Protein Family IF12113

Metagenome Isolate
205 Members
77 Samples
156 Scaffolds
173.05 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820596822|2820598183|
Length
179 aa
Sequence
MAKVGIIMGSDSDLPIMKEAAVFLDELGIDSEVTVVSAHRTPERLFSYARAARERGIAVIIAGAGGAAHLPGMVASLTSLPVIGVPVLVKSLGGIGLDSIYSILQMPPGIPVATMALNGAKNAGILAASILSTSDKIIADKLDQYKRDLANLIEGKAEKLENIGYKDYVKEMEKNQWTT

📊 Sample Types

Isolate 23.9%
Metagenome 76.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 54.5%
Termitidae 19.5%
Anthocoridae 10.4%
Kalotermitidae 5.2%
Passalidae 2.6%
Noctuidae 2.6%
Tenebrionidae 1.3%
Hodotermitidae 1.3%
Cambaridae 1.3%
Termopsidae 1.3%

🌳 Taxonomy

Archaea 3
Bacteria 165
Eukaryota 0
Viruses 0
Unclassified 37

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
2 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
3 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
4 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
5 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
6 2820032565 Unclassified Saccharibacteria Th196P3bin19 Isolate Unclassified
7 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
8 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
9 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
12 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
13 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
14 2820271343 Unclassified Firmicutes Th196P3bin32 Isolate Unclassified
15 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
16 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
17 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
18 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
19 2820261600 Unclassified Firmicutes Th196P3bin40 Isolate Unclassified
20 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
21 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
22 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
23 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
24 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
25 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
26 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
27 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
28 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
29 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
30 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
31 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
32 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
33 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
34 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
35 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
36 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
37 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
38 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
39 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
40 2820546020 Unclassified Firmicutes Lab288P1bin102 Isolate Unclassified
41 2820620956 Unclassified Firmicutes Emb289P1bin128 Isolate Unclassified
42 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
43 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
44 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
45 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
46 2773857681 Unclassified Methanomassiliicoccaceae Lab288P1bin114 Isolate Unclassified
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
49 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
50 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
51 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
52 2820563109 Unclassified Firmicutes Emb289P3bin58 Isolate Unclassified
53 2820587002 Unclassified Firmicutes Emb289P1bin94 Isolate Unclassified
54 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
55 2035265002 Agrotis sp. gut microbial communities from Texas A and M University, USA Metagenome Noctuidae
56 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
57 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
58 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
59 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
60 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
61 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
62 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
63 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
64 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
65 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
66 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
67 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
68 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
69 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
70 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
71 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
72 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
73 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
74 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
75 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
76 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
77 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466719_401778 3300042606 Unclassified 1511
2 Ga0123355_10003748 3300009826 Bacteria 21967
3 Ga0123355_10270737 3300009826 Unclassified 2360
4 Ga0123355_10604767 3300009826 Bacteria 1299
5 Ga0123355_10673403 3300009826 Unclassified 1198
6 Ga0123356_10013672 3300010049 Unclassified 7821
7 Ga0123356_10079871 3300010049 Bacteria 3091
8 Ga0123356_11899896 3300010049 Bacteria 741
9 Ga0123353_10001395 3300010167 Bacteria 29586
10 Ga0123353_10014809 3300010167 Bacteria 11274
11 Ga0123353_10350083 3300010167 Unclassified 2226
12 Ga0123353_10403686 3300010167 Unclassified 2032
13 Ga0123353_12240636 3300010167 Bacteria 659
14 JGI24695J34938_10164385 3300002450 Unclassified 913
15 Ga0415639_000581 3300038395 Bacteria 50352
16 Ga0415639_001005 3300038395 Bacteria 15117
17 Ga0415639_068437 3300038395 Unclassified 8819
18 Ga0415639_165408 3300038395 Unclassified 2282
19 Ga0466731_128510 3300042622 Bacteria 1146
20 Ga0123355_10115188 3300009826 Unclassified 4187
21 Ga0123355_10393573 3300009826 Bacteria 1794
22 Ga0123355_10437518 3300009826 Bacteria 1658
23 Ga0123356_10001176 3300010049 Bacteria 28984
24 Ga0123356_10690504 3300010049 Unclassified 1189
25 Ga0123356_10776931 3300010049 Bacteria 1129
26 Ga0123353_10004425 3300010167 Bacteria 18096
27 Ga0123353_10114345 3300010167 Bacteria 4345
28 Ga0123353_10238143 3300010167 Unclassified 2830
29 Ga0123353_10644967 3300010167 Unclassified 1501
30 IMNBL1DRAFT_c0005883 3300000062 Bacteria 6871
31 JGI24695J34938_10000001 3300002450 Bacteria 290906
32 Ga0415639_014783 3300038395 Bacteria 15870
33 Ga0415639_022803 3300038395 Bacteria 7478
34 Ga0415639_095623 3300038395 Bacteria 2647
35 Ga0466725_055684 3300042654 Bacteria 1074
36 Ga0466727_240634 3300042655 Unclassified 1656
37 Ga0466697_117536 3300042611 Unclassified 1703
38 Ga0466707_309507 3300042601 Bacteria 1849
39 Ga0466721_125359 3300042608 Bacteria 6930
40 Ga0466721_299889 3300042608 Unclassified 5118
41 Ga0123355_10219172 3300009826 Bacteria 2740
42 Ga0123355_10236406 3300009826 Unclassified 2598
43 Ga0123355_11189398 3300009826 Bacteria 780
44 Ga0123356_10001510 3300010049 Bacteria 25606
45 Ga0123356_10036932 3300010049 Bacteria 4559
46 Ga0123356_10089763 3300010049 Bacteria 2924
47 Ga0123356_10288253 3300010049 Unclassified 1741
48 Ga0123356_10586782 3300010049 Unclassified 1278
49 Ga0123356_11913211 3300010049 Bacteria 739
50 Ga0123356_12592076 3300010049 Bacteria 635
51 Ga0123353_10002221 3300010167 Bacteria 24044
52 Ga0123353_10333566 3300010167 Bacteria 2294
53 Ga0123354_10278159 3300010882 Bacteria 1631
54 JGI24695J34938_10042086 3300002450 Bacteria 2047
55 Ga0415639_008545 3300038395 Bacteria 70964
56 Ga0466657_360428 3300042582 Archaea 9122
57 Ga0466733_113749 3300042659 Bacteria 3421
58 Ga0123355_10023362 3300009826 Bacteria 9928
59 Ga0123355_10428971 3300009826 Bacteria 1683
60 Ga0123355_10685235 3300009826 Bacteria 1183
61 Ga0123356_10034021 3300010049 Bacteria 4767
62 Ga0123356_10050123 3300010049 Unclassified 3886
63 Ga0123356_10073792 3300010049 Unclassified 3209
64 Ga0123356_10122795 3300010049 Bacteria 2530
65 Ga0123356_10946976 3300010049 Bacteria 1032
66 Ga0123353_10002746 3300010167 Bacteria 21956
67 JGI24695J34938_10000241 3300002450 Bacteria 52537
68 Ga0415639_001998 3300038395 Bacteria 48214
69 Ga0415639_013408 3300038395 Bacteria 6646
70 Ga0415639_017599 3300038395 Unclassified 2878
71 Ga0466725_280041 3300042654 Unclassified 8839
72 Ga0466713_105225 3300042602 Bacteria 2587
73 Ga0123355_10110978 3300009826 Bacteria 4285
74 Ga0123355_10225874 3300009826 Bacteria 2683
75 Ga0123355_10233729 3300009826 Bacteria 2620
76 Ga0123355_10600224 3300009826 Bacteria 1307
77 Ga0123355_10802189 3300009826 Bacteria 1049
78 Ga0123355_10826837 3300009826 Bacteria 1026
79 Ga0123355_10998490 3300009826 Bacteria 889
80 Ga0123356_10040614 3300010049 Bacteria 4334
81 Ga0123356_10090400 3300010049 Bacteria 2915
82 Ga0123356_10198910 3300010049 Bacteria 2042
83 Ga0123356_10357225 3300010049 Bacteria 1587
84 Ga0123356_10520770 3300010049 Bacteria 1347
85 Ga0123356_11037747 3300010049 Archaea 989
86 Ga0123356_11132341 3300010049 Unclassified 950
87 Ga0123353_10061782 3300010167 Bacteria 6008
88 Ga0123353_10239342 3300010167 Bacteria 2822
89 Ga0123353_10613225 3300010167 Bacteria 1551
90 Ga0123353_12305085 3300010167 Unclassified 647
91 CwormDRAF_NODE_4110_len_1540_cov_183_470123 2035265002 Bacteria 1570
92 JGI24695J34938_10172302 3300002450 Unclassified 893
93 Ga0415639_155591 3300038395 Unclassified 3192
94 Ga0415639_163781 3300038395 Bacteria 1466
95 Ga0466693_235184 3300042592 Bacteria 2412
96 Ga0123357_10068790 3300009784 Bacteria 4710
97 Ga0123355_10041885 3300009826 Unclassified 7455
98 Ga0123355_10089501 3300009826 Bacteria 4885
99 Ga0123355_10335034 3300009826 Bacteria 2022
100 Ga0123355_10482820 3300009826 Bacteria 1541
101 Ga0123356_10002211 3300010049 Bacteria 20935
102 Ga0123356_10022720 3300010049 Bacteria 5913
103 Ga0123356_10046742 3300010049 Bacteria 4027
104 Ga0123356_10675222 3300010049 Bacteria 1201
105 Ga0123356_11475855 3300010049 Bacteria 838
106 Ga0123356_12230868 3300010049 Unclassified 684
107 Ga0123353_10074294 3300010167 Bacteria 5465
108 Ga0123353_10088091 3300010167 Bacteria 4999
109 Ga0123353_10329856 3300010167 Bacteria 2310
110 Ga0123354_10044176 3300010882 Bacteria 6838
111 Ga0415639_069635 3300038395 Bacteria 1684
112 Ga0123355_10000139 3300009826 Bacteria 86692
113 Ga0123355_10043246 3300009826 Bacteria 7329
114 Ga0123355_10047270 3300009826 Bacteria 6998
115 Ga0123355_10057111 3300009826 Unclassified 6317
116 Ga0123355_10203195 3300009826 Bacteria 2889
117 Ga0123355_10595607 3300009826 Unclassified 1314
118 Ga0123355_10790706 3300009826 Bacteria 1061
119 Ga0123356_10004718 3300010049 Bacteria 14043
120 Ga0123356_10032435 3300010049 Bacteria 4886
121 Ga0123356_10251399 3300010049 Bacteria 1846
122 Ga0123356_10331666 3300010049 Bacteria 1638
123 Ga0123356_10600740 3300010049 Unclassified 1265
124 Ga0123353_10050972 3300010167 Bacteria 6604
125 Ga0123353_10197620 3300010167 Bacteria 3168
126 Ga0123353_10254608 3300010167 Bacteria 2716
127 Ga0123353_10604554 3300010167 Unclassified 1566
128 Ga0123353_11936261 3300010167 Bacteria 725
129 IMNBL1DRAFT_c0020065 3300000062 Bacteria 2719
130 Ga0052191_101378 3300003097 Bacteria 1570
131 Ga0415639_005501 3300038395 Bacteria 17934
132 Ga0415639_071194 3300038395 Bacteria 1669
133 Ga0466708_392619 3300042652 Bacteria 1690
134 Ga0562379_0230 3300056790 Bacteria 153199
135 Ga0466705_501962 3300042612 Bacteria 19078
136 Ga0466706_055610 3300042599 Bacteria 4540
137 Ga0466721_009602 3300042608 Unclassified 5189
138 Ga0123355_10000768 3300009826 Bacteria 43811
139 Ga0123355_10218482 3300009826 Bacteria 2746
140 Ga0123355_10343568 3300009826 Bacteria 1985
141 Ga0123356_10000124 3300010049 Bacteria 85126
142 Ga0123356_10189064 3300010049 Bacteria 2088
143 Ga0123356_10292163 3300010049 Bacteria 1731
144 Ga0123353_10000214 3300010167 Bacteria 73027
145 Ga0123353_10043557 3300010167 Bacteria 7112
146 Ga0123353_10105417 3300010167 Bacteria 4543
147 Ga0123353_10408550 3300010167 Bacteria 2017
148 Ga0123353_10544459 3300010167 Unclassified 1676
149 Ga0123353_11050537 3300010167 Bacteria 1088
150 Ga0123353_11417710 3300010167 Bacteria 892
151 2227197195 2225789004 Bacteria 1449
152 JGI24695J34938_10050887 3300002450 Unclassified 1815
153 Ga0415639_107466 3300038395 Unclassified 3679
154 Ga0466656_328350 3300042550 Bacteria 1062
155 Ga0466693_161467 3300042592 Bacteria 4391
156 Ga0466709_210459 3300042648 Bacteria 4101

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00731 AIRC AIR carboxylase 3 149 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00731 GO:0006189 'de novo' IMP biosynthetic process BP

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.