Protein Family IF12080

Metagenome Metatranscriptome Isolate
210 Members
112 Samples
146 Scaffolds
230.79 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820466401|2820466910|
Length
234 aa
Sequence
MSMTKGKSTNPAINYSCVVRQGTSHGPCPIPQEGSWTKSKEIKDISGLSHGVGGCAPRQGACKLTLNVKRGIIEEALIETLGCSGMTHSACMAGEIIKGKTLLEALNTDLVCDAINDAMKDIFFQLVYGRSQSAFSAGGLEIGAGIEELGSSLVSQFGTVYTGEQGVRYLQTTEGYITKVGLDKNDEVIGYEFVNLGRFMQKLKQGKTYDEAYEQSMGTYGRFSEAVKIIDPRD

📊 Sample Types

Isolate 30.5%
Metagenome 69.0%
MAG 0.0%
Metatranscriptome 0.5%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 52.7%
Termitidae 20.0%
Kalotermitidae 12.7%
Palinuridae 2.7%
Rhinotermitidae 2.7%
Talitridae 1.8%
Passalidae 1.8%
Majidae 1.8%
Hodotermitidae 0.9%
Nephropidae 0.9%
Penaeidae 0.9%
Termopsidae 0.9%

🌳 Taxonomy

Archaea 1
Bacteria 196
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2844251356 Photobacterium leiognathi mandapamensis ajapo.3.1 Isolate Unclassified
2 2858407585 Photobacterium swingsii DSM 24669 Isolate Unclassified
3 2900349738 Photobacterium lucens CAIM 1938 Isolate Unclassified
4 2912636047 Vibrio crassostreae 9CS106 Isolate Unclassified
5 2654587515 Vibrio owensii CAIM 1854 Isolate Palinuridae
6 2820466401 Unclassified Firmicutes Lab288P3bin111 Isolate Unclassified
7 2772190890 Unclassified Elusimicrobia Lab288P4_bin46 Isolate Unclassified
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 8048928574 Photobacterium swingsii CECT 7576 Isolate Unclassified
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 2902451016 Photobacterium leiognathi mandapamensis ajapo.4.1 Isolate Unclassified
19 2908136803 Vibrio owensii 1700302 Isolate Unclassified
20 2600255074 Vibrio proteolyticus NBRC 13287 Isolate Unclassified
21 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
22 2820242869 Unclassified Firmicutes Th196P3bin82 Isolate Unclassified
23 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
24 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
25 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
26 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
27 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
28 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
29 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
30 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
31 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
32 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
33 640963010 Vibrio harveyi HY01 Isolate Unclassified
34 8022345672 Vibrio sp. 070316B Isolate Unclassified
35 8033364368 Vibrio panuliri LBS 2 Isolate Nephropidae
36 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
37 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
38 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
39 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
40 2877638525 Vibrio campbellii 1114GL Isolate Penaeidae
41 2902469402 Photobacterium lucens CAIM 1937 Isolate Unclassified
42 2684622551 Vibrio campbellii E1 Isolate Unclassified
43 2731957638 Vibrio harveyi NBRC 15634 Isolate Talitridae
44 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
45 2820259584 Unclassified Firmicutes Th196P3bin43 Isolate Unclassified
46 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
47 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
48 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
49 2820429680 Unclassified Firmicutes Lab288P3bin30 Isolate Unclassified
50 8022116796 Vibrio sp. T3Y01 Isolate Unclassified
51 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
52 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
53 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
54 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
55 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
56 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
57 2902438364 Photobacterium damselae Hep-2a-11 Isolate Unclassified
58 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
59 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
60 2820362221 Unclassified Firmicutes Nt197P3bin116 Isolate Unclassified
61 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
62 8008122225 Vibrio harveyi CAIM 1792 Isolate Unclassified
63 8042061949 Vibrio harveyi Hep-2a-10 Isolate Unclassified
64 2531839005 Vibrio harveyi CAIM 1792 Isolate Unclassified
65 2551306520 Aliivibrio logei ATCC 35077 Isolate Majidae
66 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
67 2820600392 Unclassified Firmicutes Emb289P1bin52 Isolate Unclassified
68 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
69 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
70 642555127 Elusimicrobium minutum Pei191 Isolate Unclassified
71 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
72 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
73 2873884416 Photobacterium sanguinicancri Mj110 CAIM 1827 Isolate Majidae
74 2667527887 Vibrio harveyi LMG 4044 Isolate Unclassified
75 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
76 8048923410 Photobacterium sanguinicancri CECT 7579 Isolate Unclassified
77 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
78 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
79 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
80 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
81 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
82 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
83 2850895757 Vibrio campbellii 170502 Isolate Unclassified
84 2872471378 Vibrio owensii V180403 Isolate Unclassified
85 2571042430 Vibrio harveyi NBRC 15634 Isolate Talitridae
86 2711768158 Vibrio coralliilyticus S2043 Isolate Unclassified
87 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
88 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
89 2820229114 Unclassified Firmicutes Th196P4bin40 Isolate Unclassified
90 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
91 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
92 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
93 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
94 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
95 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
96 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
97 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
98 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
99 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
100 2868883784 Photobacterium leiognathi mandapamensis AJ-1a Isolate Unclassified
101 2571042554 Vibrio owensii CAIM 1854 Isolate Palinuridae
102 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
103 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
104 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
105 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
106 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
107 8033368880 Vibrio panuliri CAIM 1902 Isolate Palinuridae
108 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
109 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
110 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
111 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
112 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10004979 3300010049 Bacteria 13623
2 Ga0123353_10002452 3300010167 Bacteria 23066
3 Ga0123353_10526854 3300010167 Bacteria 1712
4 Ga0123353_11122385 3300010167 Bacteria 1041
5 Ga0466706_123587 3300042599 Bacteria 10641
6 Ga0466700_461300 3300042600 Bacteria 1154
7 Ga0466717_205549 3300042604 Bacteria 1150
8 Ga0466719_429671 3300042606 Bacteria 2098
9 Ga0466728_078092 3300042620 Bacteria 2851
10 JGI24705J35276_12223345 3300002504 Bacteria 2501
11 JGI24696J40584_12882272 3300002834 Bacteria 1090
12 Ga0415639_000924 3300038395 Bacteria 51434
13 Ga0466692_069201 3300042591 Bacteria 165617
14 Ga0466696_119196 3300042596 Bacteria 1861
15 Ga0123355_10000099 3300009826 Bacteria 93904
16 Ga0123356_10000004 3300010049 Bacteria 279505
17 Ga0123356_10022110 3300010049 Bacteria 6006
18 Ga0123356_10425071 3300010049 Unclassified 1472
19 Ga0123353_11329684 3300010167 Unclassified 930
20 Ga0123353_11363742 3300010167 Bacteria 915
21 Ga0466717_024731 3300042604 Unclassified 1119
22 Ga0466698_244283 3300042610 Bacteria 1785
23 Ga0466710_187816 3300042613 Bacteria 1065
24 2227490482 2225789004 Bacteria 4101
25 Ga0265387_1033160 3300024582 Bacteria 848
26 Ga0415639_002736 3300038395 Unclassified 23990
27 Ga0123356_10304567 3300010049 Bacteria 1700
28 Ga0123354_10002711 3300010882 Bacteria 23746
29 Ga0123354_10337634 3300010882 Unclassified 1363
30 Ga0466706_142150 3300042599 Bacteria 1260
31 Ga0466700_295600 3300042600 Bacteria 1350
32 Ga0466721_023162 3300042608 Bacteria 13628
33 Ga0466703_302053 3300042636 Bacteria 49959
34 Ga0466704_284775 3300042643 Bacteria 10827
35 Ga0466704_570616 3300042643 Bacteria 13680
36 Ga0466718_120812 3300042617 Bacteria 1160
37 Ga0466726_011134 3300042619 Bacteria 62286
38 Ga0466705_350445 3300042612 Bacteria 23192
39 2227466302 2225789004 Bacteria 24584
40 JGI24702J35022_10028363 3300002462 Bacteria 3009
41 JGI24696J40584_12958250 3300002834 Bacteria 3991
42 Ga0068305_10000131 3300005083 Bacteria 190192
43 Ga0072941_1003415 3300005201 Bacteria 15744
44 Ga0415639_039770 3300038395 Bacteria 3152
45 Ga0466691_040891 3300042593 Bacteria 3715
46 Ga0123355_10000187 3300009826 Bacteria 76867
47 Ga0123355_10091787 3300009826 Bacteria 4813
48 Ga0123353_10001180 3300010167 Bacteria 31940
49 Ga0123353_10175331 3300010167 Bacteria 3400
50 Ga0123353_10313026 3300010167 Bacteria 2387
51 Ga0123353_10954608 3300010167 Archaea 1159
52 Ga0466700_405875 3300042600 Bacteria 9069
53 Ga0466716_447240 3300042605 Bacteria 7933
54 Ga0466719_107175 3300042606 Bacteria 6529
55 Ga0466698_176049 3300042610 Bacteria 1704
56 Ga0466703_269170 3300042636 Bacteria 1668
57 Ga0466708_158303 3300042652 Bacteria 28413
58 Ga0466718_148694 3300042617 Bacteria 21932
59 Ga0466723_195650 3300042618 Bacteria 3427
60 Ga0466726_280795 3300042619 Bacteria 53442
61 Ga0466705_025635 3300042612 Bacteria 1832
62 Ga0072940_1160514 3300005200 Bacteria 1087
63 Ga0072941_1043975 3300005201 Bacteria 8201
64 Ga0072941_1257942 3300005201 Bacteria 1690
65 Ga0255809_1036439 3300022820 Bacteria 1324
66 Ga0123355_10272485 3300009826 Bacteria 2349
67 Ga0123353_10000492 3300010167 Bacteria 48805
68 Ga0123353_10093834 3300010167 Bacteria 4836
69 Ga0123353_10185933 3300010167 Bacteria 3285
70 Ga0123353_10321753 3300010167 Bacteria 2347
71 Ga0123353_10532698 3300010167 Unclassified 1700
72 Ga0123354_10093577 3300010882 Bacteria 4130
73 Ga0466706_073905 3300042599 Bacteria 9972
74 Ga0466734_122343 3300042623 Bacteria 1123
75 Ga0466702_148053 3300042635 Bacteria 1629
76 Ga0466703_214871 3300042636 Bacteria 29417
77 Ga0466705_449023 3300042612 Bacteria 1397
78 Ga0466711_190243 3300042615 Bacteria 8195
79 Ga0466715_465707 3300042616 Bacteria 18528
80 Ga0466732_013714 3300042656 Unclassified 10315
81 JGI24702J35022_10006982 3300002462 Bacteria 6489
82 JGI24702J35022_10101749 3300002462 Bacteria 1574
83 JGI24696J40584_12961624 3300002834 Bacteria 25802
84 Ga0072941_1056719 3300005201 Bacteria 6030
85 Ga0123356_10000625 3300010049 Bacteria 39070
86 Ga0123356_10435228 3300010049 Bacteria 1457
87 Ga0123353_10000552 3300010167 Bacteria 46015
88 Ga0123353_10003528 3300010167 Bacteria 19786
89 Ga0123353_10134019 3300010167 Bacteria 3974
90 Ga0123353_10542128 3300010167 Bacteria 1681
91 Ga0123353_11027206 3300010167 Unclassified 1104
92 Ga0123353_11476441 3300010167 Bacteria 868
93 Ga0466707_240278 3300042601 Bacteria 12438
94 Ga0466714_031440 3300042603 Bacteria 8682
95 Ga0466721_127602 3300042608 Bacteria 1886
96 Ga0466722_062061 3300042609 Bacteria 2106
97 Ga0466702_044721 3300042635 Bacteria 1045
98 Ga0466704_216448 3300042643 Unclassified 3030
99 Ga0466723_283731 3300042618 Bacteria 10719
100 Ga0466729_195450 3300042621 Bacteria 7071
101 Ga0466733_121115 3300042659 Bacteria 23017
102 2227599624 2225789004 Bacteria 12560
103 JGI24702J35022_10073668 3300002462 Bacteria 1842
104 Ga0072941_1197297 3300005201 Bacteria 4242
105 Ga0415639_131188 3300038395 Bacteria 4054
106 Ga0466691_202049 3300042593 Bacteria 5462
107 Ga0123355_10261564 3300009826 Unclassified 2419
108 Ga0123356_10230239 3300010049 Bacteria 1917
109 Ga0123356_10473094 3300010049 Unclassified 1405
110 Ga0123353_10014530 3300010167 Bacteria 11361
111 Ga0123353_10240378 3300010167 Bacteria 2814
112 Ga0123353_11444636 3300010167 Bacteria 880
113 Ga0466706_219806 3300042599 Bacteria 48833
114 Ga0466700_180774 3300042600 Bacteria 2174
115 Ga0466700_216188 3300042600 Bacteria 1080
116 Ga0466707_060913 3300042601 Bacteria 116804
117 Ga0466713_032528 3300042602 Bacteria 7987
118 Ga0466719_210327 3300042606 Bacteria 17215
119 Ga0466721_030940 3300042608 Bacteria 17691
120 Ga0466703_239562 3300042636 Bacteria 1850
121 Ga0466704_184138 3300042643 Bacteria 42890
122 Ga0466704_419212 3300042643 Bacteria 74407
123 Ga0466704_611283 3300042643 Unclassified 4987
124 Ga0466715_511434 3300042616 Bacteria 1545
125 Ga0466726_451848 3300042619 Bacteria 5910
126 Ga0466729_168444 3300042621 Bacteria 1955
127 Ga0466732_282897 3300042656 Unclassified 1442
128 2227222213 2225789004 Bacteria 1385
129 IMNBL1DRAFT_c0000238 3300000062 Bacteria 48318
130 IMNBL1DRAFT_c0004132 3300000062 Bacteria 8857
131 Ga0068305_10475143 3300005083 Bacteria 1227
132 Ga0466690_031357 3300042590 Bacteria 2370
133 Ga0123353_10000046 3300010167 Bacteria 134232
134 Ga0123353_10066851 3300010167 Bacteria 5771
135 Ga0123353_10171334 3300010167 Bacteria 3445
136 Ga0123353_10256006 3300010167 Bacteria 2707
137 Ga0466706_175757 3300042599 Bacteria 52175
138 Ga0466713_002219 3300042602 Bacteria 61454
139 Ga0466714_016407 3300042603 Bacteria 1565
140 Ga0466714_129254 3300042603 Bacteria 1300
141 Ga0466717_006144 3300042604 Bacteria 2440
142 Ga0466717_210625 3300042604 Bacteria 1981
143 Ga0466722_190194 3300042609 Bacteria 120622
144 Ga0466698_506732 3300042610 Bacteria 10452
145 Ga0466697_034285 3300042611 Bacteria 1153
146 Ga0466709_322226 3300042648 Bacteria 1160

🧩 MSA Aligner

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.