Protein Family IF12152
Metagenome
Isolate
130
Members
47
Samples
122
Scaffolds
400.95
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820744581|2820746848|
- Length
- 456 aa
- Sequence
- MKKCFLLMIAVMMFYSCSQKVQENAQWRGENRDGVYHETGLLKEWAAGGPQLLWSFEGLGEGFSSVAVANGKVYVAGMPDDDDLVLFVFDTSGKLLNRKVVGKEWNTSFPGSRCSPLIHEGKLYLGNSLGQLFCLDEATLDEIWKIDAIRDFDGRNIMFGVTENPLIVGDKIFWTPGGVNNNMLALNKDTGELIWSSTGTGTLSTYCSPMFIDGYSVPMVITYMAAEQQQDMGGPGGGFGGPPPGAPGPGGQGGRPGGLGGGGGPGGGPPAARPMQENKLVAFNANTGEVIWTHTQPSGNTINPNTPIYSNGHIFTSTGYGGGSWLLRLIDGGRNVEQVWHNIADNQHHGPVKVGDYVYTTAQTNRGFHCINWKTGETMFRENNHAQGVVIYADGMIYCYDDRGFVSLIKPTTDRFEVVSSFEITLGTNQHWAHPVIRDGVLYIRHGDALMAYKIK
Sample Types
Isolate
3.9%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.9%
Kalotermitidae
19.1%
Unclassified
12.8%
Rhinotermitidae
6.4%
Termopsidae
6.4%
Passalidae
4.3%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 13 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 14 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 17 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 18 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 23 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 24 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 25 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 39 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 40 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_017527 | 3300042659 | Bacteria | 9196 |
| 2 | Ga0466729_001938 | 3300042621 | Bacteria | 30694 |
| 3 | Ga0466657_171011 | 3300042582 | Bacteria | 10313 |
| 4 | Ga0466709_136607 | 3300042648 | Bacteria | 19456 |
| 5 | Ga0466708_000881 | 3300042652 | Bacteria | 14731 |
| 6 | Ga0466706_032989 | 3300042599 | Bacteria | 1914 |
| 7 | Ga0123355_10000223 | 3300009826 | Bacteria | 71620 |
| 8 | Ga0123356_10082615 | 3300010049 | Bacteria | 3042 |
| 9 | Ga0123356_10223172 | 3300010049 | Bacteria | 1942 |
| 10 | Ga0123354_10139768 | 3300010882 | Bacteria | 3003 |
| 11 | Ga0466723_277765 | 3300042618 | Bacteria | 43175 |
| 12 | Ga0415639_066537 | 3300038395 | Bacteria | 1451 |
| 13 | Ga0466656_367470 | 3300042550 | Bacteria | 1892 |
| 14 | Ga0466692_029801 | 3300042591 | Bacteria | 11515 |
| 15 | Ga0466708_378326 | 3300042652 | Bacteria | 4089 |
| 16 | Ga0466725_369481 | 3300042654 | Bacteria | 29015 |
| 17 | Ga0466701_088237 | 3300042598 | Bacteria | 1473 |
| 18 | Ga0466707_370882 | 3300042601 | Bacteria | 8893 |
| 19 | Ga0466714_033102 | 3300042603 | Bacteria | 2235 |
| 20 | Ga0123356_10158974 | 3300010049 | Bacteria | 2254 |
| 21 | Ga0123356_10365065 | 3300010049 | Bacteria | 1572 |
| 22 | Ga0123353_10113791 | 3300010167 | Bacteria | 4356 |
| 23 | Ga0123353_10386202 | 3300010167 | Bacteria | 2091 |
| 24 | JGI24698J34947_10049564 | 3300002449 | Bacteria | 2121 |
| 25 | JGI24702J35022_10005343 | 3300002462 | Bacteria | 7525 |
| 26 | JGI24702J35022_10007608 | 3300002462 | Bacteria | 6197 |
| 27 | JGI24702J35022_10016592 | 3300002462 | Bacteria | 4035 |
| 28 | JGI24702J35022_10033938 | 3300002462 | Bacteria | 2729 |
| 29 | JGI24705J35276_12234008 | 3300002504 | Bacteria | 5194 |
| 30 | Ga0068302_10003034 | 3300005071 | Bacteria | 2259 |
| 31 | Ga0466657_190877 | 3300042582 | Bacteria | 1803 |
| 32 | Ga0466703_311342 | 3300042636 | Bacteria | 9501 |
| 33 | Ga0466709_007878 | 3300042648 | Bacteria | 27583 |
| 34 | Ga0466700_452825 | 3300042600 | Bacteria | 2890 |
| 35 | Ga0123353_10006551 | 3300010167 | Bacteria | 15523 |
| 36 | Ga0123353_10357369 | 3300010167 | Bacteria | 2197 |
| 37 | 2227153021 | 2225789004 | Bacteria | 8525 |
| 38 | Ga0466733_111953 | 3300042659 | Unclassified | 2627 |
| 39 | Ga0466710_081215 | 3300042613 | Unclassified | 1469 |
| 40 | Ga0466656_255799 | 3300042550 | Bacteria | 11450 |
| 41 | Ga0466691_083787 | 3300042593 | Bacteria | 17745 |
| 42 | Ga0466725_277592 | 3300042654 | Bacteria | 6551 |
| 43 | Ga0466701_034474 | 3300042598 | Bacteria | 3067 |
| 44 | Ga0466714_055553 | 3300042603 | Bacteria | 9474 |
| 45 | Ga0466722_181839 | 3300042609 | Bacteria | 5306 |
| 46 | Ga0123356_10024551 | 3300010049 | Unclassified | 5671 |
| 47 | Ga0123353_10108000 | 3300010167 | Bacteria | 4485 |
| 48 | Ga0123353_10324425 | 3300010167 | Bacteria | 2335 |
| 49 | Ga0123353_10552339 | 3300010167 | Bacteria | 1661 |
| 50 | IMNBL1DRAFT_c0000723 | 3300000062 | Bacteria | 26182 |
| 51 | IMNBL1DRAFT_c0024491 | 3300000062 | Bacteria | 2339 |
| 52 | Ga0466711_063690 | 3300042615 | Unclassified | 2508 |
| 53 | Ga0466729_164932 | 3300042621 | Bacteria | 1488 |
| 54 | Ga0466657_214583 | 3300042582 | Bacteria | 1705 |
| 55 | Ga0466695_299578 | 3300042595 | Bacteria | 10314 |
| 56 | Ga0466696_203556 | 3300042596 | Bacteria | 11539 |
| 57 | Ga0466708_071403 | 3300042652 | Bacteria | 33717 |
| 58 | Ga0466708_101326 | 3300042652 | Bacteria | 13268 |
| 59 | Ga0466701_053165 | 3300042598 | Bacteria | 1868 |
| 60 | Ga0466700_387488 | 3300042600 | Bacteria | 3718 |
| 61 | Ga0466714_124101 | 3300042603 | Bacteria | 30720 |
| 62 | Ga0123357_10268055 | 3300009784 | Bacteria | 1790 |
| 63 | Ga0123353_10125002 | 3300010167 | Bacteria | 4134 |
| 64 | JGI24702J35022_10002842 | 3300002462 | Bacteria | 10490 |
| 65 | Ga0466697_139692 | 3300042611 | Bacteria | 246544 |
| 66 | Ga0466710_128980 | 3300042613 | Bacteria | 16866 |
| 67 | Ga0466656_302559 | 3300042550 | Bacteria | 5732 |
| 68 | Ga0466690_010061 | 3300042590 | Bacteria | 20480 |
| 69 | Ga0466693_269738 | 3300042592 | Bacteria | 2150 |
| 70 | Ga0466695_248372 | 3300042595 | Bacteria | 6392 |
| 71 | Ga0466731_045040 | 3300042622 | Bacteria | 6317 |
| 72 | Ga0466731_278919 | 3300042622 | Bacteria | 1565 |
| 73 | Ga0466735_180334 | 3300042624 | Bacteria | 1489 |
| 74 | Ga0466708_172855 | 3300042652 | Bacteria | 2580 |
| 75 | Ga0466700_031678 | 3300042600 | Bacteria | 10420 |
| 76 | Ga0466722_191964 | 3300042609 | Bacteria | 2354 |
| 77 | Ga0466722_210653 | 3300042609 | Bacteria | 14336 |
| 78 | Ga0123353_10000490 | 3300010167 | Bacteria | 48867 |
| 79 | Ga0123353_10235643 | 3300010167 | Bacteria | 2849 |
| 80 | Ga0123354_10103090 | 3300010882 | Bacteria | 3839 |
| 81 | 2227573522 | 2225789004 | Bacteria | 2590 |
| 82 | JGI24702J35022_10005275 | 3300002462 | Bacteria | 7579 |
| 83 | Ga0068302_10243383 | 3300005071 | Unclassified | 1780 |
| 84 | Ga0466718_151193 | 3300042617 | Bacteria | 1791 |
| 85 | Ga0466657_261521 | 3300042582 | Bacteria | 3938 |
| 86 | Ga0466695_000941 | 3300042595 | Bacteria | 8780 |
| 87 | Ga0466696_161473 | 3300042596 | Bacteria | 25807 |
| 88 | Ga0466700_241730 | 3300042600 | Bacteria | 13617 |
| 89 | Ga0466700_489296 | 3300042600 | Bacteria | 3077 |
| 90 | Ga0466714_092220 | 3300042603 | Bacteria | 69067 |
| 91 | Ga0466716_035836 | 3300042605 | Bacteria | 6905 |
| 92 | Ga0466716_495785 | 3300042605 | Bacteria | 9655 |
| 93 | Ga0466722_037159 | 3300042609 | Bacteria | 4216 |
| 94 | Ga0123355_10035710 | 3300009826 | Unclassified | 8080 |
| 95 | Ga0123353_10012897 | 3300010167 | Bacteria | 11925 |
| 96 | Ga0123353_10055046 | 3300010167 | Bacteria | 6362 |
| 97 | Ga0123354_10259554 | 3300010882 | Bacteria | 1739 |
| 98 | Ga0123354_10300751 | 3300010882 | Bacteria | 1518 |
| 99 | 2227632951 | 2225789004 | Bacteria | 11318 |
| 100 | IMNBL1DRAFT_c0003908 | 3300000062 | Bacteria | 9230 |
| 101 | JGI24702J35022_10010405 | 3300002462 | Bacteria | 5198 |
| 102 | JGI24702J35022_10050151 | 3300002462 | Unclassified | 2223 |
| 103 | Ga0466697_087784 | 3300042611 | Bacteria | 15141 |
| 104 | Ga0466711_267834 | 3300042615 | Bacteria | 3491 |
| 105 | Ga0466657_165814 | 3300042582 | Bacteria | 4692 |
| 106 | Ga0466657_349967 | 3300042582 | Bacteria | 5743 |
| 107 | Ga0466696_058212 | 3300042596 | Bacteria | 2732 |
| 108 | Ga0466701_001783 | 3300042598 | Bacteria | 2597 |
| 109 | Ga0466729_238277 | 3300042621 | Unclassified | 1586 |
| 110 | Ga0466735_087289 | 3300042624 | Bacteria | 4248 |
| 111 | Ga0466727_040742 | 3300042655 | Bacteria | 14140 |
| 112 | Ga0466700_156172 | 3300042600 | Bacteria | 109805 |
| 113 | Ga0466707_222820 | 3300042601 | Bacteria | 15913 |
| 114 | Ga0123356_10042745 | 3300010049 | Bacteria | 4219 |
| 115 | Ga0123356_10046340 | 3300010049 | Bacteria | 4045 |
| 116 | Ga0123356_10140289 | 3300010049 | Unclassified | 2383 |
| 117 | Ga0123356_10153291 | 3300010049 | Bacteria | 2291 |
| 118 | Ga0123356_10388647 | 3300010049 | Bacteria | 1530 |
| 119 | Ga0123353_10191105 | 3300010167 | Bacteria | 3231 |
| 120 | Ga0123353_10703252 | 3300010167 | Bacteria | 1418 |
| 121 | JGI24702J35022_10004701 | 3300002462 | Bacteria | 8087 |
| 122 | JGI24696J40584_12960167 | 3300002834 | Bacteria | 6478 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13360 | PQQ_2 | PQQ-like domain | 276 | 379 | 0.85 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.