aphididae |
| 155 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 156 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 157 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 158 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160472_100023 | 3300012839 | Bacteria | 328468 |
| 2 | Ga0160443_101129 | 3300012848 | Bacteria | 10536 |
| 3 | Ga0160443_104234 | 3300012848 | Bacteria | 2209 |
| 4 | JGI24705J35276_12238715 | 3300002504 | Bacteria | 41934 |
| 5 | CVPL010L_1000687 | 3300002932 | Bacteria | 7341 |
| 6 | Ga0127530_101235 | 3300009468 | Bacteria | 10400 |
| 7 | Ga0127524_100015 | 3300009478 | Bacteria | 633867 |
| 8 | Ga0127648_100046 | 3300009534 | Bacteria | 171066 |
| 9 | Ga0123356_10084618 | 3300010049 | Bacteria | 3006 |
| 10 | Ga0466710_279205 | 3300042613 | Bacteria | 2227 |
| 11 | Ga0466734_030429 | 3300042623 | Bacteria | 16314 |
| 12 | CVPL005L_10000015 | 3300002938 | Bacteria | 104057 |
| 13 | Ga0074278_143773 | 3300005721 | Bacteria | 30516 |
| 14 | Ga0074278_146391 | 3300005721 | Unclassified | 5771 |
| 15 | Ga0102734_1000877 | 3300007129 | Bacteria | 7887 |
| 16 | Ga0102738_1000025 | 3300007141 | Bacteria | 79072 |
| 17 | Ga0127523_100016 | 3300009456 | Bacteria | 642955 |
| 18 | Ga0127653_100020 | 3300009471 | Bacteria | 389096 |
| 19 | Ga0127521_100003 | 3300009539 | Bacteria | 647534 |
| 20 | Ga0160446_101183 | 3300012835 | Bacteria | 6139 |
| 21 | Ga0466724_47083 | 3300042649 | Bacteria | 378486 |
| 22 | Ga0063521_1001286 | 3300003973 | Bacteria | 7184 |
| 23 | Ga0103264_1000097 | 3300007188 | Bacteria | 50420 |
| 24 | Ga0136159_1000005 | 3300010217 | Bacteria | 637387 |
| 25 | Ga0160441_100321 | 3300012825 | Unclassified | 43204 |
| 26 | Ga0160444_100840 | 3300012841 | Bacteria | 8537 |
| 27 | Ga0160445_100788 | 3300012847 | Unclassified | 11942 |
| 28 | Ga0160436_1000041 | 3300012861 | Bacteria | 72279 |
| 29 | Ga0309904_1000002 | 3300029810 | Bacteria | 71744 |
| 30 | Ga0466694_354083 | 3300042594 | Bacteria | 4576 |
| 31 | CVPL005L_10017354 | 3300002938 | Bacteria | 9200 |
| 32 | Ga0127646_100058 | 3300009458 | Bacteria | 571963 |
| 33 | Ga0123356_10327380 | 3300010049 | Unclassified | 1647 |
| 34 | Ga0466713_130829 | 3300042602 | Bacteria | 17811 |
| 35 | Ga0160467_100851 | 3300012829 | Unclassified | 19642 |
| 36 | Ga0160443_100158 | 3300012848 | Bacteria | 96879 |
| 37 | Ga0466724_27476 | 3300042649 | Bacteria | 555291 |
| 38 | JGI24705J35276_12233165 | 3300002504 | Bacteria | 4689 |
| 39 | Ga0103264_1002981 | 3300007188 | Bacteria | 15468 |
| 40 | Ga0103267_1000412 | 3300007190 | Bacteria | 30489 |
| 41 | Ga0127529_1000015 | 3300009479 | Bacteria | 636679 |
| 42 | Ga0127651_100210 | 3300009483 | Bacteria | 383772 |
| 43 | Ga0123355_10253642 | 3300009826 | Bacteria | 2472 |
| 44 | Ga0466721_319176 | 3300042608 | Bacteria | 3071 |
| 45 | Ga0160457_1000087 | 3300012858 | Bacteria | 121751 |
| 46 | Ga0309903_100009 | 3300029809 | Bacteria | 55657 |
| 47 | CVPL010L_1003440 | 3300002932 | Bacteria | 1810 |
| 48 | CVPL005W_1000086 | 3300002934 | Unclassified | 40382 |
| 49 | Ga0103266_1000213 | 3300007067 | Bacteria | 21126 |
| 50 | Ga0466701_039988 | 3300042598 | Bacteria | 2089 |
| 51 | Ga0466701_052075 | 3300042598 | Unclassified | 3583 |
| 52 | Ga0466717_255710 | 3300042604 | Unclassified | 2060 |
| 53 | Ga0466710_166340 | 3300042613 | Bacteria | 1571 |
| 54 | Ga0160444_100113 | 3300012841 | Bacteria | 90988 |
| 55 | Ga0160433_100005 | 3300012846 | Bacteria | 450229 |
| 56 | Ga0466725_269445 | 3300042654 | Bacteria | 1930 |
| 57 | CVPL010W_10000001 | 3300002931 | Bacteria | 135542 |
| 58 | CVPL010L_1000417 | 3300002932 | Bacteria | 9806 |
| 59 | Ga0102734_1003730 | 3300007129 | Unclassified | 7938 |
| 60 | Ga0103264_1000404 | 3300007188 | Bacteria | 46231 |
| 61 | Ga0127530_100847 | 3300009468 | Bacteria | 73229 |
| 62 | Ga0123357_10000245 | 3300009784 | Bacteria | 51650 |
| 63 | Ga0160465_100025 | 3300012803 | Bacteria | 221206 |
| 64 | Ga0255572_1000006 | 3300026175 | Bacteria | 236537 |
| 65 | Ga0466701_006445 | 3300042598 | Bacteria | 78935 |
| 66 | Ga0466731_010315 | 3300042622 | Bacteria | 3082 |
| 67 | Ga0466730_066851 | 3300042625 | Unclassified | 2523 |
| 68 | JGI24705J35276_12238462 | 3300002504 | Bacteria | 22970 |
| 69 | CVPL010L_1000001 | 3300002932 | Bacteria | 547858 |
| 70 | Ga0103264_1000294 | 3300007188 | Bacteria | 27491 |
| 71 | Ga0127525_100070 | 3300009531 | Bacteria | 646221 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.