Protein Family IF12128
Metagenome
Isolate
411
Members
135
Samples
337
Scaffolds
198.15
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820646798|2820647444|
- Length
- 220 aa
- Sequence
- MSYYSPSIEKLIESFEKLPSIGHKTAARLAFHMLNLNEEDTNEFINSIINAKKNLKYCSICYNISDTDPCQICSSPKRDSSIICVVEDVRDIIAMERTHEFKGVYHVLHGSISPMNGIGPDDIKIKELLLRLQNKAEEVIIATNPRVEGEATAMYLSKLIKPLGIKVTRIAHGIPVGGDLEYTDEITLTKALERKKRDVIWEIGMKFYFVLKKGVSNEQI
Sample Types
Isolate
18.0%
Metagenome
82.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
45.8%
Termitidae
22.1%
Kalotermitidae
10.7%
Apidae
4.6%
Scarabaeidae
3.8%
Rhinotermitidae
2.3%
Termopsidae
2.3%
Elmidae
1.5%
Tenebrionidae
1.5%
Passalidae
1.5%
Nephropidae
0.8%
Calliphoridae
0.8%
Hodotermitidae
0.8%
Drosophilidae
0.8%
Armadillidiidae
0.8%
Taxonomy
Archaea
1
Bacteria
375
Eukaryota
0
Viruses
0
Unclassified
35
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 2 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 3 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 4 | 2820450073 | Unclassified Firmicutes Lab288P3bin186 | Isolate | Unclassified |
| 5 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 6 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 7 | 2820541116 | Unclassified Firmicutes Lab288P1bin109 | Isolate | Unclassified |
| 8 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 9 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 10 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 11 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 12 | 2820848511 | Unclassified Actinobacteria Lab288P3bin86 | Isolate | Unclassified |
| 13 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 16 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 17 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 20 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 21 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 22 | 2820385248 | Unclassified Firmicutes Nt197P1bin19 | Isolate | Unclassified |
| 23 | 2820613375 | Unclassified Firmicutes Emb289P1bin134 | Isolate | Unclassified |
| 24 | 2820636287 | Unclassified Firmicutes Emb289P1bin112 | Isolate | Unclassified |
| 25 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 26 | 2820870086 | Unclassified Actinobacteria Lab288P3bin107 | Isolate | Unclassified |
| 27 | 2820871393 | Unclassified Actinobacteria Lab288P3bin101 | Isolate | Unclassified |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 30 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 31 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 32 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 33 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 34 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 35 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 36 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 37 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 41 | 2820306284 | Unclassified Firmicutes Th196P1bin11 | Isolate | Unclassified |
| 42 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 43 | 2820447167 | Unclassified Firmicutes Lab288P3bin192 | Isolate | Unclassified |
| 44 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 45 | 2820698910 | Unclassified Firmicutes Co191P1bin64 | Isolate | Unclassified |
| 46 | 2820709481 | Unclassified Firmicutes Co191P1bin30 | Isolate | Unclassified |
| 47 | 2820873081 | Unclassified Actinobacteria Lab288P1bin96 | Isolate | Unclassified |
| 48 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 49 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 50 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 51 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 52 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 53 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 54 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 55 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 56 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 57 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 58 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 59 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 60 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 61 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 62 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 63 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 64 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 65 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 66 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 67 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 68 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 69 | 2820556368 | Unclassified Firmicutes Emb289P3bin92 | Isolate | Unclassified |
| 70 | 2820634724 | Unclassified Firmicutes Emb289P1bin116 | Isolate | Unclassified |
| 71 | 2820940989 | Unclassified Actinobacteria Emb289P1bin20 | Isolate | Unclassified |
| 72 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 73 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 74 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 75 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 76 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 77 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 78 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 79 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 80 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 81 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 82 | 2820426531 | Unclassified Firmicutes Lab288P3bin45 | Isolate | Unclassified |
| 83 | 2820459456 | Unclassified Firmicutes Lab288P3bin148 | Isolate | Unclassified |
| 84 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 85 | 2820627938 | Unclassified Firmicutes Emb289P1bin122 | Isolate | Unclassified |
| 86 | 2820681712 | Unclassified Firmicutes Co191P1bin84 | Isolate | Unclassified |
| 87 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 88 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 89 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 90 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 91 | 2590828841 | Oscillospiraceae bacterium Ne3 | Isolate | Termitidae |
| 92 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 93 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 94 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 95 | 2820633305 | Unclassified Firmicutes Emb289P1bin118 | Isolate | Unclassified |
| 96 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 97 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 98 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 99 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 100 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 101 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 102 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 103 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 104 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 105 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 106 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 107 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 108 | 2820439761 | Unclassified Firmicutes Lab288P3bin203 | Isolate | Unclassified |
| 109 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 110 | 2820565217 | Unclassified Firmicutes Emb289P3bin51 | Isolate | Unclassified |
| 111 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 112 | 2820607737 | Unclassified Firmicutes Emb289P1bin48 | Isolate | Unclassified |
| 113 | 2820646798 | Unclassified Firmicutes Cu122P5bin36 | Isolate | Unclassified |
| 114 | 2820663833 | Unclassified Firmicutes Co191P3bin41 | Isolate | Unclassified |
| 115 | 2820939604 | Unclassified Actinobacteria Emb289P1bin4 | Isolate | Unclassified |
| 116 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 117 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 118 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 119 | 642555127 | Elusimicrobium minutum Pei191 | Isolate | Unclassified |
| 120 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 121 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 122 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 123 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 124 | 2820880921 | Unclassified Actinobacteria Lab288P1bin60 | Isolate | Unclassified |
| 125 | 2820893114 | Unclassified Actinobacteria Lab288P1bin125 | Isolate | Unclassified |
| 126 | 2820934415 | Unclassified Actinobacteria Emb289P1bin68 | Isolate | Unclassified |
| 127 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 128 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 129 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 130 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 131 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 132 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 133 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 134 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 135 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_140840 | 3300042611 | Bacteria | 1355 |
| 2 | Ga0466705_080272 | 3300042612 | Bacteria | 96661 |
| 3 | Ga0123357_10370273 | 3300009784 | Bacteria | 1344 |
| 4 | Ga0123355_10000118 | 3300009826 | Bacteria | 90212 |
| 5 | Ga0123355_10003474 | 3300009826 | Bacteria | 22591 |
| 6 | Ga0123355_10007038 | 3300009826 | Bacteria | 16764 |
| 7 | Ga0123355_10095153 | 3300009826 | Bacteria | 4709 |
| 8 | Ga0123355_10866957 | 3300009826 | Bacteria | 989 |
| 9 | Ga0123353_10094924 | 3300010167 | Bacteria | 4805 |
| 10 | Ga0123353_10118625 | 3300010167 | Bacteria | 4255 |
| 11 | Ga0123353_10160797 | 3300010167 | Bacteria | 3576 |
| 12 | Ga0123353_10363461 | 3300010167 | Bacteria | 2173 |
| 13 | Ga0123353_10571244 | 3300010167 | Bacteria | 1625 |
| 14 | Ga0123353_10720274 | 3300010167 | Bacteria | 1396 |
| 15 | Ga0123353_10754396 | 3300010167 | Bacteria | 1354 |
| 16 | Ga0466700_286262 | 3300042600 | Bacteria | 1890 |
| 17 | Ga0466707_369754 | 3300042601 | Bacteria | 39917 |
| 18 | Ga0466707_403130 | 3300042601 | Bacteria | 1341 |
| 19 | Ga0466719_001763 | 3300042606 | Bacteria | 1520 |
| 20 | Ga0466719_046085 | 3300042606 | Bacteria | 10202 |
| 21 | Ga0415639_089437 | 3300038395 | Bacteria | 1328 |
| 22 | Ga0466690_206359 | 3300042590 | Unclassified | 5727 |
| 23 | Ga0466692_036445 | 3300042591 | Bacteria | 12692 |
| 24 | Ga0466692_044897 | 3300042591 | Bacteria | 12981 |
| 25 | Ga0466696_232235 | 3300042596 | Bacteria | 1069 |
| 26 | IMNBL1DRAFT_c0002016 | 3300000062 | Bacteria | 14554 |
| 27 | JGI24702J35022_10329489 | 3300002462 | Bacteria | 908 |
| 28 | JGI24700J35501_10930845 | 3300002508 | Bacteria | 27731 |
| 29 | JGI24696J40584_12961109 | 3300002834 | Bacteria | 10775 |
| 30 | Ga0068302_10325357 | 3300005071 | Unclassified | 2619 |
| 31 | Ga0466711_108654 | 3300042615 | Bacteria | 3750 |
| 32 | Ga0466711_166091 | 3300042615 | Bacteria | 3442 |
| 33 | Ga0466711_212322 | 3300042615 | Unclassified | 3234 |
| 34 | Ga0466711_251373 | 3300042615 | Bacteria | 2388 |
| 35 | Ga0466715_428250 | 3300042616 | Bacteria | 21415 |
| 36 | Ga0466715_609021 | 3300042616 | Bacteria | 6496 |
| 37 | Ga0466726_216905 | 3300042619 | Bacteria | 4464 |
| 38 | Ga0466726_319100 | 3300042619 | Bacteria | 73697 |
| 39 | Ga0466703_143520 | 3300042636 | Unclassified | 1048 |
| 40 | Ga0466697_077275 | 3300042611 | Bacteria | 1061 |
| 41 | Ga0123355_10041966 | 3300009826 | Bacteria | 7448 |
| 42 | Ga0123355_10044086 | 3300009826 | Bacteria | 7259 |
| 43 | Ga0123355_10171299 | 3300009826 | Bacteria | 3245 |
| 44 | Ga0123355_10281515 | 3300009826 | Unclassified | 2295 |
| 45 | Ga0123355_10290865 | 3300009826 | Bacteria | 2242 |
| 46 | Ga0123355_10322132 | 3300009826 | Bacteria | 2081 |
| 47 | Ga0123355_10368791 | 3300009826 | Bacteria | 1883 |
| 48 | Ga0123355_10411715 | 3300009826 | Bacteria | 1735 |
| 49 | Ga0123355_10766548 | 3300009826 | Bacteria | 1086 |
| 50 | Ga0123355_11268407 | 3300009826 | Bacteria | 743 |
| 51 | Ga0123356_10054607 | 3300010049 | Bacteria | 3721 |
| 52 | Ga0123356_10146109 | 3300010049 | Bacteria | 2340 |
| 53 | Ga0123356_10204149 | 3300010049 | Bacteria | 2019 |
| 54 | Ga0123356_11579877 | 3300010049 | Bacteria | 811 |
| 55 | Ga0123353_10039844 | 3300010167 | Bacteria | 7403 |
| 56 | Ga0123353_10195320 | 3300010167 | Bacteria | 3190 |
| 57 | Ga0123353_11062652 | 3300010167 | Bacteria | 1080 |
| 58 | Ga0123354_10525383 | 3300010882 | Bacteria | 907 |
| 59 | Ga0466700_003823 | 3300042600 | Bacteria | 3026 |
| 60 | Ga0466700_107581 | 3300042600 | Bacteria | 2219 |
| 61 | Ga0466707_154360 | 3300042601 | Bacteria | 1424 |
| 62 | Ga0466713_044186 | 3300042602 | Bacteria | 91853 |
| 63 | Ga0466713_066732 | 3300042602 | Bacteria | 49983 |
| 64 | Ga0466714_027593 | 3300042603 | Bacteria | 2305 |
| 65 | Ga0466717_193749 | 3300042604 | Bacteria | 3896 |
| 66 | Ga0466719_101832 | 3300042606 | Unclassified | 1189 |
| 67 | Ga0466721_062486 | 3300042608 | Bacteria | 1169 |
| 68 | Ga0466722_060115 | 3300042609 | Bacteria | 1481 |
| 69 | Ga0466722_126079 | 3300042609 | Bacteria | 3285 |
| 70 | Ga0415639_018960 | 3300038395 | Bacteria | 3425 |
| 71 | Ga0415639_119167 | 3300038395 | Bacteria | 2973 |
| 72 | Ga0466696_072883 | 3300042596 | Bacteria | 5921 |
| 73 | Ga0466696_087383 | 3300042596 | Bacteria | 4131 |
| 74 | Ga0466696_412875 | 3300042596 | Archaea | 2909 |
| 75 | JGI24700J35501_10930364 | 3300002508 | Unclassified | 13361 |
| 76 | Ga0068302_10216786 | 3300005071 | Bacteria | 803 |
| 77 | Ga0104050_1206319 | 3300007153 | Bacteria | 1198 |
| 78 | Ga0466715_045706 | 3300042616 | Bacteria | 6098 |
| 79 | Ga0466715_628827 | 3300042616 | Bacteria | 11939 |
| 80 | Ga0466726_265532 | 3300042619 | Bacteria | 27292 |
| 81 | Ga0466726_282199 | 3300042619 | Bacteria | 65461 |
| 82 | Ga0466728_034414 | 3300042620 | Bacteria | 2513 |
| 83 | Ga0466730_026044 | 3300042625 | Bacteria | 3110 |
| 84 | Ga0466703_198853 | 3300042636 | Bacteria | 1792 |
| 85 | Ga0466709_126666 | 3300042648 | Bacteria | 28320 |
| 86 | Ga0466708_003847 | 3300042652 | Bacteria | 3240 |
| 87 | Ga0466705_114967 | 3300042612 | Bacteria | 24474 |
| 88 | Ga0466705_337288 | 3300042612 | Bacteria | 10973 |
| 89 | Ga0123357_10213472 | 3300009784 | Bacteria | 2161 |
| 90 | Ga0123355_10000193 | 3300009826 | Bacteria | 75741 |
| 91 | Ga0123355_10000793 | 3300009826 | Bacteria | 43171 |
| 92 | Ga0123355_10001349 | 3300009826 | Bacteria | 34065 |
| 93 | Ga0123355_10003765 | 3300009826 | Bacteria | 21930 |
| 94 | Ga0123355_10012533 | 3300009826 | Bacteria | 13138 |
| 95 | Ga0123355_10061002 | 3300009826 | Bacteria | 6089 |
| 96 | Ga0123355_10113099 | 3300009826 | Bacteria | 4235 |
| 97 | Ga0123355_10787675 | 3300009826 | Bacteria | 1064 |
| 98 | Ga0123356_10005517 | 3300010049 | Unclassified | 12870 |
| 99 | Ga0123356_10010646 | 3300010049 | Bacteria | 9003 |
| 100 | Ga0123356_11889986 | 3300010049 | Unclassified | 743 |
| 101 | Ga0123353_10079662 | 3300010167 | Bacteria | 5267 |
| 102 | Ga0123353_10368834 | 3300010167 | Bacteria | 2154 |
| 103 | Ga0123353_10697277 | 3300010167 | Bacteria | 1426 |
| 104 | Ga0123353_10999326 | 3300010167 | Bacteria | 1124 |
| 105 | Ga0123353_11412410 | 3300010167 | Bacteria | 894 |
| 106 | Ga0466706_061256 | 3300042599 | Bacteria | 1584 |
| 107 | Ga0466700_189535 | 3300042600 | Bacteria | 1757 |
| 108 | Ga0466714_139319 | 3300042603 | Bacteria | 1354 |
| 109 | Ga0466722_099170 | 3300042609 | Bacteria | 11738 |
| 110 | Ga0466722_264574 | 3300042609 | Bacteria | 2059 |
| 111 | Ga0415639_023683 | 3300038395 | Bacteria | 1415 |
| 112 | Ga0415639_038558 | 3300038395 | Bacteria | 3567 |
| 113 | Ga0415639_153986 | 3300038395 | Bacteria | 3160 |
| 114 | Ga0466693_292177 | 3300042592 | Bacteria | 1551 |
| 115 | Ga0466696_415840 | 3300042596 | Bacteria | 1092 |
| 116 | IMNBL1DRAFT_c0028624 | 3300000062 | Bacteria | 2075 |
| 117 | JGI24702J35022_10361159 | 3300002462 | Bacteria | 870 |
| 118 | Ga0466705_465553 | 3300042612 | Bacteria | 1715 |
| 119 | Ga0466715_356066 | 3300042616 | Bacteria | 4798 |
| 120 | Ga0466723_038043 | 3300042618 | Unclassified | 2757 |
| 121 | Ga0466726_341262 | 3300042619 | Bacteria | 7658 |
| 122 | Ga0466729_094923 | 3300042621 | Bacteria | 10202 |
| 123 | Ga0466703_251178 | 3300042636 | Bacteria | 5454 |
| 124 | Ga0466704_031184 | 3300042643 | Bacteria | 6002 |
| 125 | Ga0466724_00332 | 3300042649 | Unclassified | 2951 |
| 126 | Ga0466708_402143 | 3300042652 | Bacteria | 39815 |
| 127 | Ga0466727_293727 | 3300042655 | Bacteria | 2212 |
| 128 | Ga0123357_10007693 | 3300009784 | Bacteria | 13366 |
| 129 | Ga0123357_10178796 | 3300009784 | Bacteria | 2485 |
| 130 | Ga0123357_10282775 | 3300009784 | Unclassified | 1710 |
| 131 | Ga0123355_10000338 | 3300009826 | Bacteria | 60591 |
| 132 | Ga0123355_10004124 | 3300009826 | Bacteria | 21060 |
| 133 | Ga0123355_10011345 | 3300009826 | Bacteria | 13728 |
| 134 | Ga0123355_10016483 | 3300009826 | Bacteria | 11646 |
| 135 | Ga0123355_10034341 | 3300009826 | Bacteria | 8241 |
| 136 | Ga0123355_10109050 | 3300009826 | Bacteria | 4331 |
| 137 | Ga0123355_10222455 | 3300009826 | Bacteria | 2712 |
| 138 | Ga0123355_10248602 | 3300009826 | Bacteria | 2508 |
| 139 | Ga0123355_10323638 | 3300009826 | Unclassified | 2074 |
| 140 | Ga0123355_10412264 | 3300009826 | Bacteria | 1733 |
| 141 | Ga0123355_10570741 | 3300009826 | Bacteria | 1358 |
| 142 | Ga0123355_10684876 | 3300009826 | Bacteria | 1183 |
| 143 | Ga0123355_10948110 | 3300009826 | Bacteria | 925 |
| 144 | Ga0123355_10993580 | 3300009826 | Bacteria | 893 |
| 145 | Ga0123356_10003933 | 3300010049 | Bacteria | 15453 |
| 146 | Ga0123356_10102431 | 3300010049 | Bacteria | 2748 |
| 147 | Ga0123356_10211213 | 3300010049 | Bacteria | 1990 |
| 148 | Ga0123353_10000374 | 3300010167 | Bacteria | 54815 |
| 149 | Ga0123353_10069760 | 3300010167 | Bacteria | 5646 |
| 150 | Ga0123353_10165013 | 3300010167 | Bacteria | 3522 |
| 151 | Ga0123353_10487610 | 3300010167 | Bacteria | 1801 |
| 152 | Ga0123353_11873656 | 3300010167 | Bacteria | 741 |
| 153 | Ga0123354_10302348 | 3300010882 | Bacteria | 1511 |
| 154 | Ga0466701_064136 | 3300042598 | Bacteria | 1446 |
| 155 | Ga0466700_462526 | 3300042600 | Bacteria | 1013 |
| 156 | Ga0466707_037407 | 3300042601 | Bacteria | 17355 |
| 157 | Ga0466714_070058 | 3300042603 | Bacteria | 28115 |
| 158 | Ga0160445_104420 | 3300012847 | Bacteria | 2571 |
| 159 | Ga0466691_224339 | 3300042593 | Bacteria | 4443 |
| 160 | Ga0466696_355455 | 3300042596 | Bacteria | 3914 |
| 161 | IMNBL1DRAFT_c0002633 | 3300000062 | Bacteria | 12285 |
| 162 | Ga0466710_075046 | 3300042613 | Bacteria | 2814 |
| 163 | Ga0466729_050450 | 3300042621 | Bacteria | 1605 |
| 164 | Ga0466734_085994 | 3300042623 | Bacteria | 1938 |
| 165 | Ga0466704_048976 | 3300042643 | Unclassified | 1033 |
| 166 | Ga0466725_024333 | 3300042654 | Bacteria | 24161 |
| 167 | Ga0466705_134465 | 3300042612 | Bacteria | 10747 |
| 168 | Ga0466705_376055 | 3300042612 | Bacteria | 10383 |
| 169 | Ga0466733_193687 | 3300042659 | Bacteria | 1140 |
| 170 | Ga0123355_10006227 | 3300009826 | Unclassified | 17635 |
| 171 | Ga0123355_10396225 | 3300009826 | Bacteria | 1785 |
| 172 | Ga0123355_11042283 | 3300009826 | Bacteria | 861 |
| 173 | Ga0123355_11074687 | 3300009826 | Bacteria | 841 |
| 174 | Ga0123356_10003134 | 3300010049 | Bacteria | 17427 |
| 175 | Ga0123356_10131993 | 3300010049 | Bacteria | 2449 |
| 176 | Ga0123356_10269768 | 3300010049 | Bacteria | 1791 |
| 177 | Ga0123356_11199236 | 3300010049 | Bacteria | 925 |
| 178 | Ga0123353_10067496 | 3300010167 | Bacteria | 5743 |
| 179 | Ga0123353_10653918 | 3300010167 | Bacteria | 1487 |
| 180 | Ga0123353_11052695 | 3300010167 | Bacteria | 1086 |
| 181 | Ga0123353_11246161 | 3300010167 | Bacteria | 971 |
| 182 | Ga0466701_093560 | 3300042598 | Bacteria | 3805 |
| 183 | Ga0466706_206907 | 3300042599 | Bacteria | 2177 |
| 184 | Ga0466700_197038 | 3300042600 | Bacteria | 9256 |
| 185 | Ga0466707_204757 | 3300042601 | Bacteria | 96467 |
| 186 | Ga0466714_086734 | 3300042603 | Unclassified | 1109 |
| 187 | Ga0466714_102336 | 3300042603 | Bacteria | 7006 |
| 188 | Ga0466714_169121 | 3300042603 | Bacteria | 3903 |
| 189 | Ga0466717_312347 | 3300042604 | Bacteria | 1345 |
| 190 | Ga0466719_323622 | 3300042606 | Bacteria | 1643 |
| 191 | Ga0466719_422188 | 3300042606 | Bacteria | 1370 |
| 192 | Ga0466719_532913 | 3300042606 | Bacteria | 3881 |
| 193 | Ga0466722_017039 | 3300042609 | Bacteria | 2241 |
| 194 | Ga0415639_007172 | 3300038395 | Bacteria | 21430 |
| 195 | Ga0466694_341593 | 3300042594 | Bacteria | 6100 |
| 196 | JGI24703J35330_11246690 | 3300002501 | Bacteria | 799 |
| 197 | JGI24696J40584_12960840 | 3300002834 | Bacteria | 8848 |
| 198 | Ga0466705_473426 | 3300042612 | Unclassified | 19515 |
| 199 | Ga0466705_475106 | 3300042612 | Bacteria | 4137 |
| 200 | Ga0466715_582348 | 3300042616 | Bacteria | 1136 |
| 201 | Ga0466715_631477 | 3300042616 | Bacteria | 1039 |
| 202 | Ga0466723_278811 | 3300042618 | Bacteria | 3970 |
| 203 | Ga0466726_127465 | 3300042619 | Bacteria | 10446 |
| 204 | Ga0466728_422812 | 3300042620 | Bacteria | 2765 |
| 205 | Ga0466729_049740 | 3300042621 | Unclassified | 1153 |
| 206 | Ga0466703_183310 | 3300042636 | Bacteria | 17595 |
| 207 | Ga0466704_220698 | 3300042643 | Bacteria | 20461 |
| 208 | Ga0466733_188170 | 3300042659 | Bacteria | 4015 |
| 209 | Ga0562379_0006 | 3300056790 | Bacteria | 2459409 |
| 210 | Ga0123357_10022956 | 3300009784 | Bacteria | 8373 |
| 211 | Ga0123357_10042152 | 3300009784 | Bacteria | 6207 |
| 212 | Ga0123357_10439008 | 3300009784 | Bacteria | 1145 |
| 213 | Ga0123355_10000021 | 3300009826 | Bacteria | 153421 |
| 214 | Ga0123355_10000051 | 3300009826 | Bacteria | 119634 |
| 215 | Ga0123355_10020146 | 3300009826 | Bacteria | 10641 |
| 216 | Ga0123355_10089881 | 3300009826 | Bacteria | 4873 |
| 217 | Ga0123355_10230893 | 3300009826 | Bacteria | 2642 |
| 218 | Ga0123355_10844316 | 3300009826 | Bacteria | 1009 |
| 219 | Ga0123356_10025791 | 3300010049 | Bacteria | 5525 |
| 220 | Ga0123353_10002888 | 3300010167 | Bacteria | 21504 |
| 221 | Ga0123353_10009452 | 3300010167 | Unclassified | 13468 |
| 222 | Ga0123353_10142542 | 3300010167 | Bacteria | 3837 |
| 223 | Ga0123353_10246834 | 3300010167 | Bacteria | 2769 |
| 224 | Ga0123353_10453402 | 3300010167 | Unclassified | 1887 |
| 225 | Ga0123353_10504861 | 3300010167 | Unclassified | 1761 |
| 226 | Ga0123353_11885469 | 3300010167 | Bacteria | 738 |
| 227 | Ga0123354_10462942 | 3300010882 | Bacteria | 1017 |
| 228 | Ga0160454_100164 | 3300012798 | Bacteria | 76238 |
| 229 | Ga0466701_018020 | 3300042598 | Bacteria | 2687 |
| 230 | Ga0466701_033786 | 3300042598 | Bacteria | 2379 |
| 231 | Ga0466707_001763 | 3300042601 | Bacteria | 3315 |
| 232 | Ga0466713_021921 | 3300042602 | Bacteria | 9844 |
| 233 | Ga0466713_142763 | 3300042602 | Bacteria | 2251 |
| 234 | Ga0466722_242620 | 3300042609 | Bacteria | 6791 |
| 235 | Ga0415639_027060 | 3300038395 | Bacteria | 7824 |
| 236 | Ga0466656_343842 | 3300042550 | Bacteria | 2319 |
| 237 | Ga0466690_250555 | 3300042590 | Unclassified | 1221 |
| 238 | Ga0466691_083444 | 3300042593 | Bacteria | 26579 |
| 239 | JGI24703J35330_11748577 | 3300002501 | Bacteria | 20757 |
| 240 | JGI24705J35276_12238817 | 3300002504 | Bacteria | 232340 |
| 241 | Ga0068305_10182512 | 3300005083 | Bacteria | 30631 |
| 242 | Ga0466711_326110 | 3300042615 | Bacteria | 6526 |
| 243 | Ga0466711_469736 | 3300042615 | Bacteria | 7565 |
| 244 | Ga0466715_110969 | 3300042616 | Bacteria | 33576 |
| 245 | Ga0466726_118582 | 3300042619 | Bacteria | 27943 |
| 246 | Ga0466726_426870 | 3300042619 | Bacteria | 1721 |
| 247 | Ga0466704_476880 | 3300042643 | Bacteria | 5392 |
| 248 | Ga0466724_42229 | 3300042649 | Bacteria | 1070 |
| 249 | Ga0466725_423604 | 3300042654 | Bacteria | 7218 |
| 250 | Ga0466697_097013 | 3300042611 | Bacteria | 9483 |
| 251 | Ga0466733_118011 | 3300042659 | Bacteria | 5437 |
| 252 | Ga0123357_10127381 | 3300009784 | Bacteria | 3184 |
| 253 | Ga0123355_10004883 | 3300009826 | Bacteria | 19511 |
| 254 | Ga0123355_10066633 | 3300009826 | Bacteria | 5795 |
| 255 | Ga0123355_10075389 | 3300009826 | Bacteria | 5399 |
| 256 | Ga0123355_10087359 | 3300009826 | Bacteria | 4955 |
| 257 | Ga0123355_10346872 | 3300009826 | Bacteria | 1972 |
| 258 | Ga0123355_10498065 | 3300009826 | Unclassified | 1505 |
| 259 | Ga0123355_10548815 | 3300009826 | Bacteria | 1398 |
| 260 | Ga0123355_10665413 | 3300009826 | Unclassified | 1209 |
| 261 | Ga0123356_10000423 | 3300010049 | Bacteria | 48180 |
| 262 | Ga0123356_10045498 | 3300010049 | Bacteria | 4084 |
| 263 | Ga0123356_10191712 | 3300010049 | Unclassified | 2076 |
| 264 | Ga0123356_10814003 | 3300010049 | Bacteria | 1105 |
| 265 | Ga0123356_11373679 | 3300010049 | Bacteria | 868 |
| 266 | Ga0123353_10000217 | 3300010167 | Bacteria | 72754 |
| 267 | Ga0123353_10002781 | 3300010167 | Bacteria | 21846 |
| 268 | Ga0123353_10027212 | 3300010167 | Unclassified | 8758 |
| 269 | Ga0123353_10610565 | 3300010167 | Bacteria | 1556 |
| 270 | Ga0123353_11041055 | 3300010167 | Bacteria | 1094 |
| 271 | Ga0160464_100615 | 3300012805 | Bacteria | 22653 |
| 272 | Ga0466706_005645 | 3300042599 | Bacteria | 1638 |
| 273 | Ga0466707_387226 | 3300042601 | Bacteria | 9108 |
| 274 | Ga0466714_011831 | 3300042603 | Bacteria | 18310 |
| 275 | Ga0466714_109083 | 3300042603 | Unclassified | 1114 |
| 276 | Ga0466719_354857 | 3300042606 | Bacteria | 1229 |
| 277 | Ga0466722_120000 | 3300042609 | Bacteria | 3055 |
| 278 | Ga0466696_491038 | 3300042596 | Unclassified | 1489 |
| 279 | IMNBL1DRAFT_c0012837 | 3300000062 | Bacteria | 3802 |
| 280 | JGI24695J34938_10000065 | 3300002450 | Bacteria | 87483 |
| 281 | JGI24695J34938_10000999 | 3300002450 | Bacteria | 25681 |
| 282 | Ga0072940_1552423 | 3300005200 | Bacteria | 645 |
| 283 | Ga0072941_1144374 | 3300005201 | Bacteria | 19347 |
| 284 | Ga0072941_1367354 | 3300005201 | Bacteria | 1194 |
| 285 | Ga0466711_010893 | 3300042615 | Unclassified | 12549 |
| 286 | Ga0466711_151472 | 3300042615 | Unclassified | 1410 |
| 287 | Ga0466711_440253 | 3300042615 | Bacteria | 1420 |
| 288 | Ga0466723_064027 | 3300042618 | Bacteria | 8780 |
| 289 | Ga0466703_369172 | 3300042636 | Bacteria | 9799 |
| 290 | Ga0562374_0008 | 3300057007 | Bacteria | 1999653 |
| 291 | Ga0123357_10120783 | 3300009784 | Bacteria | 3302 |
| 292 | Ga0123357_10145944 | 3300009784 | Bacteria | 2890 |
| 293 | Ga0123355_10000478 | 3300009826 | Bacteria | 53107 |
| 294 | Ga0123355_10006768 | 3300009826 | Bacteria | 17056 |
| 295 | Ga0123355_10025615 | 3300009826 | Bacteria | 9499 |
| 296 | Ga0123355_10034982 | 3300009826 | Bacteria | 8166 |
| 297 | Ga0123355_10085872 | 3300009826 | Bacteria | 5006 |
| 298 | Ga0123355_10190573 | 3300009826 | Bacteria | 3021 |
| 299 | Ga0123355_10253045 | 3300009826 | Bacteria | 2476 |
| 300 | Ga0123356_10010653 | 3300010049 | Bacteria | 9000 |
| 301 | Ga0123356_10053792 | 3300010049 | Bacteria | 3748 |
| 302 | Ga0123356_10076523 | 3300010049 | Unclassified | 3154 |
| 303 | Ga0123356_10169055 | 3300010049 | Bacteria | 2195 |
| 304 | Ga0123356_10402271 | 3300010049 | Bacteria | 1507 |
| 305 | Ga0123356_10957539 | 3300010049 | Bacteria | 1027 |
| 306 | Ga0123353_10057376 | 3300010167 | Bacteria | 6237 |
| 307 | Ga0123353_11763123 | 3300010167 | Unclassified | 772 |
| 308 | Ga0123354_10051422 | 3300010882 | Bacteria | 6222 |
| 309 | Ga0123354_10251408 | 3300010882 | Bacteria | 1789 |
| 310 | Ga0123354_10419805 | 3300010882 | Bacteria | 1113 |
| 311 | Ga0466706_129083 | 3300042599 | Bacteria | 10682 |
| 312 | Ga0466706_255250 | 3300042599 | Bacteria | 1850 |
| 313 | Ga0466700_228777 | 3300042600 | Bacteria | 1866 |
| 314 | Ga0466716_272907 | 3300042605 | Bacteria | 4863 |
| 315 | Ga0466719_055260 | 3300042606 | Bacteria | 5394 |
| 316 | Ga0466719_577122 | 3300042606 | Bacteria | 2071 |
| 317 | Ga0466722_006083 | 3300042609 | Bacteria | 2656 |
| 318 | Ga0160452_100666 | 3300012834 | Bacteria | 17841 |
| 319 | Ga0415639_024951 | 3300038395 | Bacteria | 4499 |
| 320 | Ga0415639_027583 | 3300038395 | Bacteria | 6682 |
| 321 | Ga0466693_023359 | 3300042592 | Bacteria | 1883 |
| 322 | Ga0466696_496749 | 3300042596 | Bacteria | 1974 |
| 323 | 2227484835 | 2225789004 | Bacteria | 825 |
| 324 | IMNBL1DRAFT_c0020235 | 3300000062 | Unclassified | 2701 |
| 325 | Ga0466711_146263 | 3300042615 | Bacteria | 26702 |
| 326 | Ga0466711_315770 | 3300042615 | Bacteria | 8302 |
| 327 | Ga0466715_058227 | 3300042616 | Bacteria | 14968 |
| 328 | Ga0466715_196327 | 3300042616 | Bacteria | 39725 |
| 329 | Ga0466715_207935 | 3300042616 | Bacteria | 14795 |
| 330 | Ga0466726_018500 | 3300042619 | Bacteria | 14232 |
| 331 | Ga0466726_348494 | 3300042619 | Bacteria | 1820 |
| 332 | Ga0466734_007130 | 3300042623 | Bacteria | 1444 |
| 333 | Ga0466703_317832 | 3300042636 | Unclassified | 1861 |
| 334 | Ga0466704_553347 | 3300042643 | Bacteria | 8474 |
| 335 | Ga0466724_54517 | 3300042649 | Unclassified | 1350 |
| 336 | Ga0466708_392414 | 3300042652 | Bacteria | 11096 |
| 337 | Ga0466727_214470 | 3300042655 | Bacteria | 1510 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.