Protein Family IF12138
Metagenome
Isolate
188
Members
69
Samples
164
Scaffolds
288.46
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820698910|2820702184|
- Length
- 311 aa
- Sequence
- VTKVMGKTSLRQGEITQRAKRKRVNRNVRRPNRSLSGDIFIVFLLCVFGFFFAFPLIFAINHAFKPMNELFMFPPRLFVINPTMNNLSDLFILMSRSWVTFSRYVFNTVFITFVGTVGHLMVASMGAYAVSKYTFPGSKAFFNLVIITLMFSGFVTAIPNFLILAQLGWIDTFWAVIIPSFAFPMGFFLLKQFIDTVPMSLVESAKIDGAGEWRIYTRIVMPLVKPAMLTAMIFSVQGLWNNPQANLIYTEQLKTLPFALQQIVGSPHTPNIARAGVGAAVAMVMMIVPIILFIVAQSNILSTMANSGIKE
Sample Types
Isolate
12.8%
Metagenome
87.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
36.8%
Termitidae
36.8%
Kalotermitidae
16.2%
Rhinotermitidae
5.9%
Termopsidae
2.9%
Hodotermitidae
1.5%
Taxonomy
Archaea
1
Bacteria
160
Eukaryota
0
Viruses
0
Unclassified
27
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 2 | 2820298281 | Unclassified Firmicutes Th196P1bin9 | Isolate | Unclassified |
| 3 | 2820490862 | Unclassified Firmicutes Lab288P1bin64 | Isolate | Unclassified |
| 4 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 7 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 14 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 15 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 16 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 25 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 26 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 27 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 28 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 29 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 30 | 2820382897 | Unclassified Firmicutes Nt197P1bin3 | Isolate | Unclassified |
| 31 | 2820463629 | Unclassified Firmicutes Lab288P3bin124 | Isolate | Unclassified |
| 32 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 33 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 34 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 35 | 2820630457 | Unclassified Firmicutes Emb289P1bin119 | Isolate | Unclassified |
| 36 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 40 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 41 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 42 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 43 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 44 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 49 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 50 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 51 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 52 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 53 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 54 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 55 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 56 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 57 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 58 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 59 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 60 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 61 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 62 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 63 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 64 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 65 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 66 | 2820380671 | Unclassified Firmicutes Nt197P1bin4 | Isolate | Unclassified |
| 67 | 2820600392 | Unclassified Firmicutes Emb289P1bin52 | Isolate | Unclassified |
| 68 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 69 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10010101 | 3300010049 | Bacteria | 9280 |
| 2 | Ga0123356_10051089 | 3300010049 | Unclassified | 3846 |
| 3 | Ga0123356_10102370 | 3300010049 | Unclassified | 2749 |
| 4 | Ga0466706_135838 | 3300042599 | Bacteria | 1470 |
| 5 | Ga0466720_108558 | 3300042607 | Bacteria | 20119 |
| 6 | Ga0466720_189522 | 3300042607 | Bacteria | 75127 |
| 7 | Ga0466722_156756 | 3300042609 | Bacteria | 24949 |
| 8 | Ga0264413_102081 | 3300024493 | Bacteria | 16871 |
| 9 | Ga0415639_002511 | 3300038395 | Bacteria | 23923 |
| 10 | Ga0415639_003223 | 3300038395 | Bacteria | 15001 |
| 11 | Ga0415639_016058 | 3300038395 | Bacteria | 16734 |
| 12 | Ga0415639_119023 | 3300038395 | Bacteria | 6561 |
| 13 | Ga0415639_215970 | 3300038395 | Bacteria | 1186 |
| 14 | Ga0466690_261120 | 3300042590 | Bacteria | 17769 |
| 15 | Ga0466694_022378 | 3300042594 | Bacteria | 11752 |
| 16 | Ga0466694_369010 | 3300042594 | Bacteria | 3252 |
| 17 | Ga0074263_115629 | 3300005485 | Unclassified | 2132 |
| 18 | Ga0466702_014257 | 3300042635 | Bacteria | 1921 |
| 19 | Ga0466709_119162 | 3300042648 | Bacteria | 25743 |
| 20 | Ga0466718_045997 | 3300042617 | Bacteria | 18502 |
| 21 | Ga0466726_467522 | 3300042619 | Bacteria | 2588 |
| 22 | Ga0466732_395551 | 3300042656 | Bacteria | 26916 |
| 23 | Ga0123355_10096961 | 3300009826 | Bacteria | 4655 |
| 24 | Ga0123356_10128684 | 3300010049 | Bacteria | 2477 |
| 25 | Ga0466706_100885 | 3300042599 | Bacteria | 1005 |
| 26 | Ga0466717_230021 | 3300042604 | Bacteria | 6936 |
| 27 | Ga0264413_103350 | 3300024493 | Bacteria | 2537 |
| 28 | Ga0415639_023273 | 3300038395 | Bacteria | 13833 |
| 29 | Ga0415639_051128 | 3300038395 | Bacteria | 1263 |
| 30 | Ga0466690_103707 | 3300042590 | Bacteria | 8624 |
| 31 | Ga0466692_092947 | 3300042591 | Bacteria | 4852 |
| 32 | Ga0466693_062276 | 3300042592 | Unclassified | 1904 |
| 33 | Ga0466693_110769 | 3300042592 | Bacteria | 1583 |
| 34 | Ga0466693_149162 | 3300042592 | Bacteria | 1855 |
| 35 | JGI24698J34947_10002300 | 3300002449 | Bacteria | 10266 |
| 36 | JGI24695J34938_10001193 | 3300002450 | Bacteria | 23039 |
| 37 | JGI24695J34938_10008174 | 3300002450 | Bacteria | 6009 |
| 38 | JGI24702J35022_10002096 | 3300002462 | Bacteria | 12315 |
| 39 | JGI24703J35330_11748323 | 3300002501 | Unclassified | 13912 |
| 40 | JGI24700J35501_10930848 | 3300002508 | Bacteria | 27915 |
| 41 | Ga0466704_044598 | 3300042643 | Bacteria | 4460 |
| 42 | Ga0466718_009670 | 3300042617 | Bacteria | 18115 |
| 43 | Ga0466718_167642 | 3300042617 | Bacteria | 6638 |
| 44 | Ga0466732_005641 | 3300042656 | Bacteria | 25741 |
| 45 | Ga0123355_10177664 | 3300009826 | Bacteria | 3167 |
| 46 | Ga0123356_10036867 | 3300010049 | Bacteria | 4564 |
| 47 | Ga0466707_204297 | 3300042601 | Bacteria | 2331 |
| 48 | Ga0466716_338719 | 3300042605 | Bacteria | 3732 |
| 49 | Ga0466720_005775 | 3300042607 | Unclassified | 2224 |
| 50 | Ga0466722_016820 | 3300042609 | Bacteria | 19174 |
| 51 | Ga0456237_0014601 | 3300041968 | Unclassified | 1119 |
| 52 | Ga0466690_009441 | 3300042590 | Bacteria | 8462 |
| 53 | Ga0466692_016538 | 3300042591 | Bacteria | 3554 |
| 54 | Ga0466694_212689 | 3300042594 | Bacteria | 44215 |
| 55 | AustNasuHG_c1001426 | 3300000089 | Bacteria | 8542 |
| 56 | AustNasuHG_c1005284 | 3300000089 | Unclassified | 4613 |
| 57 | JGI24698J34947_10056514 | 3300002449 | Bacteria | 1951 |
| 58 | JGI24703J35330_11748609 | 3300002501 | Bacteria | 21881 |
| 59 | Ga0466718_125860 | 3300042617 | Bacteria | 3813 |
| 60 | Ga0466726_331204 | 3300042619 | Bacteria | 12657 |
| 61 | Ga0123355_10003955 | 3300009826 | Bacteria | 21448 |
| 62 | Ga0123356_10011986 | 3300010049 | Bacteria | 8436 |
| 63 | Ga0123353_10000054 | 3300010167 | Bacteria | 129789 |
| 64 | Ga0123353_10005132 | 3300010167 | Bacteria | 17103 |
| 65 | Ga0466706_109638 | 3300042599 | Bacteria | 35665 |
| 66 | Ga0466721_018815 | 3300042608 | Bacteria | 91064 |
| 67 | Ga0466693_245032 | 3300042592 | Bacteria | 1774 |
| 68 | Ga0466696_395994 | 3300042596 | Bacteria | 11509 |
| 69 | AustNasuHG_c1005504 | 3300000089 | Bacteria | 4526 |
| 70 | JGI24695J34938_10001305 | 3300002450 | Bacteria | 21792 |
| 71 | Ga0466731_247163 | 3300042622 | Bacteria | 6747 |
| 72 | Ga0466709_232982 | 3300042648 | Bacteria | 15361 |
| 73 | Ga0466711_232748 | 3300042615 | Bacteria | 1401 |
| 74 | Ga0466718_023786 | 3300042617 | Bacteria | 24556 |
| 75 | Ga0466718_074668 | 3300042617 | Bacteria | 12150 |
| 76 | Ga0466732_457028 | 3300042656 | Bacteria | 4392 |
| 77 | Ga0123355_10001687 | 3300009826 | Bacteria | 30721 |
| 78 | Ga0123355_10025570 | 3300009826 | Bacteria | 9507 |
| 79 | Ga0123355_10036040 | 3300009826 | Bacteria | 8043 |
| 80 | Ga0123355_10061249 | 3300009826 | Bacteria | 6077 |
| 81 | Ga0123355_10284415 | 3300009826 | Unclassified | 2278 |
| 82 | Ga0123355_10797762 | 3300009826 | Bacteria | 1054 |
| 83 | Ga0123356_10416066 | 3300010049 | Unclassified | 1485 |
| 84 | Ga0123354_10154597 | 3300010882 | Bacteria | 2759 |
| 85 | Ga0466714_025748 | 3300042603 | Bacteria | 2379 |
| 86 | Ga0466720_080458 | 3300042607 | Bacteria | 9083 |
| 87 | Ga0415639_000672 | 3300038395 | Bacteria | 94504 |
| 88 | Ga0415639_002725 | 3300038395 | Bacteria | 8534 |
| 89 | Ga0415639_028200 | 3300038395 | Bacteria | 10013 |
| 90 | Ga0466692_175191 | 3300042591 | Unclassified | 6080 |
| 91 | Ga0466694_029156 | 3300042594 | Bacteria | 68693 |
| 92 | JGI24695J34938_10001109 | 3300002450 | Bacteria | 24296 |
| 93 | JGI24695J34938_10001520 | 3300002450 | Bacteria | 19548 |
| 94 | JGI24703J35330_11748501 | 3300002501 | Unclassified | 17822 |
| 95 | Ga0466729_235265 | 3300042621 | Bacteria | 1741 |
| 96 | Ga0466708_162792 | 3300042652 | Bacteria | 11600 |
| 97 | Ga0466705_460630 | 3300042612 | Archaea | 13331 |
| 98 | Ga0466718_126723 | 3300042617 | Unclassified | 3831 |
| 99 | Ga0466718_165039 | 3300042617 | Bacteria | 21082 |
| 100 | Ga0466726_008551 | 3300042619 | Bacteria | 4302 |
| 101 | Ga0466728_106163 | 3300042620 | Unclassified | 1240 |
| 102 | Ga0466728_251296 | 3300042620 | Bacteria | 9229 |
| 103 | Ga0123355_10000441 | 3300009826 | Bacteria | 54815 |
| 104 | Ga0123356_10003113 | 3300010049 | Bacteria | 17506 |
| 105 | Ga0123353_10286801 | 3300010167 | Bacteria | 2524 |
| 106 | Ga0466706_192338 | 3300042599 | Bacteria | 1668 |
| 107 | Ga0466707_391554 | 3300042601 | Bacteria | 2082 |
| 108 | Ga0466720_064604 | 3300042607 | Bacteria | 9993 |
| 109 | Ga0415639_005742 | 3300038395 | Bacteria | 43559 |
| 110 | Ga0415639_019435 | 3300038395 | Bacteria | 12144 |
| 111 | Ga0415639_077893 | 3300038395 | Bacteria | 4781 |
| 112 | Ga0456237_0000802 | 3300041968 | Bacteria | 4887 |
| 113 | Ga0466693_328931 | 3300042592 | Bacteria | 2251 |
| 114 | JGI24695J34938_10000581 | 3300002450 | Bacteria | 35281 |
| 115 | Ga0074263_110612 | 3300005485 | Unclassified | 3032 |
| 116 | Ga0074263_111840 | 3300005485 | Bacteria | 3550 |
| 117 | Ga0466718_079924 | 3300042617 | Bacteria | 1754 |
| 118 | Ga0123355_10000927 | 3300009826 | Bacteria | 40540 |
| 119 | Ga0466706_052945 | 3300042599 | Bacteria | 3352 |
| 120 | Ga0466717_040625 | 3300042604 | Unclassified | 1534 |
| 121 | Ga0466719_313289 | 3300042606 | Bacteria | 14836 |
| 122 | Ga0466720_003321 | 3300042607 | Bacteria | 20579 |
| 123 | Ga0466720_013529 | 3300042607 | Unclassified | 2360 |
| 124 | Ga0466720_103072 | 3300042607 | Bacteria | 18125 |
| 125 | Ga0466721_159297 | 3300042608 | Bacteria | 6278 |
| 126 | Ga0466721_214117 | 3300042608 | Bacteria | 7029 |
| 127 | Ga0415639_004985 | 3300038395 | Bacteria | 1709 |
| 128 | Ga0466690_390782 | 3300042590 | Unclassified | 1365 |
| 129 | Ga0466694_044199 | 3300042594 | Bacteria | 67264 |
| 130 | Ga0466694_323533 | 3300042594 | Bacteria | 2274 |
| 131 | AustNasuHG_c1000401 | 3300000089 | Bacteria | 15105 |
| 132 | JGI24695J34938_10001914 | 3300002450 | Bacteria | 16822 |
| 133 | JGI24695J34938_10003593 | 3300002450 | Unclassified | 10670 |
| 134 | JGI24695J34938_10003790 | 3300002450 | Bacteria | 10298 |
| 135 | JGI24700J35501_10930745 | 3300002508 | Bacteria | 21440 |
| 136 | Ga0466727_080848 | 3300042655 | Bacteria | 1225 |
| 137 | Ga0466712_004977 | 3300042614 | Bacteria | 12849 |
| 138 | Ga0466718_051728 | 3300042617 | Bacteria | 17202 |
| 139 | Ga0123355_10110575 | 3300009826 | Bacteria | 4295 |
| 140 | Ga0123355_10224783 | 3300009826 | Bacteria | 2692 |
| 141 | Ga0123353_10072024 | 3300010167 | Unclassified | 5554 |
| 142 | Ga0466706_036173 | 3300042599 | Bacteria | 14723 |
| 143 | Ga0466714_091413 | 3300042603 | Bacteria | 1862 |
| 144 | Ga0466720_104621 | 3300042607 | Bacteria | 22409 |
| 145 | Ga0415639_014248 | 3300038395 | Bacteria | 3439 |
| 146 | Ga0415639_103264 | 3300038395 | Unclassified | 3673 |
| 147 | Ga0466693_119591 | 3300042592 | Unclassified | 2781 |
| 148 | Ga0466691_024334 | 3300042593 | Bacteria | 12456 |
| 149 | Ga0466691_050768 | 3300042593 | Bacteria | 73218 |
| 150 | Ga0466696_074662 | 3300042596 | Unclassified | 1214 |
| 151 | Ga0466696_440229 | 3300042596 | Bacteria | 4995 |
| 152 | Ga0466699_368546 | 3300042597 | Bacteria | 23219 |
| 153 | AustNasuHG_c1000108 | 3300000089 | Bacteria | 24878 |
| 154 | AustNasuHG_c1027418 | 3300000089 | Unclassified | 1739 |
| 155 | JGI24702J35022_10035438 | 3300002462 | Bacteria | 2669 |
| 156 | JGI24700J35501_10930286 | 3300002508 | Bacteria | 12766 |
| 157 | Ga0074263_102903 | 3300005485 | Unclassified | 3838 |
| 158 | Ga0466729_211575 | 3300042621 | Bacteria | 3307 |
| 159 | Ga0466709_248770 | 3300042648 | Bacteria | 16656 |
| 160 | Ga0466724_01905 | 3300042649 | Bacteria | 2055 |
| 161 | Ga0466708_196078 | 3300042652 | Bacteria | 11603 |
| 162 | Ga0466708_220979 | 3300042652 | Bacteria | 3798 |
| 163 | Ga0466727_308053 | 3300042655 | Unclassified | 2581 |
| 164 | Ga0466711_001414 | 3300042615 | Unclassified | 21036 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00528 | BPD_transp_1 | Binding-protein-dependent transport system inner membrane component | 129 | 297 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.