Protein Family IF12189
Metagenome
Isolate
241
Members
198
Samples
87
Scaffolds
304.86
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820854745|2820855263|
- Length
- 333 aa
- Sequence
- LSMLGTPTFQEIILALSSYWATQGCVLLQPYDTEVGAGTFHPATTLRSLGPDAWRTAYVQPSRRPTDGRYGKNPNRLQHYYQYQVLLKPSPDDVLIRYFDSLRAIGIEPAEHDIRLVEDDWESPTLGAWGLGWEVWLNGMECTQFTYFQQVGGFDCRPVSSEVTYGLERLAMYIQGVDSVYDLVWSAAPDGQLFTYADVFLANEQQYSAYNFEVADVEMLLGLFTTYEAECDRVLEAGHVLPAYDYVLKCSHAFNLLDARGAVSVTERQGYILRVRALAKACCAAYMDFIAEKADGAAQDAVPQDIVVPDVVVPDMGAQPQNVVSEGKGGGSA
Sample Types
Isolate
63.9%
Metagenome
36.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
26.0%
Apidae
15.5%
Drosophilidae
13.8%
Termitidae
8.3%
Halictidae
5.0%
Scarabaeidae
4.4%
Kalotermitidae
4.4%
Tenebrionidae
4.4%
Blattidae
3.9%
Formicidae
1.7%
Elmidae
1.7%
Dytiscidae
1.1%
Termopsidae
1.1%
Rhinotermitidae
1.1%
Gomphidae
0.6%
Nephropidae
0.6%
Vespidae
0.6%
Bombycidae
0.6%
Hodotermitidae
0.6%
Rhaphidophoridae
0.6%
Noctuidae
0.6%
Libellulidae
0.6%
Hydrophilidae
0.6%
Cerambycidae
0.6%
Passalidae
0.6%
Penaeidae
0.6%
Armadillidiidae
0.6%
Curculionidae
0.6%
Taxonomy
Archaea
0
Bacteria
228
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 2 | 2821322763 | Unclassified Actinobacteria Cu122P5bin19 | Isolate | Unclassified |
| 3 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 4 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 5 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 6 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 7 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 8 | 2964749277 | Lactiplantibacillus plantarum FlyG20.1.4 | Isolate | Drosophilidae |
| 9 | 2964775400 | Lactiplantibacillus plantarum FlyG2.1.8 | Isolate | Unclassified |
| 10 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 11 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 12 | 2728369362 | Lactiplantibacillus plantarum DF | Isolate | Drosophilidae |
| 13 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 14 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 15 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 16 | 2820053807 | Unclassified Proteobacteria Th196P3bin117 | Isolate | Unclassified |
| 17 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 20 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 21 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 22 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 23 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 24 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 25 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 26 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 27 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 28 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 29 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 30 | 2820854745 | Unclassified Actinobacteria Lab288P3bin234 | Isolate | Unclassified |
| 31 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 32 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 33 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 34 | 2937236879 | Lactiplantibacillus plantarum MHO2.4 | Isolate | |
| 35 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 36 | 2960772748 | Lactiplantibacillus plantarum MHO2.9 | Isolate | |
| 37 | 2964765680 | Lactiplantibacillus plantarum MHO2.5 | Isolate | |
| 38 | 2820907832 | Unclassified Actinobacteria Emb289P4bin29 | Isolate | Unclassified |
| 39 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 40 | 2576861670 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 41 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 42 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 43 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 44 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 45 | 2820170025 | Unclassified Proteobacteria Co191P1bin43 | Isolate | Unclassified |
| 46 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 47 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 48 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 49 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 50 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 51 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 52 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 53 | 2967825073 | Lactiplantibacillus plantarum FlyG9.1.4 | Isolate | Drosophilidae |
| 54 | 2970254690 | Lactiplantibacillus plantarum FlyG9.2.5 | Isolate | Drosophilidae |
| 55 | 2977596371 | Lactiplantibacillus plantarum FlyG11.2.6 | Isolate | Drosophilidae |
| 56 | 2977622177 | Lactiplantibacillus plantarum FlyG20.2.6 | Isolate | Drosophilidae |
| 57 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 58 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 59 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 60 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 61 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 62 | 2896402965 | Weissella diestrammenae KACC 16890 | Isolate | Rhaphidophoridae |
| 63 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 64 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 65 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 66 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 67 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 68 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 69 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 70 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 71 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 72 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 73 | 2770939318 | Lactiplantibacillus plantarum plantarum LP2 | Isolate | Apidae |
| 74 | 2820094617 | Unclassified Proteobacteria Lab288P3bin216 | Isolate | Unclassified |
| 75 | 2820134530 | Unclassified Proteobacteria Emb289P3bin65 | Isolate | Unclassified |
| 76 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 77 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 78 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 79 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 80 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 81 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 82 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 83 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 84 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 85 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 86 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 87 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 88 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 89 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 90 | 2902668162 | Lacticaseibacillus paracasei DmW_181 | Isolate | Drosophilidae |
| 91 | 2964778705 | Lactiplantibacillus plantarum DietG20.2.2_EE | Isolate | Unclassified |
| 92 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 93 | 2084038013 | Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae | Metagenome | Cerambycidae |
| 94 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 95 | 2597490293 | Lactiplantibacillus plantarum DmCS_001 | Isolate | Drosophilidae |
| 96 | 2718218475 | Lactiplantibacillus plantarum KP | Isolate | Drosophilidae |
| 97 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 98 | 2820166269 | Unclassified Proteobacteria Co191P4bin16 | Isolate | Unclassified |
| 99 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 100 | 2820411483 | Unclassified Firmicutes Lab288P4bin76 | Isolate | Unclassified |
| 101 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 102 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 103 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 104 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 105 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 106 | 2970225615 | Lactiplantibacillus plantarum FlyG8.1.1 | Isolate | Drosophilidae |
| 107 | 2977628635 | Lactiplantibacillus plantarum FlyG3.1.8 | Isolate | Drosophilidae |
| 108 | 2977653127 | Lactiplantibacillus plantarum FlyG10.1.5 | Isolate | Drosophilidae |
| 109 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 110 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 111 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 112 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 113 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 114 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 115 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 116 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 117 | 2964739456 | Lactiplantibacillus plantarum FlyG10.1.9 | Isolate | Drosophilidae |
| 118 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 119 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 120 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 121 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 122 | 2690315820 | Lactiplantibacillus plantarum WJL | Isolate | Drosophilidae |
| 123 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 124 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 125 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 126 | 2651870343 | Fructobacillus sp. EFB-N1 | Isolate | Apidae |
| 127 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 128 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 129 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 130 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 131 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 132 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 133 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 134 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 135 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 136 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 137 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 138 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 139 | 2756170272 | Convivina intestini DSM 28795 | Isolate | Unclassified |
| 140 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 141 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 142 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 143 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 144 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 145 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 146 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 147 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 148 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 149 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 150 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 151 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 152 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 153 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 154 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 155 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 156 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 157 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 158 | 2957623355 | Lactiplantibacillus plantarum FlyG11.1.2 | Isolate | Drosophilidae |
| 159 | 2873632256 | Weissella coleopterorum HDW19 | Isolate | Dytiscidae |
| 160 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 161 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 162 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 163 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 164 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 165 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 166 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 167 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 168 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 169 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 170 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 171 | 2967802344 | Lactiplantibacillus plantarum FlyG11.1.6 | Isolate | Drosophilidae |
| 172 | 2977592972 | Lactiplantibacillus plantarum FlyG7.1.6 | Isolate | Drosophilidae |
| 173 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 174 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 175 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 176 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 177 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 178 | 2834540479 | Leuconostoc citreum DmW_111 | Isolate | Drosophilidae |
| 179 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 180 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 181 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 182 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 183 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 184 | 2675903377 | Apilactobacillus kunkeei AR114 | Isolate | Unclassified |
| 185 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 186 | 2820168331 | Unclassified Proteobacteria Co191P3bin57 | Isolate | Unclassified |
| 187 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 188 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 189 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 190 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 191 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 192 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 193 | 2970199020 | Lactiplantibacillus plantarum FlyG8.1.2 | Isolate | Drosophilidae |
| 194 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 195 | 2977635137 | Lactiplantibacillus plantarum DietG20.1.2 | Isolate | Unclassified |
| 196 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 197 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 198 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0530661_000001 | 3300056564 | Bacteria | 684835 |
| 2 | Ga0562379_0258 | 3300056790 | Bacteria | 138793 |
| 3 | Ga0562375_0035 | 3300056856 | Bacteria | 623265 |
| 4 | Ga0562375_0131 | 3300056856 | Unclassified | 227882 |
| 5 | Ga0562375_2598 | 3300056856 | Unclassified | 19654 |
| 6 | Ga0123357_10127684 | 3300009784 | Bacteria | 3179 |
| 7 | Ga0160465_103166 | 3300012803 | Unclassified | 3143 |
| 8 | Ga0466707_165992 | 3300042601 | Bacteria | 110489 |
| 9 | Ga0466707_282471 | 3300042601 | Bacteria | 2464 |
| 10 | 2212252407 | 2209111004 | Bacteria | 24284 |
| 11 | Ga0466709_052071 | 3300042648 | Bacteria | 2081 |
| 12 | Ga0466697_177714 | 3300042611 | Bacteria | 1412 |
| 13 | Ga0466705_141790 | 3300042612 | Bacteria | 5124 |
| 14 | Ga0530661_000684 | 3300056564 | Unclassified | 22675 |
| 15 | Ga0562378_0279 | 3300056814 | Bacteria | 111869 |
| 16 | Ga0562374_0006 | 3300057007 | Bacteria | 2178283 |
| 17 | Ga0466728_103170 | 3300042620 | Bacteria | 22476 |
| 18 | Ga0123353_10175887 | 3300010167 | Unclassified | 3393 |
| 19 | Ga0466707_360001 | 3300042601 | Bacteria | 2279 |
| 20 | Ga0466691_114549 | 3300042593 | Bacteria | 24170 |
| 21 | Ga0562375_0304 | 3300056856 | Bacteria | 121677 |
| 22 | Ga0466715_439437 | 3300042616 | Bacteria | 13795 |
| 23 | Ga0123355_10052658 | 3300009826 | Bacteria | 6602 |
| 24 | Ga0123354_10000681 | 3300010882 | Bacteria | 36122 |
| 25 | Ga0123354_10170803 | 3300010882 | Unclassified | 2531 |
| 26 | HBC_ctgsDRAFT_1029281 | 3300000333 | Unclassified | 1352 |
| 27 | Ga0072940_1226806 | 3300005200 | Bacteria | 3550 |
| 28 | Ga0466703_422881 | 3300042636 | Bacteria | 44036 |
| 29 | Ga0466724_31216 | 3300042649 | Bacteria | 1994 |
| 30 | Ga0160443_100739 | 3300012848 | Bacteria | 17333 |
| 31 | Ga0562379_0022 | 3300056790 | Bacteria | 931623 |
| 32 | Ga0562377_0073 | 3300056842 | Bacteria | 402311 |
| 33 | Ga0562376_1206 | 3300056857 | Unclassified | 37659 |
| 34 | Ga0562374_0037 | 3300057007 | Bacteria | 679104 |
| 35 | Ga0562374_1563 | 3300057007 | Bacteria | 25967 |
| 36 | Ga0466715_062865 | 3300042616 | Bacteria | 4778 |
| 37 | Ga0123357_10007677 | 3300009784 | Bacteria | 13382 |
| 38 | Ga0466706_078168 | 3300042599 | Bacteria | 5570 |
| 39 | Ga0466706_155209 | 3300042599 | Bacteria | 186431 |
| 40 | Ga0466706_203736 | 3300042599 | Bacteria | 1121 |
| 41 | CVPL010L_1001028 | 3300002932 | Unclassified | 6462 |
| 42 | Ga0466734_086426 | 3300042623 | Bacteria | 9823 |
| 43 | Ga0466703_098671 | 3300042636 | Bacteria | 4864 |
| 44 | Ga0466691_168939 | 3300042593 | Bacteria | 15025 |
| 45 | Ga0562379_0065 | 3300056790 | Bacteria | 449364 |
| 46 | Ga0562377_0539 | 3300056842 | Bacteria | 59504 |
| 47 | Ga0466715_572420 | 3300042616 | Bacteria | 103400 |
| 48 | Ga0123356_10000022 | 3300010049 | Bacteria | 176186 |
| 49 | Ga0123353_10001151 | 3300010167 | Bacteria | 32240 |
| 50 | Ga0123354_10018580 | 3300010882 | Bacteria | 10902 |
| 51 | Ga0466719_474775 | 3300042606 | Bacteria | 19172 |
| 52 | 2227591277 | 2225789004 | Bacteria | 49030 |
| 53 | JGI24696J40584_12961190 | 3300002834 | Unclassified | 11834 |
| 54 | Ga0466729_229591 | 3300042621 | Unclassified | 1998 |
| 55 | Ga0466724_54266 | 3300042649 | Bacteria | 1496 |
| 56 | Ga0466697_243091 | 3300042611 | Bacteria | 1677 |
| 57 | Ga0562379_0009 | 3300056790 | Bacteria | 1927879 |
| 58 | Ga0562375_0005 | 3300056856 | Bacteria | 2472444 |
| 59 | Ga0562374_0725 | 3300057007 | Bacteria | 48750 |
| 60 | Ga0466701_035767 | 3300042598 | Bacteria | 128967 |
| 61 | Ga0466707_048716 | 3300042601 | Bacteria | 7008 |
| 62 | Ga0466707_284811 | 3300042601 | Bacteria | 7786 |
| 63 | Ga0466713_093617 | 3300042602 | Bacteria | 168801 |
| 64 | Ga0063521_1015340 | 3300003973 | Unclassified | 1848 |
| 65 | Ga0255572_1000643 | 3300026175 | Bacteria | 42323 |
| 66 | Ga0466656_260441 | 3300042550 | Bacteria | 1004 |
| 67 | Ga0562377_1775 | 3300056842 | Bacteria | 19874 |
| 68 | Ga0562375_0013 | 3300056856 | Bacteria | 1229523 |
| 69 | Ga0562376_0268 | 3300056857 | Bacteria | 104382 |
| 70 | Ga0466706_171848 | 3300042599 | Bacteria | 31760 |
| 71 | Ga0466706_212735 | 3300042599 | Bacteria | 6276 |
| 72 | Ga0466706_242652 | 3300042599 | Unclassified | 4035 |
| 73 | Ga0466707_076357 | 3300042601 | Bacteria | 224161 |
| 74 | AglaG_contig22869 | 2084038013 | Bacteria | 8539 |
| 75 | Ga0068302_10019901 | 3300005071 | Bacteria | 6547 |
| 76 | Ga0123357_10000529 | 3300009784 | Bacteria | 37494 |
| 77 | Ga0466727_030597 | 3300042655 | Bacteria | 6972 |
| 78 | Ga0466690_294865 | 3300042590 | Bacteria | 10648 |
| 79 | Ga0530661_000887 | 3300056564 | Bacteria | 18482 |
| 80 | Ga0562379_0044 | 3300056790 | Bacteria | 597058 |
| 81 | Ga0562379_0069 | 3300056790 | Bacteria | 430601 |
| 82 | Ga0562378_0008 | 3300056814 | Bacteria | 1370151 |
| 83 | Ga0562377_0106 | 3300056842 | Bacteria | 268063 |
| 84 | Ga0562375_3984 | 3300056856 | Bacteria | 12315 |
| 85 | Ga0123357_10036963 | 3300009784 | Bacteria | 6645 |
| 86 | Ga0160454_100011 | 3300012798 | Bacteria | 394348 |
| 87 | Ga0466702_238990 | 3300042635 | Bacteria | 163005 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02091 | tRNA-synt_2e | Glycyl-tRNA synthetase alpha subunit | 9 | 288 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.