Protein Family IF12170

Metagenome Isolate
320 Members
244 Samples
136 Scaffolds
341.02 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820813074|2820813365|
Length
400 aa
Sequence
MSGKGLAGPVPGAPGACVLVTGGAGYIGSHTCVELIQGGWRVLVVDDLSNSSAEALERVRQITGCGADDLVFYEGSILDEALLDRVFAQHAIDAIIHFAGFKAVGESTEKPLAYYENNIAGTLALCKVAGAHGVKSLAFSSSATVYGDPKAVPISESCPKGIPTNPYGHTKSMIEQILFDLYASDPGWCVALLRYFNPIGAHESGLIGEDPKGIPNNLVPYVAQVAVGKRERVGVFGDDYPTPDGTGVRDYIHVVDLARGHVKALEWMARQATGGRLGDGGGRDGGSGRDGGVDVQDGTGPQGDMAAKQQGGVGVFNLGTGKGSSVLEVIRAYGQACGKPLPYEVLPRRAGDIAVSYASCEKARDELGWTAAFDLLRMCEDSWRWQSRNPDGYRSEAAVR

πŸ“Š Sample Types

Isolate 57.5%
Metagenome 42.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Coreidae 33.3%
Unclassified 14.6%
Apidae 10.8%
Termitidae 7.9%
Kalotermitidae 5.4%
Blattidae 3.3%
Formicidae 3.3%
Elmidae 2.5%
Drosophilidae 2.5%
Sarcophagidae 2.5%
Curculionidae 1.7%
Noctuidae 1.2%
Termopsidae 1.2%
Rhinotermitidae 1.2%
Berytidae 0.8%
Culicidae 0.8%
Armadillidiidae 0.8%
Largidae 0.8%
Passalidae 0.8%
Palinuridae 0.4%
Nymphalidae 0.4%
Thripidae 0.4%
Stratiomyidae 0.4%
Pediculidae 0.4%
Hodotermitidae 0.4%
Nephropidae 0.4%
Alydidae 0.4%
Majidae 0.4%
Talitridae 0.4%

🌳 Taxonomy

Archaea 0
Bacteria 304
Eukaryota 1
Viruses 0
Unclassified 15

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820857933 Unclassified Actinobacteria Lab288P3bin173 Isolate Unclassified
2 2864840607 Acinetobacter johnsonii S00071 Isolate Elmidae
3 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
4 2891690481 Commensalibacter melissae ESL0390 Isolate Apidae
5 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
6 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
7 2756170209 Commensalibacter sp. ESL0284 Isolate Unclassified
8 2820209022 Unclassified Kiritimatiellaeota Th196P3bin76 Isolate Unclassified
9 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
10 2035265002 Agrotis sp. gut microbial communities from Texas A and M University, USA Metagenome Noctuidae
11 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
12 8025658853 Caballeronia temeraria LZ065 Isolate Coreidae
13 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
14 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
15 8069770227 Caballeronia sp. LZ019 Isolate Coreidae
16 8074746876 Commensalibacter sp. W6292M3 Isolate Apidae
17 8074750600 Commensalibacter sp. W8163 Isolate Apidae
18 8101994502 Caballeronia sp. ATUFL_F2_KS42 Isolate Coreidae
19 8102124461 Caballeronia sp. INML3B Isolate Coreidae
20 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
21 8102312426 Caballeronia sp. AAUFL_F1_KS47 Isolate Coreidae
22 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
23 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
24 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
25 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
26 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
27 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
28 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
29 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
30 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
31 2832039703 Ignatzschineria cameli UAE-HKU59 Isolate Sarcophagidae
32 2864804954 Acinetobacter johnsonii S00050 Isolate Elmidae
33 2864973726 Acinetobacter schindleri S00243 Isolate Elmidae
34 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
35 2775507278 Commensalibacter papalotli (ex Servin-Garciduenas et al. 2014) MX-MONARCH01 Isolate Nymphalidae
36 2820688768 Unclassified Firmicutes Co191P1bin74 Isolate Unclassified
37 8022096067 Vibrio sp. SALL6 Isolate Unclassified
38 8023724303 Caballeronia zhejiangensis LP003 Isolate Coreidae
39 8024001094 Caballeronia sp. TF1N1 Isolate Berytidae
40 8025666332 Caballeronia grimmiae LZ050 Isolate Coreidae
41 8025694439 Caballeronia cordobensis LZ033 Isolate Coreidae
42 8025701579 Caballeronia telluris LZ031 Isolate Coreidae
43 8065338428 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
44 8074745029 Commensalibacter melissae M0407 Isolate Apidae
45 8074748739 Commensalibacter sp. W8133 Isolate Apidae
46 8101967387 Caballeronia sp. AAUFL_F3_KS11A Isolate Coreidae
47 8102007614 Caballeronia sp. ATUFL_M1_KS5A Isolate Coreidae
48 8102041249 Caballeronia sp. GACF4 Isolate Coreidae
49 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
50 8102201977 Caballeronia sp. LZ031 Isolate Coreidae
51 8102264549 Caballeronia sp. NCF2 Isolate Coreidae
52 2989793055 Vibrio atypicus DSM 25292 Isolate Unclassified
53 3006190525 Acinetobacter sp. S54 Isolate Curculionidae
54 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
55 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
56 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
57 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
58 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
59 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
60 2833052049 Commensalibacter melissae AMU001 Isolate Apidae
61 2835008077 Commensalibacter intestini DmL_052 Isolate Drosophilidae
62 2864843793 Acinetobacter johnsonii S00075 Isolate Elmidae
63 2871760914 Pantoea ananatis PANS 01-2 Isolate Thripidae
64 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
65 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
66 2820676843 Unclassified Firmicutes Co191P3bin17 Isolate Unclassified
67 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
68 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
69 641522603 Acinetobacter baumannii SDF Isolate Pediculidae
70 8025650824 Caballeronia hypogeia LZ032 Isolate Coreidae
71 8025671076 Caballeronia cordobensis LZ034LL Isolate Coreidae
72 8025735396 Caballeronia zhejiangensis LZ016 Isolate Coreidae
73 8074871419 Commensalibacter sp. M0133 Isolate Apidae
74 8074884171 Commensalibacter sp. M0355 Isolate Apidae
75 8102047609 Caballeronia sp. GACF5 Isolate Coreidae
76 8102074813 Caballeronia sp. GAWG1-1 Isolate Coreidae
77 8102081745 Caballeronia sp. GAWG1-5s-s Isolate Coreidae
78 8102117041 Caballeronia sp. INML3 Isolate Coreidae
79 8102131453 Caballeronia sp. INML5 Isolate Coreidae
80 8102138357 Caballeronia sp. INSB1 Isolate Coreidae
81 8102216467 Caballeronia sp. LZ033 Isolate Coreidae
82 8102230706 Caballeronia sp. LZ035 Isolate Coreidae
83 8102239244 Caballeronia sp. LZ043 Isolate Coreidae
84 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
85 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
86 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
87 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
88 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
89 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
90 2820813074 Unclassified Actinobacteria Nt197P3bin52 Isolate Unclassified
91 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
92 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
93 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
94 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
95 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
96 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
97 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
98 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
99 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
100 8021899934 Acinetobacter sp. AR2-3 Isolate Culicidae
101 8025716094 Caballeronia zhejiangensis LZ028 Isolate Coreidae
102 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
103 8074882376 Commensalibacter sp. M0270 Isolate Apidae
104 8101960468 Caballeronia sp. AAUFL_F2_KS46 Isolate Coreidae
105 8101988189 Caballeronia sp. ATUFL_F1_KS4A Isolate Coreidae
106 8102014801 Caballeronia sp. ATUFL_M2_KS44 Isolate Coreidae
107 8102060671 Caballeronia sp. GAFFF2 Isolate Coreidae
108 8102152052 Caballeronia sp. LZ001 Isolate Coreidae
109 8102208438 Caballeronia sp. LZ032 Isolate Coreidae
110 8102251710 Caballeronia sp. LZ065 Isolate Coreidae
111 8102279326 Caballeronia sp. NCTM1 Isolate Coreidae
112 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
113 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
114 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
115 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
116 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
117 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
118 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
119 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
120 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
121 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
122 2820811576 Unclassified Actinobacteria Nt197P3bin53 Isolate Unclassified
123 2831380896 Ignatzschineria ureiclastica KCTC 22644 Isolate Sarcophagidae
124 2864863795 Acinetobacter johnsonii S00116 Isolate Elmidae
125 2884203697 Commensalibacter melissae ESL0284 Isolate Apidae
126 2891591111 Commensalibacter sp. ESL0382 Isolate Unclassified
127 2891610497 Commensalibacter melissae ESL0367 Isolate Apidae
128 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
129 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
130 2511231129 Vibrio sp. EJY3 Isolate Unclassified
131 2513237339 Commensalibacter intestini A911 Isolate Drosophilidae
132 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
133 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
134 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
135 2820696217 Unclassified Firmicutes Co191P1bin66 Isolate Unclassified
136 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
137 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
138 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
139 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
140 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
141 8023747282 Caballeronia zhejiangensis LZ019 Isolate Coreidae
142 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
143 8024037630 Caballeronia zhejiangensis A33_M4_a Isolate Coreidae
144 8025685901 Caballeronia fortuita LZ035 Isolate Coreidae
145 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
146 8025756023 Caballeronia peredens LZ002 Isolate Coreidae
147 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
148 8078130113 Caballeronia sp. INDeC2 Isolate Coreidae
149 8100455565 Delftia sp. S67 Isolate Curculionidae
150 8102054868 Caballeronia sp. GAFFF1 Isolate Coreidae
151 8102102351 Caballeronia sp. INML1 Isolate Coreidae
152 8102161003 Caballeronia sp. LZ002 Isolate Coreidae
153 8102174626 Caballeronia sp. LZ024 Isolate Coreidae
154 8102246966 Caballeronia sp. LZ050 Isolate Coreidae
155 3003869270 Paraburkholderia sp. PGU16 Isolate Largidae
156 3006156446 Acinetobacter baretiae B10A Isolate Apidae
157 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
158 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
159 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
160 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
161 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
162 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
163 2891605396 Commensalibacter melissae ESL0392 Isolate Apidae
164 2891614855 Commensalibacter melissae ESL0379 Isolate Apidae
165 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
166 2513237114 Ignatzschineria larvae DSM 13226 Isolate Sarcophagidae
167 2528768159 Alteromonadaceae bacterium Bs31 Isolate Unclassified
168 2531839311 Acinetobacter sp. HA Isolate Noctuidae
169 2597489944 Caballeronia insecticola RPE64 Isolate Alydidae
170 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
171 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
172 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
173 8023752828 Caballeronia grimmiae LZ062 Isolate Coreidae
174 8024019580 Caballeronia sp. Lep1P3 Isolate Coreidae
175 8024044713 Caballeronia sp. Sq4a Isolate Coreidae
176 8069763219 Caballeronia sp. LZ008 Isolate Coreidae
177 8074743123 Commensalibacter melissae M0402 Isolate Apidae
178 8100449422 Delftia sp. S66 Isolate Curculionidae
179 8102001125 Caballeronia sp. ATUFL_F2_KS9A Isolate Coreidae
180 8102169119 Caballeronia sp. LZ016 Isolate Coreidae
181 8102181083 Caballeronia sp. LZ025 Isolate Coreidae
182 8102271933 Caballeronia sp. NCF4 Isolate Coreidae
183 3003878002 Paraburkholderia sp. PGU19 Isolate Largidae
184 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
185 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
186 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
187 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
188 2864874997 Acinetobacter lwoffii S00127 Isolate Elmidae
189 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
190 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
191 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
192 2820610792 Unclassified Firmicutes Emb289P1bin33 Isolate Unclassified
193 8023757577 Caballeronia peredens LP006 Isolate Coreidae
194 8023764196 Caballeronia peredens LZ001 Isolate Coreidae
195 8025678175 Caballeronia hypogeia LZ043 Isolate Coreidae
196 8025728939 Caballeronia telluris LZ024 Isolate Coreidae
197 8025747911 Caballeronia peredens LZ003 Isolate Coreidae
198 8069755105 Caballeronia sp. LZ003 Isolate Coreidae
199 8069775773 Caballeronia sp. LZ062 Isolate Coreidae
200 8074737057 Commensalibacter sp. M0357 Isolate Apidae
201 8074867669 Commensalibacter sp. B14384M2 Isolate Apidae
202 8074869529 Commensalibacter sp. B14384M3 Isolate Apidae
203 8074873247 Commensalibacter sp. M0134 Isolate Apidae
204 8074876897 Commensalibacter sp. M0266 Isolate Apidae
205 8100461708 Delftia sp. S65 Isolate Curculionidae
206 8101951471 Caballeronia sp. AAUFL_F1_KS45 Isolate Coreidae
207 8101974301 Caballeronia sp. ASUFL_F2_KS49 Isolate Coreidae
208 8101981714 Caballeronia sp. ATUFL_F1_KS39 Isolate Coreidae
209 8102020860 Caballeronia sp. AZ10_KS36 Isolate Coreidae
210 8102026984 Caballeronia sp. AZ1_KS37 Isolate Coreidae
211 8102067727 Caballeronia sp. GAFFF3 Isolate Coreidae
212 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
213 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
214 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
215 2820882373 Unclassified Actinobacteria Lab288P1bin45 Isolate Unclassified
216 2832037495 Ignatzschineria indica KCTC 22643 Isolate Sarcophagidae
217 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
218 2891675627 Commensalibacter melissae ESL0366 Isolate Apidae
219 2636415586 Vibrio harveyi NBRC 15634 Isolate Talitridae
220 2791355471 Vibrio bivalvicida 605 Isolate Unclassified
221 8024014383 Caballeronia sp. SL2Y3 Isolate Berytidae
222 8025740903 Caballeronia zhejiangensis LZ008 Isolate Coreidae
223 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
224 8069748016 Caballeronia sp. LP003 Isolate Coreidae
225 8074832014 Commensalibacter melissae M0391 Isolate Apidae
226 8074875073 Commensalibacter sp. M0265 Isolate Apidae
227 8074878724 Commensalibacter sp. M0267 Isolate Apidae
228 8074880551 Commensalibacter sp. M0268 Isolate Apidae
229 8102033761 Caballeronia sp. AZ7_KS35 Isolate Coreidae
230 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
231 8102109360 Caballeronia sp. INML2 Isolate Coreidae
232 8102145433 Caballeronia sp. LP006 Isolate Coreidae
233 8102186987 Caballeronia sp. LZ028 Isolate Coreidae
234 8102223607 Caballeronia sp. LZ034LL Isolate Coreidae
235 8102286609 Caballeronia sp. NCTM5 Isolate Coreidae
236 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
237 3300002938 Larval gut metagenome for colony PL005 Metagenome Formicidae
238 3300007078 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut Metagenome Drosophilidae
239 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
240 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
241 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
242 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
243 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
244 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10210877 3300009784 Bacteria 2182
2 Ga0123355_10000691 3300009826 Bacteria 45851
3 Ga0123355_10204330 3300009826 Bacteria 2878
4 Ga0466715_002728 3300042616 Bacteria 18684
5 Ga0466718_078392 3300042617 Bacteria 4998
6 Ga0466726_043211 3300042619 Bacteria 11924
7 Ga0466706_045255 3300042599 Bacteria 5731
8 Ga0466706_281859 3300042599 Bacteria 14832
9 Ga0466707_181989 3300042601 Bacteria 3014
10 JGI24702J35022_10051466 3300002462 Bacteria 2195
11 JGI24703J35330_11748350 3300002501 Unclassified 14436
12 CVPL005W_1000171 3300002934 Unclassified 28551
13 CVPL005L_10002609 3300002938 Unclassified 20507
14 Ga0103260_1000027 3300007139 Bacteria 71480
15 Ga0104019_1002712 3300007150 Bacteria 7562
16 Ga0104019_1191373 3300007150 Bacteria 1848
17 Ga0466703_118871 3300042636 Bacteria 17117
18 Ga0466704_607981 3300042643 Unclassified 2771
19 Ga0466708_148875 3300042652 Bacteria 14741
20 Ga0160433_100762 3300012846 Bacteria 11858
21 Ga0466696_311240 3300042596 Bacteria 1352
22 Ga0466696_390963 3300042596 Bacteria 2233
23 Ga0123355_10000351 3300009826 Bacteria 59711
24 Ga0123355_10255486 3300009826 Bacteria 2460
25 Ga0123356_10017730 3300010049 Unclassified 6766
26 Ga0123353_10085020 3300010167 Bacteria 5094
27 Ga0466715_120110 3300042616 Bacteria 76368
28 Ga0466726_373793 3300042619 Bacteria 12257
29 Ga0466713_010364 3300042602 Bacteria 21142
30 JGI24703J35330_11748601 3300002501 Unclassified 21657
31 CVPL010W_10002167 3300002931 Bacteria 23001
32 Ga0102739_1000153 3300007095 Bacteria 19022
33 Ga0160430_100439 3300012852 Unclassified 24210
34 Ga0466691_046357 3300042593 Bacteria 6524
35 Ga0123353_10000633 3300010167 Bacteria 42953
36 Ga0123353_10042499 3300010167 Bacteria 7188
37 Ga0466715_072660 3300042616 Bacteria 7232
38 Ga0466714_101428 3300042603 Bacteria 21112
39 Ga0466716_027242 3300042605 Bacteria 4262
40 JGI24695J34938_10002635 3300002450 Bacteria 13425
41 JGI24702J35022_10044400 3300002462 Bacteria 2369
42 Ga0072941_1064099 3300005201 Bacteria 42220
43 Ga0102740_1006314 3300007140 Bacteria 2125
44 Ga0466724_25668 3300042649 Unclassified 4616
45 Ga0466724_61258 3300042649 Bacteria 49653
46 Ga0415639_053720 3300038395 Bacteria 4739
47 Ga0466705_303118 3300042612 Bacteria 4448
48 Ga0466733_135655 3300042659 Bacteria 3642
49 Ga0123356_10200477 3300010049 Bacteria 2035
50 Ga0123353_10012215 3300010167 Bacteria 12185
51 Ga0123353_10119576 3300010167 Bacteria 4237
52 Ga0123353_10262728 3300010167 Bacteria 2665
53 Ga0466705_490491 3300042612 Bacteria 14557
54 Ga0466715_185145 3300042616 Bacteria 4580
55 Ga0466726_129888 3300042619 Bacteria 6025
56 Ga0466707_120789 3300042601 Bacteria 129814
57 Ga0466717_119617 3300042604 Bacteria 4961
58 Ga0466722_152782 3300042609 Bacteria 5814
59 IMNBL1DRAFT_c0002258 3300000062 Unclassified 13562
60 JGI24702J35022_10096840 3300002462 Bacteria 1611
61 Ga0074278_110274 3300005721 Bacteria 65258
62 Ga0104045_1002366 3300007085 Bacteria 3466
63 Ga0102740_1000054 3300007140 Unclassified 27264
64 Ga0466703_092914 3300042636 Bacteria 53394
65 Ga0466732_423307 3300042656 Bacteria 2577
66 Ga0123355_10023445 3300009826 Bacteria 9912
67 Ga0123353_10000813 3300010167 Bacteria 38028
68 Ga0123353_10004265 3300010167 Bacteria 18366
69 Ga0123353_10028579 3300010167 Bacteria 8572
70 Ga0466723_224621 3300042618 Bacteria 4309
71 Ga0466723_271234 3300042618 Eukaryota 1239
72 CwormDRAF_NODE_8368_len_1785_cov_185_489639 2035265002 Bacteria 1815
73 Ga0466735_123597 3300042624 Bacteria 1959
74 Ga0466730_003163 3300042625 Bacteria 80945
75 Ga0466730_060188 3300042625 Bacteria 807184
76 Ga0466730_071032 3300042625 Bacteria 7197
77 Ga0466704_439382 3300042643 Bacteria 7883
78 Ga0466709_193739 3300042648 Bacteria 5289
79 Ga0466690_194305 3300042590 Bacteria 2016
80 Ga0466701_013932 3300042598 Bacteria 93883
81 Ga0123356_10012433 3300010049 Bacteria 8260
82 Ga0123353_10041856 3300010167 Bacteria 7241
83 Ga0123353_10194514 3300010167 Bacteria 3198
84 Ga0466701_047531 3300042598 Bacteria 58092
85 Ga0466706_058827 3300042599 Bacteria 12335
86 Ga0466706_070055 3300042599 Bacteria 20111
87 2227619085 2225789004 Bacteria 11786
88 Ga0052191_101230 3300003097 Unclassified 1815
89 Ga0127649_148118 3300009460 Bacteria 2797
90 Ga0466704_310333 3300042643 Bacteria 2019
91 Ga0466704_548200 3300042643 Bacteria 4649
92 Ga0466724_43013 3300042649 Bacteria 36848
93 Ga0466727_305092 3300042655 Bacteria 5429
94 Ga0415639_012493 3300038395 Bacteria 14177
95 Ga0415639_096453 3300038395 Bacteria 2433
96 Ga0466693_166172 3300042592 Bacteria 1630
97 Ga0466693_206598 3300042592 Bacteria 1783
98 Ga0123353_10673600 3300010167 Bacteria 1459
99 Ga0466726_157855 3300042619 Bacteria 95901
100 Ga0466728_430329 3300042620 Bacteria 3935
101 Ga0466729_046526 3300042621 Unclassified 4029
102 Ga0466716_187317 3300042605 Bacteria 1717
103 Ga0466719_264490 3300042606 Bacteria 4896
104 Ga0104051_1019331 3300007078 Bacteria 2920
105 Ga0105005_1019630 3300007505 Bacteria 1984
106 Ga0123357_10000070 3300009784 Bacteria 83799
107 Ga0466729_310450 3300042621 Bacteria 3313
108 Ga0466735_090592 3300042624 Bacteria 2842
109 Ga0466703_018633 3300042636 Bacteria 1206
110 Ga0466724_28668 3300042649 Unclassified 1915
111 Ga0160447_100617 3300012849 Bacteria 15909
112 Ga0415639_028156 3300038395 Bacteria 1605
113 Ga0466696_025181 3300042596 Bacteria 2724
114 Ga0466705_174413 3300042612 Bacteria 1944
115 Ga0466733_056035 3300042659 Bacteria 12033
116 Ga0123355_10110758 3300009826 Bacteria 4290
117 Ga0123356_10400635 3300010049 Bacteria 1510
118 Ga0160464_100356 3300012805 Bacteria 37530
119 Ga0466715_021993 3300042616 Bacteria 4267
120 Ga0466723_317614 3300042618 Bacteria 6456
121 Ga0466726_347306 3300042619 Bacteria 1383
122 Ga0466717_313059 3300042604 Bacteria 6546
123 Ga0466716_281192 3300042605 Bacteria 8790
124 2227197206 2225789004 Bacteria 1448
125 IMNBL1DRAFT_c0002106 3300000062 Bacteria 14170
126 JGI24695J34938_10115298 3300002450 Bacteria 1094
127 JGI24702J35022_10068854 3300002462 Bacteria 1903
128 JGI24697J35500_11213035 3300002507 Bacteria 1791
129 JGI24696J40584_12957445 3300002834 Bacteria 3518
130 Ga0072941_1593371 3300005201 Bacteria 1392
131 Ga0103261_1000046 3300007083 Unclassified 39142
132 Ga0102737_1008971 3300007142 Unclassified 1740
133 Ga0466730_091158 3300042625 Bacteria 112660
134 Ga0160445_101683 3300012847 Bacteria 5887
135 Ga0466692_196711 3300042591 Bacteria 11771
136 Ga0466691_141569 3300042593 Bacteria 1703

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01370 Epimerase NAD dependent epimerase/dehydratase family 18 271 0.94
PF04321 RmlD_sub_bind RmlD substrate binding domain 18 178 0.92
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 19 259 0.9
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 18 200 0.83
PF00106 adh_short short chain dehydrogenase 17 119 0.82
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 19 178 0.81

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.