Protein Family IF12189

Metagenome Isolate
241 Members
198 Samples
87 Scaffolds
304.86 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820854745|2820855263|
Length
333 aa
Sequence
LSMLGTPTFQEIILALSSYWATQGCVLLQPYDTEVGAGTFHPATTLRSLGPDAWRTAYVQPSRRPTDGRYGKNPNRLQHYYQYQVLLKPSPDDVLIRYFDSLRAIGIEPAEHDIRLVEDDWESPTLGAWGLGWEVWLNGMECTQFTYFQQVGGFDCRPVSSEVTYGLERLAMYIQGVDSVYDLVWSAAPDGQLFTYADVFLANEQQYSAYNFEVADVEMLLGLFTTYEAECDRVLEAGHVLPAYDYVLKCSHAFNLLDARGAVSVTERQGYILRVRALAKACCAAYMDFIAEKADGAAQDAVPQDIVVPDVVVPDMGAQPQNVVSEGKGGGSA

πŸ“Š Sample Types

Isolate 63.9%
Metagenome 36.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 26.0%
Apidae 15.5%
Drosophilidae 13.8%
Termitidae 8.3%
Halictidae 5.0%
Scarabaeidae 4.4%
Kalotermitidae 4.4%
Tenebrionidae 4.4%
Blattidae 3.9%
Formicidae 1.7%
Elmidae 1.7%
Dytiscidae 1.1%
Termopsidae 1.1%
Rhinotermitidae 1.1%
Gomphidae 0.6%
Nephropidae 0.6%
Vespidae 0.6%
Bombycidae 0.6%
Hodotermitidae 0.6%
Rhaphidophoridae 0.6%
Noctuidae 0.6%
Libellulidae 0.6%
Hydrophilidae 0.6%
Cerambycidae 0.6%
Passalidae 0.6%
Penaeidae 0.6%
Armadillidiidae 0.6%
Curculionidae 0.6%

🌳 Taxonomy

Archaea 0
Bacteria 228
Eukaryota 0
Viruses 0
Unclassified 13

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
2 2821322763 Unclassified Actinobacteria Cu122P5bin19 Isolate Unclassified
3 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
4 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
5 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
6 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
7 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
8 2964749277 Lactiplantibacillus plantarum FlyG20.1.4 Isolate Drosophilidae
9 2964775400 Lactiplantibacillus plantarum FlyG2.1.8 Isolate Unclassified
10 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
11 2595698195 Melissococcus plutonius 119 Isolate Apidae
12 2728369362 Lactiplantibacillus plantarum DF Isolate Drosophilidae
13 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
14 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
15 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
16 2820053807 Unclassified Proteobacteria Th196P3bin117 Isolate Unclassified
17 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
18 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
19 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
20 8007223943 Enterococcus sp. MSG2901 Isolate
21 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
22 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
23 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
24 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
25 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
26 2979949929 Lactobacillus sp. ESL0263 Isolate Apidae
27 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
28 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
29 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
30 2820854745 Unclassified Actinobacteria Lab288P3bin234 Isolate Unclassified
31 2827179085 Paenibacillus alvei DSM 29 Isolate Apidae
32 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
33 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
34 2937236879 Lactiplantibacillus plantarum MHO2.4 Isolate
35 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
36 2960772748 Lactiplantibacillus plantarum MHO2.9 Isolate
37 2964765680 Lactiplantibacillus plantarum MHO2.5 Isolate
38 2820907832 Unclassified Actinobacteria Emb289P4bin29 Isolate Unclassified
39 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
40 2576861670 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
41 2595698193 Melissococcus plutonius B5 Isolate Apidae
42 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
43 2758568511 Lactobacillus apis ESL0263 Isolate Unclassified
44 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
45 2820170025 Unclassified Proteobacteria Co191P1bin43 Isolate Unclassified
46 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
47 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
48 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
49 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
50 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
51 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
52 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
53 2967825073 Lactiplantibacillus plantarum FlyG9.1.4 Isolate Drosophilidae
54 2970254690 Lactiplantibacillus plantarum FlyG9.2.5 Isolate Drosophilidae
55 2977596371 Lactiplantibacillus plantarum FlyG11.2.6 Isolate Drosophilidae
56 2977622177 Lactiplantibacillus plantarum FlyG20.2.6 Isolate Drosophilidae
57 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
58 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
59 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
60 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
61 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
62 2896402965 Weissella diestrammenae KACC 16890 Isolate Rhaphidophoridae
63 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
64 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
65 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
66 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
67 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
68 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
69 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
70 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
71 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
72 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
73 2770939318 Lactiplantibacillus plantarum plantarum LP2 Isolate Apidae
74 2820094617 Unclassified Proteobacteria Lab288P3bin216 Isolate Unclassified
75 2820134530 Unclassified Proteobacteria Emb289P3bin65 Isolate Unclassified
76 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
77 8108568626 Enterococcus sp. DIV1094 Isolate
78 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
79 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
80 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
81 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
82 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
83 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
84 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
85 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
86 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
87 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
88 2864895409 Bacillus aerius S00152 Isolate Elmidae
89 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
90 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
91 2964778705 Lactiplantibacillus plantarum DietG20.2.2_EE Isolate Unclassified
92 2912324399 Lactobacillus apis ESL0185 Isolate Apidae
93 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
94 2595698197 Melissococcus plutonius H6 Isolate Apidae
95 2597490293 Lactiplantibacillus plantarum DmCS_001 Isolate Drosophilidae
96 2718218475 Lactiplantibacillus plantarum KP Isolate Drosophilidae
97 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
98 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
99 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
100 2820411483 Unclassified Firmicutes Lab288P4bin76 Isolate Unclassified
101 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
102 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
103 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
104 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
105 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
106 2970225615 Lactiplantibacillus plantarum FlyG8.1.1 Isolate Drosophilidae
107 2977628635 Lactiplantibacillus plantarum FlyG3.1.8 Isolate Drosophilidae
108 2977653127 Lactiplantibacillus plantarum FlyG10.1.5 Isolate Drosophilidae
109 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
110 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
111 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
112 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
113 8114555646 Enterococcus sp. DIV1094 Isolate
114 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
115 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
116 2940380068 Paenibacillus sp. PastH-2 Isolate Blattidae
117 2964739456 Lactiplantibacillus plantarum FlyG10.1.9 Isolate Drosophilidae
118 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
119 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
120 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
121 2627853628 Melissococcus plutonius 82 Isolate Apidae
122 2690315820 Lactiplantibacillus plantarum WJL Isolate Drosophilidae
123 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
124 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
125 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
126 2651870343 Fructobacillus sp. EFB-N1 Isolate Apidae
127 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
128 8082023105 Niallia sp. Man26 Isolate Penaeidae
129 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
130 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
131 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
132 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
133 2864909992 Bacillus velezensis S00166 Isolate Elmidae
134 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
135 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
136 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
137 2595698199 Melissococcus plutonius 60 Isolate Apidae
138 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
139 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
140 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
141 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
142 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
143 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
144 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
145 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
146 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
147 8007237282 Enterococcus sp. DIV0212c Isolate
148 8017489919 Lactobacillus brevis EF Isolate Unclassified
149 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
150 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
151 8066802609 Apilactobacillus timberlakei HV_09 Isolate Halictidae
152 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
153 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
154 3004719924 Lactobacillus sp. W8174 Isolate Apidae
155 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
156 2864801025 Bacillus aerius S00042 Isolate Elmidae
157 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
158 2957623355 Lactiplantibacillus plantarum FlyG11.1.2 Isolate Drosophilidae
159 2873632256 Weissella coleopterorum HDW19 Isolate Dytiscidae
160 2684622912 Lactobacillus apis Lb_185 Isolate Unclassified
161 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
162 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
163 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
164 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
165 2814123166 Lactobacillus apis LMG 26964 Isolate Apidae
166 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
167 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
168 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
169 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
170 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
171 2967802344 Lactiplantibacillus plantarum FlyG11.1.6 Isolate Drosophilidae
172 2977592972 Lactiplantibacillus plantarum FlyG7.1.6 Isolate Drosophilidae
173 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
174 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
175 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
176 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
177 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
178 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
179 2923762712 Apilactobacillus micheneri Hlig3 Isolate Halictidae
180 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
181 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
182 2595698198 Melissococcus plutonius L9 Isolate Apidae
183 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
184 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
185 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
186 2820168331 Unclassified Proteobacteria Co191P3bin57 Isolate Unclassified
187 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
188 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
189 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
190 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
191 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
192 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
193 2970199020 Lactiplantibacillus plantarum FlyG8.1.2 Isolate Drosophilidae
194 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
195 2977635137 Lactiplantibacillus plantarum DietG20.1.2 Isolate Unclassified
196 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
197 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
198 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0530661_000001 3300056564 Bacteria 684835
2 Ga0562379_0258 3300056790 Bacteria 138793
3 Ga0562375_0035 3300056856 Bacteria 623265
4 Ga0562375_0131 3300056856 Unclassified 227882
5 Ga0562375_2598 3300056856 Unclassified 19654
6 Ga0123357_10127684 3300009784 Bacteria 3179
7 Ga0160465_103166 3300012803 Unclassified 3143
8 Ga0466707_165992 3300042601 Bacteria 110489
9 Ga0466707_282471 3300042601 Bacteria 2464
10 2212252407 2209111004 Bacteria 24284
11 Ga0466709_052071 3300042648 Bacteria 2081
12 Ga0466697_177714 3300042611 Bacteria 1412
13 Ga0466705_141790 3300042612 Bacteria 5124
14 Ga0530661_000684 3300056564 Unclassified 22675
15 Ga0562378_0279 3300056814 Bacteria 111869
16 Ga0562374_0006 3300057007 Bacteria 2178283
17 Ga0466728_103170 3300042620 Bacteria 22476
18 Ga0123353_10175887 3300010167 Unclassified 3393
19 Ga0466707_360001 3300042601 Bacteria 2279
20 Ga0466691_114549 3300042593 Bacteria 24170
21 Ga0562375_0304 3300056856 Bacteria 121677
22 Ga0466715_439437 3300042616 Bacteria 13795
23 Ga0123355_10052658 3300009826 Bacteria 6602
24 Ga0123354_10000681 3300010882 Bacteria 36122
25 Ga0123354_10170803 3300010882 Unclassified 2531
26 HBC_ctgsDRAFT_1029281 3300000333 Unclassified 1352
27 Ga0072940_1226806 3300005200 Bacteria 3550
28 Ga0466703_422881 3300042636 Bacteria 44036
29 Ga0466724_31216 3300042649 Bacteria 1994
30 Ga0160443_100739 3300012848 Bacteria 17333
31 Ga0562379_0022 3300056790 Bacteria 931623
32 Ga0562377_0073 3300056842 Bacteria 402311
33 Ga0562376_1206 3300056857 Unclassified 37659
34 Ga0562374_0037 3300057007 Bacteria 679104
35 Ga0562374_1563 3300057007 Bacteria 25967
36 Ga0466715_062865 3300042616 Bacteria 4778
37 Ga0123357_10007677 3300009784 Bacteria 13382
38 Ga0466706_078168 3300042599 Bacteria 5570
39 Ga0466706_155209 3300042599 Bacteria 186431
40 Ga0466706_203736 3300042599 Bacteria 1121
41 CVPL010L_1001028 3300002932 Unclassified 6462
42 Ga0466734_086426 3300042623 Bacteria 9823
43 Ga0466703_098671 3300042636 Bacteria 4864
44 Ga0466691_168939 3300042593 Bacteria 15025
45 Ga0562379_0065 3300056790 Bacteria 449364
46 Ga0562377_0539 3300056842 Bacteria 59504
47 Ga0466715_572420 3300042616 Bacteria 103400
48 Ga0123356_10000022 3300010049 Bacteria 176186
49 Ga0123353_10001151 3300010167 Bacteria 32240
50 Ga0123354_10018580 3300010882 Bacteria 10902
51 Ga0466719_474775 3300042606 Bacteria 19172
52 2227591277 2225789004 Bacteria 49030
53 JGI24696J40584_12961190 3300002834 Unclassified 11834
54 Ga0466729_229591 3300042621 Unclassified 1998
55 Ga0466724_54266 3300042649 Bacteria 1496
56 Ga0466697_243091 3300042611 Bacteria 1677
57 Ga0562379_0009 3300056790 Bacteria 1927879
58 Ga0562375_0005 3300056856 Bacteria 2472444
59 Ga0562374_0725 3300057007 Bacteria 48750
60 Ga0466701_035767 3300042598 Bacteria 128967
61 Ga0466707_048716 3300042601 Bacteria 7008
62 Ga0466707_284811 3300042601 Bacteria 7786
63 Ga0466713_093617 3300042602 Bacteria 168801
64 Ga0063521_1015340 3300003973 Unclassified 1848
65 Ga0255572_1000643 3300026175 Bacteria 42323
66 Ga0466656_260441 3300042550 Bacteria 1004
67 Ga0562377_1775 3300056842 Bacteria 19874
68 Ga0562375_0013 3300056856 Bacteria 1229523
69 Ga0562376_0268 3300056857 Bacteria 104382
70 Ga0466706_171848 3300042599 Bacteria 31760
71 Ga0466706_212735 3300042599 Bacteria 6276
72 Ga0466706_242652 3300042599 Unclassified 4035
73 Ga0466707_076357 3300042601 Bacteria 224161
74 AglaG_contig22869 2084038013 Bacteria 8539
75 Ga0068302_10019901 3300005071 Bacteria 6547
76 Ga0123357_10000529 3300009784 Bacteria 37494
77 Ga0466727_030597 3300042655 Bacteria 6972
78 Ga0466690_294865 3300042590 Bacteria 10648
79 Ga0530661_000887 3300056564 Bacteria 18482
80 Ga0562379_0044 3300056790 Bacteria 597058
81 Ga0562379_0069 3300056790 Bacteria 430601
82 Ga0562378_0008 3300056814 Bacteria 1370151
83 Ga0562377_0106 3300056842 Bacteria 268063
84 Ga0562375_3984 3300056856 Bacteria 12315
85 Ga0123357_10036963 3300009784 Bacteria 6645
86 Ga0160454_100011 3300012798 Bacteria 394348
87 Ga0466702_238990 3300042635 Bacteria 163005

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02091 tRNA-synt_2e Glycyl-tRNA synthetase alpha subunit 9 288 0.98

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.