Protein Family IF12032

Metagenome Isolate
168 Members
66 Samples
126 Scaffolds
263.35 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2820282995|2820284879|
Length
324 aa
Sequence
LYTQTARQGCRALRKALDAGLQLDILRSAKLELIIVRCSCSGASGKPRPTNIIIHYSLLIEVIMLTKRLIACFDIIAGRVTKAVQFQDNIDVAAADELAQTMYEAQIDELIFYDITASSEKRPVDIETVKKVARCVFIPFTVGGGIKELDDMYEALKAGAEKISIDSMAVRNPQIISDGAKAFGSQCIVLSTQVKRTPSMPSGYEVYIDGARLATGLDALEWIKKGQELGAGEICINSIDNDGMLSGYDLELMKLAESSLSVPLIASGGAGKPEHLKALFEKTEAQAAIISSMLYSPRMESNYAVSEIKEYLIENGICMRPTRV

πŸ“Š Sample Types

Isolate 25.0%
Metagenome 75.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 62.5%
Termitidae 32.8%
Passalidae 3.1%
Hodotermitidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 22

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190893 Unclassified Elusimicrobia Nt197P4_bin29 Isolate Unclassified
2 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
3 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
4 2820014844 Unclassified Spirochaetes Nt197P3bin95 Isolate Unclassified
5 2820240463 Unclassified Firmicutes Th196P3bin85 Isolate Unclassified
6 2820246658 Unclassified Firmicutes Th196P3bin70 Isolate Unclassified
7 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
8 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
9 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
10 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
11 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
12 2820685979 Unclassified Firmicutes Co191P1bin81 Isolate Unclassified
13 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
18 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
19 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
24 2740892547 Fibrobacteria bacterium GUT77 MC_77 Isolate Unclassified
25 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
26 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
27 2820375548 Unclassified Firmicutes Nt197P1bin8 Isolate Unclassified
28 2820472365 Unclassified Firmicutes Lab288P1bin87 Isolate Unclassified
29 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
30 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
31 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
32 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
33 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
34 2820280018 Unclassified Firmicutes Th196P3bin149 Isolate Unclassified
35 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
36 2820462123 Unclassified Firmicutes Lab288P3bin129 Isolate Unclassified
37 2820673891 Unclassified Firmicutes Co191P3bin18 Isolate Unclassified
38 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
39 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
40 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
41 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
42 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
43 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
44 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
45 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
46 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
47 2820806175 Unclassified Actinobacteria Th196P3bin122 Isolate Unclassified
48 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
49 2778260941 Unclassified Fibrobacteres Th196P3bin8 Isolate Unclassified
50 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
51 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
52 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
53 2820277137 Unclassified Firmicutes Th196P3bin150 Isolate Unclassified
54 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
55 2820513949 Unclassified Firmicutes Lab288P1bin39 Isolate Unclassified
56 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
57 2820617402 Unclassified Firmicutes Emb289P1bin131 Isolate Unclassified
58 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
59 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
60 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
61 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
62 2820288918 Unclassified Firmicutes Th196P3bin137 Isolate Unclassified
63 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
64 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
65 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
66 3300005200 Nasutitermes gut metagenome Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0415639_047845 3300038395 Bacteria 10523
2 Ga0466693_360292 3300042592 Bacteria 3403
3 Ga0466694_207654 3300042594 Bacteria 1816
4 Ga0466694_271302 3300042594 Bacteria 4587
5 Ga0466699_279028 3300042597 Bacteria 2287
6 Ga0466699_282849 3300042597 Unclassified 1220
7 Ga0466699_320762 3300042597 Bacteria 25864
8 Ga0072941_1128887 3300005201 Bacteria 15469
9 Ga0466702_100257 3300042635 Bacteria 3554
10 Ga0466702_342180 3300042635 Bacteria 1279
11 Ga0466718_105478 3300042617 Bacteria 2643
12 Ga0123355_10000922 3300009826 Bacteria 40710
13 Ga0123355_10039396 3300009826 Bacteria 7688
14 Ga0123355_10194099 3300009826 Bacteria 2982
15 Ga0123356_10007648 3300010049 Bacteria 10768
16 Ga0466732_345256 3300042656 Bacteria 21012
17 Ga0466720_058251 3300042607 Bacteria 15810
18 Ga0415639_160236 3300038395 Bacteria 3146
19 Ga0466699_025911 3300042597 Bacteria 1379
20 Ga0466699_352369 3300042597 Unclassified 3408
21 Ga0072940_1040144 3300005200 Bacteria 2483
22 Ga0466702_062256 3300042635 Bacteria 47552
23 Ga0123355_10015896 3300009826 Bacteria 11841
24 Ga0123355_10085404 3300009826 Bacteria 5022
25 Ga0123355_10104473 3300009826 Bacteria 4448
26 Ga0123355_10184821 3300009826 Bacteria 3085
27 Ga0123354_10205825 3300010882 Unclassified 2146
28 Ga0466720_017687 3300042607 Bacteria 6296
29 Ga0264413_130260 3300024493 Bacteria 12956
30 Ga0264413_144958 3300024493 Unclassified 2356
31 Ga0415639_109238 3300038395 Unclassified 1075
32 Ga0466694_099352 3300042594 Bacteria 3175
33 Ga0466699_145077 3300042597 Bacteria 1852
34 2227425263 2225789004 Bacteria 5592
35 JGI24703J35330_11748536 3300002501 Bacteria 18955
36 Ga0072941_1002494 3300005201 Bacteria 21470
37 Ga0072941_1059881 3300005201 Bacteria 4663
38 Ga0466718_129043 3300042617 Bacteria 5658
39 Ga0123355_10009218 3300009826 Bacteria 14979
40 Ga0123355_10042369 3300009826 Bacteria 7410
41 Ga0123353_10205398 3300010167 Bacteria 3095
42 Ga0123353_10455892 3300010167 Bacteria 1881
43 Ga0123353_10923514 3300010167 Bacteria 1185
44 Ga0123354_10161216 3300010882 Bacteria 2661
45 Ga0466732_231252 3300042656 Bacteria 1700
46 Ga0415639_002342 3300038395 Bacteria 3203
47 Ga0415639_077797 3300038395 Bacteria 5188
48 Ga0466693_156461 3300042592 Unclassified 1073
49 JGI24703J35330_11747963 3300002501 Bacteria 9478
50 Ga0466702_123420 3300042635 Bacteria 2029
51 Ga0466718_091964 3300042617 Bacteria 11393
52 Ga0466718_096178 3300042617 Bacteria 1051
53 Ga0466718_104777 3300042617 Bacteria 1062
54 Ga0123355_10020495 3300009826 Bacteria 10561
55 Ga0123356_10284208 3300010049 Bacteria 1751
56 Ga0466717_022311 3300042604 Bacteria 3913
57 Ga0466720_084103 3300042607 Bacteria 2975
58 Ga0415639_007793 3300038395 Bacteria 12587
59 Ga0466693_244527 3300042592 Bacteria 2256
60 Ga0466699_046077 3300042597 Bacteria 7412
61 Ga0466699_072842 3300042597 Unclassified 2296
62 Ga0466699_141552 3300042597 Bacteria 9431
63 Ga0466699_221090 3300042597 Bacteria 4884
64 JGI24695J34938_10110367 3300002450 Unclassified 1121
65 JGI24703J35330_11647826 3300002501 Bacteria 1580
66 Ga0466702_440566 3300042635 Unclassified 1036
67 Ga0123355_10077423 3300009826 Bacteria 5316
68 Ga0123355_10626513 3300009826 Bacteria 1265
69 Ga0123356_10061823 3300010049 Unclassified 3498
70 Ga0123353_10156182 3300010167 Bacteria 3636
71 Ga0123353_10546235 3300010167 Bacteria 1673
72 Ga0123353_11031342 3300010167 Unclassified 1101
73 Ga0466732_281739 3300042656 Unclassified 1524
74 Ga0466717_242612 3300042604 Unclassified 1177
75 Ga0466720_129776 3300042607 Bacteria 44546
76 Ga0466720_230936 3300042607 Bacteria 5440
77 Ga0415639_060538 3300038395 Bacteria 4914
78 Ga0415639_064318 3300038395 Bacteria 4781
79 Ga0466693_168834 3300042592 Bacteria 4061
80 Ga0466694_025479 3300042594 Bacteria 30226
81 Ga0466699_323298 3300042597 Bacteria 1045
82 IMNBL1DRAFT_c0023769 3300000062 Bacteria 2394
83 JGI24695J34938_10001283 3300002450 Bacteria 22012
84 JGI24705J35276_12238810 3300002504 Bacteria 153372
85 Ga0072941_1088715 3300005201 Unclassified 9540
86 Ga0466702_002025 3300042635 Unclassified 2085
87 Ga0466702_111739 3300042635 Unclassified 3301
88 Ga0466702_385361 3300042635 Bacteria 1273
89 Ga0466718_017125 3300042617 Bacteria 2152
90 Ga0123353_10123295 3300010167 Bacteria 4165
91 Ga0123353_10493655 3300010167 Bacteria 1786
92 Ga0466732_273463 3300042656 Archaea 2000
93 Ga0466706_011360 3300042599 Bacteria 77012
94 Ga0466720_118212 3300042607 Bacteria 10704
95 Ga0264413_109032 3300024493 Bacteria 20980
96 Ga0466693_251270 3300042592 Unclassified 3080
97 Ga0466694_389754 3300042594 Bacteria 14466
98 Ga0466699_046566 3300042597 Bacteria 4054
99 Ga0466699_053478 3300042597 Bacteria 6145
100 Ga0466702_191755 3300042635 Bacteria 1207
101 Ga0466702_329660 3300042635 Bacteria 6578
102 Ga0466702_335754 3300042635 Bacteria 1586
103 Ga0123355_10049263 3300009826 Bacteria 6850
104 Ga0123355_10984726 3300009826 Unclassified 898
105 Ga0123353_10011893 3300010167 Bacteria 12307
106 Ga0123353_10568706 3300010167 Unclassified 1630
107 Ga0466720_123259 3300042607 Unclassified 6430
108 Ga0466720_137382 3300042607 Unclassified 1597
109 Ga0466698_057359 3300042610 Bacteria 8853
110 Ga0415639_191348 3300038395 Bacteria 1390
111 Ga0466693_083397 3300042592 Bacteria 1571
112 Ga0466693_286722 3300042592 Unclassified 1015
113 Ga0466699_116824 3300042597 Bacteria 1999
114 AustNasuHG_c1006334 3300000089 Bacteria 4229
115 JGI24702J35022_10054458 3300002462 Bacteria 2134
116 Ga0072940_1118823 3300005200 Bacteria 11896
117 Ga0074263_101283 3300005485 Bacteria 3503
118 Ga0466718_049337 3300042617 Bacteria 4391
119 Ga0466718_094911 3300042617 Bacteria 19633
120 Ga0466718_102131 3300042617 Bacteria 2366
121 Ga0123355_10000048 3300009826 Bacteria 122485
122 Ga0123355_10159974 3300009826 Bacteria 3395
123 Ga0123355_10312360 3300009826 Bacteria 2128
124 Ga0123355_10322406 3300009826 Bacteria 2080
125 Ga0123353_10137562 3300010167 Bacteria 3916
126 Ga0123353_10371848 3300010167 Bacteria 2142

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00977 His_biosynth Histidine biosynthesis protein 68 297 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00977 GO:0000105 L-histidine biosynthetic process BP

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.