Protein Family IF12140
Metagenome
Isolate
127
Members
69
Samples
99
Scaffolds
309.8
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820711732|2820713088|
- Length
- 363 aa
- Sequence
- MEFKHIPVLYNQCLDGLKIKPNGIYLDGTFGGGGHSRGIHSNLTTGILICVDKDIEALKASKSFFETNKNVIALHSDYKYALDKLADLQGVADNSTTNTTNAIDTTTASDTTTTKASQQALKAVQTIKALQNNTPLRLDGVLLDLGVSSYQIDNAARGFSYMNDAPLDMRMDTSASLSAYNVVNNYSASQLTKIIRDYGEEKFASKIANAIVRARGCKKSGNATPIKTTLELSNLIKNTIPKAVQFKANAGGHPAKRTFQAIRIYVNGELDSLYEVIQNFALSLNTGGRMCVITFHSLEDRLVKQAFADLAKGCVCDKKLPICICKNKPKIKLINTKPILPSIEELAQNKRASSAKLRVVEKI
Sample Types
Isolate
22.1%
Metagenome
78.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
28.1%
Termitidae
21.9%
Kalotermitidae
15.6%
Chrysomelidae
14.1%
Aphididae
7.8%
Passalidae
4.7%
Glossinidae
1.6%
Scarabaeidae
1.6%
Termopsidae
1.6%
Tenebrionidae
1.6%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820476618 | Unclassified Firmicutes Lab288P1bin80 | Isolate | Unclassified |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 2998827899 | Enterobacteriaceae endosymbiont of Donacia cincticornis DcincSym | Isolate | Chrysomelidae |
| 4 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 5 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 9 | 2511231135 | Wigglesworthia glossinidia endosymbiont of Glossina morsitans | Isolate | Glossinidae |
| 10 | 2998828354 | Enterobacteriaceae endosymbiont of Donacia vulgaris DvulSym | Isolate | Chrysomelidae |
| 11 | 2998833917 | Enterobacteriaceae endosymbiont of Donacia clavipes DclaSym | Isolate | Chrysomelidae |
| 12 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 13 | 2999138033 | Enterobacteriaceae endosymbiont of Donacia provostii DprovSym | Isolate | Chrysomelidae |
| 14 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 15 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 20 | 2820507989 | Unclassified Firmicutes Lab288P1bin41 | Isolate | Unclassified |
| 21 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 22 | 2820680340 | Unclassified Firmicutes Co191P1bin89 | Isolate | Unclassified |
| 23 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 2998830690 | Enterobacteriaceae endosymbiont of Donacia dentata DdentSym | Isolate | Chrysomelidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2998832509 | Enterobacteriaceae endosymbiont of Donacia cinerea DcinSym | Isolate | Chrysomelidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2511231158 | Buchnera aphidicola Ua | Isolate | Aphididae |
| 35 | 2654587723 | Buchnera aphidicola (Aphis glycines) BAg | Isolate | Aphididae |
| 36 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 37 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 38 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 39 | 3300009458 | Microbial communities of aphids from Asclepias tuberosa in Tucson, AZ, USA - Aphis nerii NM100509 seqcov | Metagenome | |
| 40 | 3300009533 | Microbial communities of aphids from Crataegus sp. in NC, USA - Muscaphis stroyani CVD02-21 seqcov | Metagenome | |
| 41 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 42 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 43 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 44 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 45 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 46 | 2820711732 | Unclassified Firmicutes Co191P1bin26 | Isolate | Unclassified |
| 47 | 2998831604 | Enterobacteriaceae endosymbiont of Donacia thalassina DthaSym | Isolate | Chrysomelidae |
| 48 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 49 | 8118997823 | Spiroplasma platyhelix PALS-1 | Isolate | Unclassified |
| 50 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 51 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 52 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 53 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 54 | 2998828810 | Enterobacteriaceae endosymbiont of Donacia simplex DsimSym | Isolate | Chrysomelidae |
| 55 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 56 | 3300009463 | Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov | Metagenome | |
| 57 | 3300009539 | Microbial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcov | Metagenome | Aphididae |
| 58 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 59 | 3300038942 | Host-associated microbial communities from haemolymph of Banana aphid from Africa - Madagascar | Metagenome | Aphididae |
| 60 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 61 | 2820342392 | Unclassified Firmicutes Nt197P3bin64 | Isolate | Unclassified |
| 62 | 2820468515 | Unclassified Firmicutes Lab288P1bin95 | Isolate | Unclassified |
| 63 | 637000338 | Wigglesworthia glossinidia | Isolate | Unclassified |
| 64 | 2998829729 | Enterobacteriaceae endosymbiont of Donacia sparganii DsparSym | Isolate | Chrysomelidae |
| 65 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 66 | 3300009531 | Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov | Metagenome | Aphididae |
| 67 | 2989426036 | Spiroplasma platyhelix PALS-1 | Isolate | Unclassified |
| 68 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 69 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_171587 | 3300042659 | Bacteria | 8568 |
| 2 | Ga0415639_001974 | 3300038395 | Bacteria | 35864 |
| 3 | 2227638490 | 2225789004 | Bacteria | 11177 |
| 4 | Ga0127521_100003 | 3300009539 | Bacteria | 647534 |
| 5 | Ga0123357_10001100 | 3300009784 | Unclassified | 28002 |
| 6 | Ga0466702_200102 | 3300042635 | Bacteria | 1597 |
| 7 | Ga0466704_333351 | 3300042643 | Bacteria | 1841 |
| 8 | Ga0466725_073049 | 3300042654 | Bacteria | 1539 |
| 9 | Ga0466715_096470 | 3300042616 | Bacteria | 1885 |
| 10 | Ga0466715_350462 | 3300042616 | Bacteria | 102654 |
| 11 | Ga0466726_122483 | 3300042619 | Bacteria | 1764 |
| 12 | Ga0466728_278004 | 3300042620 | Bacteria | 1997 |
| 13 | Ga0123355_10789798 | 3300009826 | Unclassified | 1062 |
| 14 | Ga0415639_012167 | 3300038395 | Bacteria | 5319 |
| 15 | Ga0415639_020413 | 3300038395 | Bacteria | 18608 |
| 16 | Ga0466696_035171 | 3300042596 | Bacteria | 31883 |
| 17 | IMNBL1DRAFT_c0000506 | 3300000062 | Bacteria | 32202 |
| 18 | Ga0068305_10001462 | 3300005083 | Unclassified | 45206 |
| 19 | Ga0466704_512941 | 3300042643 | Bacteria | 93161 |
| 20 | Ga0466704_587284 | 3300042643 | Bacteria | 3037 |
| 21 | Ga0466709_115669 | 3300042648 | Bacteria | 217304 |
| 22 | Ga0466706_069909 | 3300042599 | Bacteria | 48168 |
| 23 | Ga0466721_292375 | 3300042608 | Bacteria | 1926 |
| 24 | Ga0466698_227887 | 3300042610 | Bacteria | 14837 |
| 25 | Ga0123355_10076282 | 3300009826 | Bacteria | 5362 |
| 26 | Ga0123356_10246827 | 3300010049 | Bacteria | 1860 |
| 27 | Ga0123356_10278298 | 3300010049 | Bacteria | 1767 |
| 28 | Ga0466696_144363 | 3300042596 | Bacteria | 39172 |
| 29 | IMNBL1DRAFT_c0015541 | 3300000062 | Unclassified | 3300 |
| 30 | Ga0127646_100579 | 3300009458 | Bacteria | 62797 |
| 31 | Ga0466707_375044 | 3300042601 | Bacteria | 5816 |
| 32 | Ga0466707_383225 | 3300042601 | Bacteria | 31315 |
| 33 | Ga0123357_10059661 | 3300009784 | Bacteria | 5119 |
| 34 | Ga0123353_10011072 | 3300010167 | Bacteria | 12672 |
| 35 | Ga0123353_10011240 | 3300010167 | Unclassified | 12595 |
| 36 | Ga0415639_013613 | 3300038395 | Bacteria | 35232 |
| 37 | Ga0415639_033619 | 3300038395 | Bacteria | 14527 |
| 38 | 2227030364 | 2225789003 | Unclassified | 4547 |
| 39 | Ga0127524_100015 | 3300009478 | Bacteria | 633867 |
| 40 | Ga0466704_109257 | 3300042643 | Bacteria | 1680 |
| 41 | Ga0466706_031529 | 3300042599 | Bacteria | 6611 |
| 42 | Ga0466713_052392 | 3300042602 | Bacteria | 216200 |
| 43 | Ga0466717_189077 | 3300042604 | Bacteria | 3344 |
| 44 | Ga0466719_486957 | 3300042606 | Bacteria | 6874 |
| 45 | Ga0466705_525350 | 3300042612 | Bacteria | 2223 |
| 46 | Ga0123353_10703365 | 3300010167 | Bacteria | 1418 |
| 47 | Ga0415639_003797 | 3300038395 | Bacteria | 5442 |
| 48 | Ga0415639_024718 | 3300038395 | Bacteria | 7581 |
| 49 | Ga0415639_115265 | 3300038395 | Unclassified | 2010 |
| 50 | 2227594105 | 2225789004 | Bacteria | 2395 |
| 51 | IMNBL1DRAFT_c0000066 | 3300000062 | Bacteria | 95639 |
| 52 | Ga0466713_034384 | 3300042602 | Bacteria | 3444 |
| 53 | Ga0466723_337868 | 3300042618 | Bacteria | 1090 |
| 54 | Ga0123355_10475208 | 3300009826 | Bacteria | 1559 |
| 55 | Ga0123356_10051869 | 3300010049 | Bacteria | 3816 |
| 56 | Ga0123356_10728174 | 3300010049 | Bacteria | 1161 |
| 57 | Ga0123353_10014602 | 3300010167 | Bacteria | 11338 |
| 58 | Ga0123353_10067988 | 3300010167 | Bacteria | 5721 |
| 59 | Ga0562378_2694 | 3300056814 | Bacteria | 13538 |
| 60 | Ga0415639_127970 | 3300038395 | Bacteria | 10343 |
| 61 | 2227394696 | 2225789004 | Unclassified | 5830 |
| 62 | IMNBL1DRAFT_c0018973 | 3300000062 | Bacteria | 2837 |
| 63 | Ga0127644_100036 | 3300009463 | Bacteria | 636219 |
| 64 | Ga0466730_061847 | 3300042625 | Bacteria | 1791 |
| 65 | Ga0466703_302053 | 3300042636 | Bacteria | 49959 |
| 66 | Ga0466725_452865 | 3300042654 | Bacteria | 5583 |
| 67 | Ga0466706_078149 | 3300042599 | Bacteria | 13842 |
| 68 | Ga0466706_171833 | 3300042599 | Bacteria | 1700 |
| 69 | Ga0466716_179821 | 3300042605 | Unclassified | 1615 |
| 70 | Ga0466715_425508 | 3300042616 | Bacteria | 2752 |
| 71 | Ga0123355_10114497 | 3300009826 | Bacteria | 4204 |
| 72 | Ga0123355_10439122 | 3300009826 | Bacteria | 1654 |
| 73 | Ga0123353_10221051 | 3300010167 | Unclassified | 2961 |
| 74 | Ga0466705_256914 | 3300042612 | Bacteria | 5469 |
| 75 | Ga0415639_094559 | 3300038395 | Bacteria | 11199 |
| 76 | Ga0068305_10004648 | 3300005083 | Bacteria | 5761 |
| 77 | Ga0127645_100025 | 3300009461 | Bacteria | 631301 |
| 78 | Ga0127525_100070 | 3300009531 | Bacteria | 646221 |
| 79 | Ga0466725_005931 | 3300042654 | Bacteria | 3917 |
| 80 | Ga0466707_108750 | 3300042601 | Bacteria | 3030 |
| 81 | Ga0123355_10072650 | 3300009826 | Bacteria | 5517 |
| 82 | Ga0123355_10112930 | 3300009826 | Bacteria | 4239 |
| 83 | Ga0123356_10286884 | 3300010049 | Bacteria | 1744 |
| 84 | Ga0123353_10466568 | 3300010167 | Bacteria | 1853 |
| 85 | Ga0123353_10576064 | 3300010167 | Bacteria | 1616 |
| 86 | Ga0466705_351438 | 3300042612 | Bacteria | 8338 |
| 87 | Ga0415639_005984 | 3300038395 | Bacteria | 24530 |
| 88 | Ga0415639_078971 | 3300038395 | Bacteria | 2130 |
| 89 | Ga0120204_000017 | 3300038942 | Bacteria | 8780 |
| 90 | Ga0466694_099956 | 3300042594 | Bacteria | 22361 |
| 91 | Ga0127528_1000015 | 3300009533 | Bacteria | 619772 |
| 92 | Ga0466702_308816 | 3300042635 | Bacteria | 2173 |
| 93 | Ga0466706_063033 | 3300042599 | Bacteria | 1600 |
| 94 | Ga0466706_113039 | 3300042599 | Bacteria | 10828 |
| 95 | Ga0466700_149068 | 3300042600 | Bacteria | 2980 |
| 96 | Ga0466707_084550 | 3300042601 | Bacteria | 6965 |
| 97 | Ga0466707_397266 | 3300042601 | Bacteria | 38710 |
| 98 | Ga0466715_321200 | 3300042616 | Bacteria | 12521 |
| 99 | Ga0123356_10118494 | 3300010049 | Bacteria | 2570 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01795 | Methyltransf_5 | MraW methylase family | 2 | 363 | 0.93 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01795 | GO:0008168 | methyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.