Protein Family IF12072

Metagenome Isolate
245 Members
110 Samples
184 Scaffolds
317.91 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820442516|2820443898|
Length
365 aa
Sequence
VSSLRINFKLRREESGICLLPTAGNELSSVNSKECKENIIKFEMEYNVSLKIIGMGKGIPERCVTNDDLAGFLDTDDEWIVTRTGIKTRYVCTYETLTDLSVTAAKQALDKANLAASDISLIICATLGGDYRTPSHACTVAEQLGTTCPAFDINAACTGFVYALDIASAYLEAGKAKNILIICAEMMSSQMDWNDRNTCILFGDGAAACVVTAGNALKYTSLSAIADTTILNLPVDTGNNPFIAEKRGKAYLQMQGQEVFKFAVGIVGKDVKHALETTGLSPEQIDYFILHQANKRIIDSIRVKLKQPEEKFPVNIDKYGNISSVSVPLLLSEMLDEGKINPSDTLFISAFGAGLTAGSCILVWE

📊 Sample Types

Isolate 24.9%
Metagenome 75.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 40.4%
Termitidae 22.0%
Blattidae 11.0%
Kalotermitidae 11.0%
Apidae 6.4%
Rhinotermitidae 2.8%
Termopsidae 2.8%
Passalidae 1.8%
Dytiscidae 0.9%
Hodotermitidae 0.9%

🌳 Taxonomy

Archaea 0
Bacteria 235
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
2 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
3 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
4 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
5 2820400448 Unclassified Firmicutes Nc150Mbin1 Isolate Unclassified
6 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
7 2820822094 Unclassified Actinobacteria Nt197P3bin131 Isolate Unclassified
8 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
9 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
10 2799112229 Lactobacillus sp. ESL0413 Isolate Unclassified
11 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
12 2820403592 Unclassified Firmicutes Lab288P4bin93 Isolate Unclassified
13 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
14 2630968413 Bombilactobacillus mellifer Bin4 Isolate Unclassified
15 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
16 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
17 2940373808 Fusobacterium sp. PH5-7 Isolate Blattidae
18 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
19 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
20 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
21 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
22 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
23 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
24 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
25 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
26 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
27 2820520043 Unclassified Firmicutes Lab288P1bin24 Isolate Unclassified
28 2820707375 Unclassified Firmicutes Co191P1bin31 Isolate Unclassified
29 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
30 2820836992 Unclassified Actinobacteria Lab288P4bin32 Isolate Unclassified
31 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
32 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
33 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
34 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
35 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
36 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
37 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
38 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
39 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
40 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
41 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
44 2799112220 Lactobacillus sp. ESL0411 Isolate Unclassified
45 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
46 2820432912 Unclassified Firmicutes Lab288P3bin219 Isolate Unclassified
47 2820530790 Unclassified Firmicutes Lab288P1bin141 Isolate Unclassified
48 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
49 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
50 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
51 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
52 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
53 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
54 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
55 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
56 2820303403 Unclassified Firmicutes Th196P1bin2 Isolate Unclassified
57 2820510699 Unclassified Firmicutes Lab288P1bin40 Isolate Unclassified
58 2820522177 Unclassified Firmicutes Lab288P1bin22 Isolate Unclassified
59 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
60 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
61 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
62 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
63 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
64 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
65 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
66 2820324456 Unclassified Firmicutes Nt197P3bin80 Isolate Unclassified
67 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
68 2873593402 Erysipelothrix sp. HDW6A Isolate Dytiscidae
69 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
70 2882334426 Lactobacillus sp. 2-3 Isolate Unclassified
71 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
72 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
73 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
74 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
75 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
76 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
77 2820339298 Unclassified Firmicutes Nt197P3bin68 Isolate Unclassified
78 2940241992 Fusobacterium sp. PH5-29 Isolate Blattidae
79 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
80 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
81 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
82 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
83 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
84 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
85 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
86 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
87 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
88 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
89 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
90 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
91 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
92 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
93 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
94 2820298281 Unclassified Firmicutes Th196P1bin9 Isolate Unclassified
95 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
96 2820683647 Unclassified Firmicutes Co191P1bin82 Isolate Unclassified
97 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
98 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
99 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
100 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
101 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
102 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
103 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
104 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
105 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
106 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
107 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
108 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
109 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
110 3004719924 Lactobacillus sp. W8174 Isolate Apidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466729_271515 3300042621 Bacteria 90292
2 Ga0466702_224806 3300042635 Bacteria 2478
3 Ga0466697_094323 3300042611 Bacteria 2000
4 Ga0466733_145608 3300042659 Bacteria 22667
5 Ga0466706_288606 3300042599 Bacteria 39888
6 Ga0466719_443370 3300042606 Bacteria 12284
7 Ga0123355_10288481 3300009826 Bacteria 2255
8 Ga0123356_10000484 3300010049 Bacteria 44489
9 Ga0123356_10007940 3300010049 Unclassified 10563
10 Ga0123356_10015572 3300010049 Bacteria 7283
11 Ga0123356_10029427 3300010049 Unclassified 5144
12 Ga0123356_10405726 3300010049 Bacteria 1501
13 Ga0123353_10114981 3300010167 Bacteria 4331
14 Ga0123353_10508104 3300010167 Bacteria 1753
15 Ga0123353_10873403 3300010167 Bacteria 1229
16 Ga0123354_10026133 3300010882 Bacteria 9207
17 Ga0466715_488739 3300042616 Bacteria 22610
18 Ga0466718_038401 3300042617 Bacteria 1238
19 Ga0415639_076566 3300038395 Bacteria 7175
20 Ga0466696_061308 3300042596 Bacteria 5728
21 Ga0466701_000978 3300042598 Bacteria 49977
22 2227590725 2225789004 Unclassified 2424
23 IMNBL1DRAFT_c0002998 3300000062 Bacteria 11194
24 JGI24702J35022_10032111 3300002462 Bacteria 2812
25 Ga0466731_225820 3300042622 Bacteria 13914
26 Ga0466704_140728 3300042643 Bacteria 10895
27 Ga0466705_053941 3300042612 Bacteria 5417
28 Ga0466733_164616 3300042659 Bacteria 5303
29 Ga0466714_084366 3300042603 Bacteria 21983
30 Ga0123357_10353347 3300009784 Bacteria 1403
31 Ga0123356_10004705 3300010049 Bacteria 14055
32 Ga0123356_10105392 3300010049 Bacteria 2713
33 Ga0123356_10172173 3300010049 Bacteria 2177
34 Ga0123356_10196917 3300010049 Bacteria 2051
35 Ga0123356_10346813 3300010049 Bacteria 1607
36 Ga0123356_10385259 3300010049 Bacteria 1536
37 Ga0123356_10560372 3300010049 Bacteria 1304
38 Ga0123356_10605370 3300010049 Bacteria 1261
39 Ga0123353_10020716 3300010167 Bacteria 9837
40 Ga0123353_10082871 3300010167 Bacteria 5159
41 Ga0123354_10063071 3300010882 Bacteria 5449
42 Ga0123354_10078263 3300010882 Bacteria 4702
43 Ga0466718_148167 3300042617 Bacteria 2643
44 Ga0466726_014304 3300042619 Bacteria 19540
45 Ga0415639_014328 3300038395 Bacteria 31068
46 Ga0466692_096164 3300042591 Bacteria 1340
47 JGI24702J35022_10002660 3300002462 Bacteria 10844
48 JGI24702J35022_10044596 3300002462 Bacteria 2363
49 JGI24703J35330_11652452 3300002501 Bacteria 1606
50 JGI24700J35501_10927699 3300002508 Unclassified 7003
51 Ga0072941_1194498 3300005201 Bacteria 22087
52 Ga0466709_398029 3300042648 Bacteria 84534
53 Ga0466708_223466 3300042652 Bacteria 31630
54 Ga0466707_135746 3300042601 Bacteria 1253
55 Ga0466713_034518 3300042602 Bacteria 40969
56 Ga0466722_173116 3300042609 Bacteria 181242
57 Ga0123355_10006271 3300009826 Bacteria 17578
58 Ga0123355_10294851 3300009826 Bacteria 2220
59 Ga0123356_10001780 3300010049 Bacteria 23506
60 Ga0123356_10002104 3300010049 Bacteria 21470
61 Ga0123356_10045567 3300010049 Bacteria 4080
62 Ga0123356_10112587 3300010049 Bacteria 2631
63 Ga0123356_10393125 3300010049 Bacteria 1522
64 Ga0123353_10092482 3300010167 Unclassified 4873
65 Ga0123353_10106362 3300010167 Bacteria 4521
66 Ga0123353_10255144 3300010167 Bacteria 2712
67 Ga0123353_10343851 3300010167 Bacteria 2252
68 Ga0123353_10344881 3300010167 Bacteria 2247
69 Ga0123354_10185427 3300010882 Bacteria 2355
70 Ga0466715_562081 3300042616 Bacteria 7046
71 Ga0466656_146497 3300042550 Bacteria 1744
72 Ga0466690_307186 3300042590 Bacteria 1289
73 Ga0466696_393857 3300042596 Bacteria 1236
74 HBC_ctgsDRAFT_1029180 3300000333 Bacteria 1355
75 JGI24702J35022_10025925 3300002462 Bacteria 3161
76 Ga0466729_274888 3300042621 Bacteria 1605
77 Ga0466705_065077 3300042612 Bacteria 5815
78 Ga0466714_040158 3300042603 Bacteria 1948
79 Ga0466716_278016 3300042605 Bacteria 19052
80 Ga0466719_057519 3300042606 Bacteria 7416
81 Ga0466719_250441 3300042606 Bacteria 19360
82 Ga0466722_264311 3300042609 Bacteria 1327
83 Ga0123357_10041986 3300009784 Bacteria 6220
84 Ga0123355_10459820 3300009826 Bacteria 1598
85 Ga0123356_10013450 3300010049 Bacteria 7897
86 Ga0123356_10013536 3300010049 Bacteria 7869
87 Ga0123356_10016403 3300010049 Bacteria 7068
88 Ga0123356_10035297 3300010049 Bacteria 4672
89 Ga0123356_10059546 3300010049 Bacteria 3562
90 Ga0123356_10060019 3300010049 Bacteria 3548
91 Ga0123356_10102392 3300010049 Bacteria 2749
92 Ga0123356_10379696 3300010049 Bacteria 1545
93 Ga0123353_10000593 3300010167 Bacteria 44284
94 Ga0123353_10144513 3300010167 Bacteria 3805
95 Ga0123353_10497263 3300010167 Bacteria 1778
96 Ga0123354_10290703 3300010882 Bacteria 1567
97 Ga0123354_10290974 3300010882 Bacteria 1566
98 Ga0415639_089902 3300038395 Bacteria 1090
99 Ga0466692_127746 3300042591 Bacteria 6837
100 Ga0466691_113359 3300042593 Bacteria 2497
101 IMNBL1DRAFT_c0005086 3300000062 Bacteria 7647
102 JGI24695J34938_10049216 3300002450 Bacteria 1853
103 JGI24700J35501_10930928 3300002508 Bacteria 55834
104 Ga0466704_042665 3300042643 Bacteria 2695
105 Ga0466714_059102 3300042603 Bacteria 3897
106 Ga0466721_050013 3300042608 Bacteria 16572
107 Ga0123357_10050520 3300009784 Bacteria 5628
108 Ga0123356_10068912 3300010049 Bacteria 3316
109 Ga0123356_10105332 3300010049 Bacteria 2713
110 Ga0123356_10467482 3300010049 Bacteria 1412
111 Ga0123353_10275846 3300010167 Bacteria 2586
112 Ga0123353_10330031 3300010167 Bacteria 2310
113 Ga0123353_10599788 3300010167 Bacteria 1574
114 Ga0123353_10814512 3300010167 Bacteria 1287
115 Ga0466726_038109 3300042619 Unclassified 8577
116 Ga0415639_075522 3300038395 Bacteria 2755
117 Ga0466694_116710 3300042594 Bacteria 6899
118 Ga0466696_126187 3300042596 Bacteria 1714
119 IMNBL1DRAFT_c0029204 3300000062 Bacteria 2044
120 JGI24702J35022_10161620 3300002462 Bacteria 1262
121 JGI24700J35501_10930765 3300002508 Bacteria 22545
122 Ga0466734_046412 3300042623 Bacteria 3422
123 Ga0466727_346205 3300042655 Bacteria 1936
124 Ga0466707_003451 3300042601 Bacteria 14475
125 Ga0466714_001629 3300042603 Bacteria 4171
126 Ga0466722_174453 3300042609 Bacteria 18060
127 Ga0123355_10003359 3300009826 Bacteria 22908
128 Ga0123355_10743752 3300009826 Bacteria 1111
129 Ga0123356_10000888 3300010049 Bacteria 33102
130 Ga0123356_10001745 3300010049 Bacteria 23657
131 Ga0123356_10015575 3300010049 Bacteria 7282
132 Ga0123356_10092391 3300010049 Bacteria 2886
133 Ga0123356_10288906 3300010049 Bacteria 1739
134 Ga0123353_10000032 3300010167 Bacteria 153370
135 Ga0123353_10430871 3300010167 Bacteria 1950
136 Ga0466729_156588 3300042621 Bacteria 2361
137 IMNBL1DRAFT_c0003356 3300000062 Bacteria 10387
138 IMNBL1DRAFT_c0058174 3300000062 Bacteria 1175
139 Ga0068302_10508567 3300005071 Bacteria 997
140 Ga0074278_132307 3300005721 Bacteria 8545
141 Ga0466702_048253 3300042635 Bacteria 2413
142 Ga0466703_416749 3300042636 Bacteria 10839
143 Ga0466704_373506 3300042643 Unclassified 14145
144 Ga0466704_447515 3300042643 Bacteria 1367
145 Ga0466709_271740 3300042648 Unclassified 56710
146 Ga0466706_267407 3300042599 Bacteria 4102
147 Ga0466717_268945 3300042604 Bacteria 32772
148 Ga0466719_280811 3300042606 Bacteria 18551
149 Ga0123357_10011139 3300009784 Bacteria 11503
150 Ga0123356_10005177 3300010049 Bacteria 13332
151 Ga0123356_10220447 3300010049 Bacteria 1953
152 Ga0123356_10473546 3300010049 Bacteria 1404
153 Ga0123353_10591364 3300010167 Bacteria 1589
154 Ga0466705_530038 3300042612 Bacteria 5520
155 Ga0466723_011749 3300042618 Bacteria 14421
156 Ga0466726_031584 3300042619 Bacteria 27301
157 Ga0466729_169210 3300042621 Bacteria 15399
158 Ga0466696_289846 3300042596 Bacteria 1128
159 Ga0068302_10011325 3300005071 Bacteria 11767
160 Ga0068302_10155444 3300005071 Bacteria 2241
161 Ga0466729_267825 3300042621 Bacteria 2782
162 Ga0466729_291467 3300042621 Bacteria 2591
163 Ga0466703_193799 3300042636 Unclassified 3372
164 Ga0466705_051590 3300042612 Bacteria 62178
165 Ga0466701_046327 3300042598 Unclassified 1538
166 Ga0466707_011234 3300042601 Bacteria 5064
167 Ga0466707_288031 3300042601 Bacteria 21006
168 Ga0466713_114014 3300042602 Bacteria 21101
169 Ga0466722_223611 3300042609 Bacteria 3968
170 Ga0123355_10000615 3300009826 Bacteria 48109
171 Ga0123356_10000010 3300010049 Bacteria 220063
172 Ga0123356_10077008 3300010049 Bacteria 3144
173 Ga0123356_10437214 3300010049 Bacteria 1454
174 Ga0123353_10005432 3300010167 Bacteria 16729
175 Ga0123353_10169962 3300010167 Bacteria 3462
176 Ga0123353_10730436 3300010167 Bacteria 1383
177 Ga0466705_479050 3300042612 Bacteria 1899
178 Ga0466715_471213 3300042616 Bacteria 5402
179 Ga0466718_071944 3300042617 Bacteria 3062
180 Ga0466718_077805 3300042617 Bacteria 2327
181 Ga0466693_317838 3300042592 Bacteria 2530
182 2227525488 2225789004 Bacteria 3251
183 JGI24695J34938_10030550 3300002450 Bacteria 2508
184 JGI24702J35022_10047079 3300002462 Bacteria 2296

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF08541 ACP_syn_III_C 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal 275 364 0.99
PF08545 ACP_syn_III 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 151 216 0.92
PF00108 Thiolase_N Thiolase, N-terminal domain 93 194 0.85

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00108 GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.