Protein Family IF12230
Metagenome
Isolate
175
Members
69
Samples
154
Scaffolds
423.99
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2828505942|2828506614|
- Length
- 462 aa
- Sequence
- MKILMLGWEYPPIISGGLGTATEGIVKGLLEVGHEVTLVLPHFPVKVTLPKGLKIVSPENPFIMRKKLFNNFSNSLGNKKSRYESERLMSEINENYKDLLFNSHYDYSNKQIEFSEGHKKVIKKKFLKYVNSLYKNMNISDFVSEFRKLFIDKDSYQEKAYILGLLALNIIEQDSDYHVIHANDWMTFVAAKMVKEKIDIPLFVHIHSTELDRSGEINYNEKILQIEKMGLELADMIIAVSNYTKNIIVNNFKIPNSKIKVVYNANNTKHEINNFKQSLLSLENKVPIVTFVGRVTYQKGPYYFVQAAKKVLQFNSNVMFKVVGSGDLLVSMKQLVSELKLDKNFYFTGFLNSNEVKNILADSDVFVMPSVSEPFGIVALEAIAQKIPVIISKQSGVSEVLNHVLKVDFWDTDLIADRILSVLKYHCIKSEMIDYSLQDLSQRTWIKSAETLTAAYSEIPKS
Sample Types
Isolate
12.0%
Metagenome
88.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.3%
Unclassified
28.4%
Kalotermitidae
19.4%
Rhinotermitidae
6.0%
Termopsidae
4.5%
Blattidae
3.0%
Hydrophilidae
3.0%
Hodotermitidae
1.5%
Passalidae
1.5%
Tenebrionidae
1.5%
Taxonomy
Archaea
1
Bacteria
168
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 2 | 2828505942 | Spirobacillus cienkowskii binning01 | Isolate | Unclassified |
| 3 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 11 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 14 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 2820023741 | Unclassified Spirochaetes Lab288P3bin165 | Isolate | Unclassified |
| 17 | 2820727601 | Unclassified Cloacimonetes Nt197P3bin46 | Isolate | Unclassified |
| 18 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 22 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 23 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 24 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 25 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 26 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 27 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 28 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 29 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 30 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 31 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 36 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 37 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 38 | 2820208273 | Unclassified Microgenomates Th196P3bin94 | Isolate | Unclassified |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 42 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 43 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 44 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 45 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 46 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 47 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 48 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 49 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 50 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 51 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 52 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 53 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 54 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 55 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 56 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 57 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 58 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 59 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 60 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 61 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 62 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 63 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 64 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 65 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 66 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 67 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 68 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 69 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_010836 | 3300042612 | Bacteria | 7056 |
| 2 | Ga0466705_042060 | 3300042612 | Bacteria | 13919 |
| 3 | Ga0466733_034872 | 3300042659 | Bacteria | 11561 |
| 4 | Ga0466733_169240 | 3300042659 | Bacteria | 4697 |
| 5 | Ga0265387_1001354 | 3300024582 | Bacteria | 3583 |
| 6 | Ga0466690_024348 | 3300042590 | Bacteria | 16349 |
| 7 | Ga0466695_315523 | 3300042595 | Bacteria | 24973 |
| 8 | Ga0123355_10000700 | 3300009826 | Bacteria | 45486 |
| 9 | Ga0123356_10277402 | 3300010049 | Bacteria | 1769 |
| 10 | Ga0123353_10008238 | 3300010167 | Bacteria | 14206 |
| 11 | Ga0123353_10028149 | 3300010167 | Bacteria | 8627 |
| 12 | Ga0123353_10218372 | 3300010167 | Bacteria | 2984 |
| 13 | Ga0123353_10431290 | 3300010167 | Bacteria | 1949 |
| 14 | Ga0123354_10297348 | 3300010882 | Bacteria | 1534 |
| 15 | Ga0466711_274662 | 3300042615 | Bacteria | 19079 |
| 16 | Ga0466715_017275 | 3300042616 | Bacteria | 2252 |
| 17 | Ga0466726_407218 | 3300042619 | Bacteria | 2908 |
| 18 | JGI24702J35022_10001262 | 3300002462 | Bacteria | 15781 |
| 19 | Ga0466735_177842 | 3300042624 | Bacteria | 1554 |
| 20 | Ga0466708_181194 | 3300042652 | Bacteria | 24776 |
| 21 | Ga0466706_024921 | 3300042599 | Bacteria | 4563 |
| 22 | Ga0466706_041845 | 3300042599 | Unclassified | 3812 |
| 23 | Ga0466706_053003 | 3300042599 | Unclassified | 2184 |
| 24 | Ga0466713_021467 | 3300042602 | Bacteria | 36702 |
| 25 | Ga0466733_055806 | 3300042659 | Bacteria | 2727 |
| 26 | Ga0415639_255304 | 3300038395 | Bacteria | 2785 |
| 27 | Ga0466657_053274 | 3300042582 | Bacteria | 3830 |
| 28 | Ga0466690_231213 | 3300042590 | Unclassified | 3170 |
| 29 | Ga0466691_022736 | 3300042593 | Bacteria | 17480 |
| 30 | Ga0123355_10010330 | 3300009826 | Bacteria | 14292 |
| 31 | Ga0123353_10039792 | 3300010167 | Bacteria | 7407 |
| 32 | Ga0123353_10150522 | 3300010167 | Bacteria | 3716 |
| 33 | Ga0123353_10151959 | 3300010167 | Archaea | 3695 |
| 34 | Ga0466715_285475 | 3300042616 | Bacteria | 12063 |
| 35 | Ga0466715_368745 | 3300042616 | Bacteria | 44371 |
| 36 | JGI24696J40584_12960943 | 3300002834 | Bacteria | 9557 |
| 37 | Ga0072941_1091753 | 3300005201 | Bacteria | 5077 |
| 38 | Ga0466713_113552 | 3300042602 | Bacteria | 2776 |
| 39 | Ga0466714_058710 | 3300042603 | Bacteria | 109931 |
| 40 | Ga0466714_117553 | 3300042603 | Bacteria | 17526 |
| 41 | Ga0466714_119975 | 3300042603 | Bacteria | 4930 |
| 42 | Ga0466733_073670 | 3300042659 | Bacteria | 1535 |
| 43 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 44 | Ga0415639_054865 | 3300038395 | Bacteria | 3463 |
| 45 | Ga0466657_031327 | 3300042582 | Bacteria | 2600 |
| 46 | Ga0466657_257454 | 3300042582 | Bacteria | 2023 |
| 47 | Ga0466692_104659 | 3300042591 | Bacteria | 36513 |
| 48 | Ga0466691_035670 | 3300042593 | Bacteria | 11664 |
| 49 | Ga0123353_10004662 | 3300010167 | Bacteria | 17714 |
| 50 | Ga0123353_10027644 | 3300010167 | Bacteria | 8698 |
| 51 | Ga0466711_268714 | 3300042615 | Bacteria | 10697 |
| 52 | Ga0466711_384978 | 3300042615 | Bacteria | 26666 |
| 53 | Ga0466715_181207 | 3300042616 | Bacteria | 24444 |
| 54 | Ga0466715_578748 | 3300042616 | Bacteria | 6211 |
| 55 | Ga0466723_101863 | 3300042618 | Bacteria | 35831 |
| 56 | Ga0466726_340103 | 3300042619 | Bacteria | 6321 |
| 57 | Ga0466728_003422 | 3300042620 | Bacteria | 9494 |
| 58 | Ga0466728_093793 | 3300042620 | Bacteria | 6220 |
| 59 | JGI24702J35022_10003297 | 3300002462 | Bacteria | 9749 |
| 60 | JGI24705J35276_12231883 | 3300002504 | Bacteria | 4101 |
| 61 | Ga0466703_013629 | 3300042636 | Bacteria | 2849 |
| 62 | Ga0466704_049172 | 3300042643 | Bacteria | 6272 |
| 63 | Ga0466708_370173 | 3300042652 | Bacteria | 14554 |
| 64 | Ga0466706_007312 | 3300042599 | Bacteria | 6515 |
| 65 | Ga0466713_110748 | 3300042602 | Bacteria | 2996 |
| 66 | Ga0466714_075210 | 3300042603 | Bacteria | 17760 |
| 67 | Ga0466717_294566 | 3300042604 | Bacteria | 4665 |
| 68 | Ga0466732_040314 | 3300042656 | Bacteria | 3544 |
| 69 | 2227591281 | 2225789004 | Bacteria | 48540 |
| 70 | JGI24702J35022_10002145 | 3300002462 | Bacteria | 12176 |
| 71 | Ga0072941_1025750 | 3300005201 | Bacteria | 10646 |
| 72 | Ga0072941_1036082 | 3300005201 | Unclassified | 6923 |
| 73 | Ga0466734_070901 | 3300042623 | Bacteria | 2289 |
| 74 | Ga0466730_054826 | 3300042625 | Bacteria | 4037 |
| 75 | Ga0466727_136441 | 3300042655 | Bacteria | 19395 |
| 76 | Ga0466706_213723 | 3300042599 | Bacteria | 14614 |
| 77 | Ga0466700_061944 | 3300042600 | Bacteria | 2549 |
| 78 | Ga0466714_009598 | 3300042603 | Bacteria | 4407 |
| 79 | Ga0466714_146137 | 3300042603 | Bacteria | 42453 |
| 80 | Ga0466722_167084 | 3300042609 | Bacteria | 4108 |
| 81 | Ga0466705_171946 | 3300042612 | Bacteria | 7040 |
| 82 | Ga0466705_238775 | 3300042612 | Bacteria | 8370 |
| 83 | Ga0466733_099225 | 3300042659 | Bacteria | 7640 |
| 84 | Ga0466657_085300 | 3300042582 | Bacteria | 6652 |
| 85 | Ga0466690_116257 | 3300042590 | Bacteria | 7709 |
| 86 | Ga0123356_10056708 | 3300010049 | Bacteria | 3650 |
| 87 | Ga0123356_10123699 | 3300010049 | Bacteria | 2521 |
| 88 | Ga0123353_10029847 | 3300010167 | Bacteria | 8412 |
| 89 | Ga0123354_10288765 | 3300010882 | Bacteria | 1576 |
| 90 | Ga0466711_151683 | 3300042615 | Bacteria | 4564 |
| 91 | Ga0466711_189974 | 3300042615 | Bacteria | 5477 |
| 92 | Ga0466729_139127 | 3300042621 | Bacteria | 4006 |
| 93 | JGI24705J35276_12235485 | 3300002504 | Bacteria | 6574 |
| 94 | Ga0466703_164881 | 3300042636 | Bacteria | 4837 |
| 95 | Ga0466703_331987 | 3300042636 | Bacteria | 2365 |
| 96 | Ga0466703_355781 | 3300042636 | Bacteria | 5833 |
| 97 | Ga0466708_286335 | 3300042652 | Bacteria | 16948 |
| 98 | Ga0466697_015667 | 3300042611 | Bacteria | 1279 |
| 99 | Ga0466697_272913 | 3300042611 | Bacteria | 12072 |
| 100 | Ga0466657_179854 | 3300042582 | Bacteria | 2299 |
| 101 | Ga0466690_093185 | 3300042590 | Bacteria | 6040 |
| 102 | Ga0466691_026668 | 3300042593 | Bacteria | 3460 |
| 103 | Ga0466691_053905 | 3300042593 | Bacteria | 19612 |
| 104 | Ga0466696_155458 | 3300042596 | Bacteria | 4261 |
| 105 | Ga0123356_10115721 | 3300010049 | Bacteria | 2599 |
| 106 | Ga0123356_10145590 | 3300010049 | Bacteria | 2343 |
| 107 | Ga0123353_10089501 | 3300010167 | Bacteria | 4956 |
| 108 | Ga0466723_050045 | 3300042618 | Bacteria | 16417 |
| 109 | 2227341911 | 2225789004 | Bacteria | 6240 |
| 110 | JGI24705J35276_12235370 | 3300002504 | Bacteria | 6460 |
| 111 | Ga0072940_1391490 | 3300005200 | Bacteria | 3824 |
| 112 | Ga0072941_1014336 | 3300005201 | Bacteria | 17012 |
| 113 | Ga0466704_203489 | 3300042643 | Bacteria | 4118 |
| 114 | Ga0466708_023836 | 3300042652 | Bacteria | 5482 |
| 115 | Ga0466706_089813 | 3300042599 | Bacteria | 54811 |
| 116 | Ga0466706_181757 | 3300042599 | Bacteria | 31091 |
| 117 | Ga0466714_061134 | 3300042603 | Bacteria | 3600 |
| 118 | Ga0466714_066409 | 3300042603 | Bacteria | 7079 |
| 119 | Ga0466714_120823 | 3300042603 | Bacteria | 4658 |
| 120 | Ga0466719_534117 | 3300042606 | Bacteria | 6240 |
| 121 | Ga0466697_162040 | 3300042611 | Bacteria | 2433 |
| 122 | Ga0466733_075139 | 3300042659 | Bacteria | 5840 |
| 123 | Ga0415639_046188 | 3300038395 | Bacteria | 12682 |
| 124 | Ga0415639_054866 | 3300038395 | Unclassified | 11953 |
| 125 | Ga0466656_200104 | 3300042550 | Bacteria | 5500 |
| 126 | Ga0466690_333270 | 3300042590 | Bacteria | 11132 |
| 127 | Ga0466691_227165 | 3300042593 | Bacteria | 7427 |
| 128 | Ga0466696_231722 | 3300042596 | Bacteria | 21210 |
| 129 | Ga0123354_10052024 | 3300010882 | Bacteria | 6176 |
| 130 | Ga0466705_486768 | 3300042612 | Bacteria | 3434 |
| 131 | Ga0466709_392133 | 3300042648 | Bacteria | 13579 |
| 132 | Ga0466706_011910 | 3300042599 | Bacteria | 39915 |
| 133 | Ga0466706_188460 | 3300042599 | Bacteria | 25440 |
| 134 | Ga0466706_230598 | 3300042599 | Unclassified | 1359 |
| 135 | Ga0466700_370829 | 3300042600 | Bacteria | 1469 |
| 136 | Ga0466707_372044 | 3300042601 | Bacteria | 2663 |
| 137 | Ga0466714_028404 | 3300042603 | Bacteria | 2097 |
| 138 | Ga0466714_131315 | 3300042603 | Bacteria | 35796 |
| 139 | Ga0466733_032834 | 3300042659 | Bacteria | 13907 |
| 140 | Ga0415639_062502 | 3300038395 | Bacteria | 2956 |
| 141 | Ga0466690_272889 | 3300042590 | Bacteria | 7294 |
| 142 | Ga0123357_10033407 | 3300009784 | Bacteria | 6990 |
| 143 | Ga0123355_10001902 | 3300009826 | Bacteria | 29343 |
| 144 | Ga0123353_10000175 | 3300010167 | Bacteria | 81609 |
| 145 | Ga0123353_10202659 | 3300010167 | Bacteria | 3120 |
| 146 | Ga0466728_119745 | 3300042620 | Bacteria | 20813 |
| 147 | Ga0068305_10333635 | 3300005083 | Bacteria | 5530 |
| 148 | Ga0072941_1018815 | 3300005201 | Bacteria | 18367 |
| 149 | Ga0466729_243212 | 3300042621 | Bacteria | 24352 |
| 150 | Ga0466708_277226 | 3300042652 | Bacteria | 15355 |
| 151 | Ga0466706_279275 | 3300042599 | Bacteria | 5698 |
| 152 | Ga0466714_032455 | 3300042603 | Bacteria | 12581 |
| 153 | Ga0466714_119180 | 3300042603 | Bacteria | 4609 |
| 154 | Ga0466714_149877 | 3300042603 | Bacteria | 4520 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13692 | Glyco_trans_1_4 | Glycosyl transferases group 1 | 287 | 424 | 0.91 |
| PF00534 | Glycos_transf_1 | Glycosyl transferases group 1 | 283 | 424 | 0.91 |
| PF13579 | Glyco_trans_4_4 | Glycosyl transferase 4-like domain | 169 | 264 | 0.83 |
| PF13439 | Glyco_transf_4 | Glycosyltransferase Family 4 | 165 | 268 | 0.8 |
| PF20706 | GT4-conflict | Family 4 Glycosyltransferase in conflict systems | 202 | 407 | 0.76 |
| PF08323 | Glyco_transf_5 | Starch synthase catalytic domain | 2 | 250 | 0.64 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00534 | GO:0016757 | glycosyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.