Protein Family IF12032
Metagenome
Isolate
168
Members
66
Samples
126
Scaffolds
263.35
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820282995|2820284879|
- Length
- 324 aa
- Sequence
- LYTQTARQGCRALRKALDAGLQLDILRSAKLELIIVRCSCSGASGKPRPTNIIIHYSLLIEVIMLTKRLIACFDIIAGRVTKAVQFQDNIDVAAADELAQTMYEAQIDELIFYDITASSEKRPVDIETVKKVARCVFIPFTVGGGIKELDDMYEALKAGAEKISIDSMAVRNPQIISDGAKAFGSQCIVLSTQVKRTPSMPSGYEVYIDGARLATGLDALEWIKKGQELGAGEICINSIDNDGMLSGYDLELMKLAESSLSVPLIASGGAGKPEHLKALFEKTEAQAAIISSMLYSPRMESNYAVSEIKEYLIENGICMRPTRV
Sample Types
Isolate
25.0%
Metagenome
75.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
62.5%
Termitidae
32.8%
Passalidae
3.1%
Hodotermitidae
1.6%
Taxonomy
Archaea
1
Bacteria
145
Eukaryota
0
Viruses
0
Unclassified
22
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 2 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 3 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 4 | 2820014844 | Unclassified Spirochaetes Nt197P3bin95 | Isolate | Unclassified |
| 5 | 2820240463 | Unclassified Firmicutes Th196P3bin85 | Isolate | Unclassified |
| 6 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 7 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 10 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 11 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 12 | 2820685979 | Unclassified Firmicutes Co191P1bin81 | Isolate | Unclassified |
| 13 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 2820254385 | Unclassified Firmicutes Th196P3bin54 | Isolate | Unclassified |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 18 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 2740892547 | Fibrobacteria bacterium GUT77 MC_77 | Isolate | Unclassified |
| 25 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 26 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 27 | 2820375548 | Unclassified Firmicutes Nt197P1bin8 | Isolate | Unclassified |
| 28 | 2820472365 | Unclassified Firmicutes Lab288P1bin87 | Isolate | Unclassified |
| 29 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 30 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 2820001644 | Unclassified Synergistetes Th196P3bin106 | Isolate | Unclassified |
| 33 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 34 | 2820280018 | Unclassified Firmicutes Th196P3bin149 | Isolate | Unclassified |
| 35 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 36 | 2820462123 | Unclassified Firmicutes Lab288P3bin129 | Isolate | Unclassified |
| 37 | 2820673891 | Unclassified Firmicutes Co191P3bin18 | Isolate | Unclassified |
| 38 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 39 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 40 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 41 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 42 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 43 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 44 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 45 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 2820806175 | Unclassified Actinobacteria Th196P3bin122 | Isolate | Unclassified |
| 48 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 49 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 50 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 51 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 52 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 53 | 2820277137 | Unclassified Firmicutes Th196P3bin150 | Isolate | Unclassified |
| 54 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 55 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 56 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 57 | 2820617402 | Unclassified Firmicutes Emb289P1bin131 | Isolate | Unclassified |
| 58 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 59 | 2772190894 | Unclassified Elusimicrobia Th196P4_bin33 | Isolate | Unclassified |
| 60 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 61 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 62 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 63 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 64 | 2820387566 | Unclassified Firmicutes Nt197P1bin1 | Isolate | Unclassified |
| 65 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 66 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_047845 | 3300038395 | Bacteria | 10523 |
| 2 | Ga0466693_360292 | 3300042592 | Bacteria | 3403 |
| 3 | Ga0466694_207654 | 3300042594 | Bacteria | 1816 |
| 4 | Ga0466694_271302 | 3300042594 | Bacteria | 4587 |
| 5 | Ga0466699_279028 | 3300042597 | Bacteria | 2287 |
| 6 | Ga0466699_282849 | 3300042597 | Unclassified | 1220 |
| 7 | Ga0466699_320762 | 3300042597 | Bacteria | 25864 |
| 8 | Ga0072941_1128887 | 3300005201 | Bacteria | 15469 |
| 9 | Ga0466702_100257 | 3300042635 | Bacteria | 3554 |
| 10 | Ga0466702_342180 | 3300042635 | Bacteria | 1279 |
| 11 | Ga0466718_105478 | 3300042617 | Bacteria | 2643 |
| 12 | Ga0123355_10000922 | 3300009826 | Bacteria | 40710 |
| 13 | Ga0123355_10039396 | 3300009826 | Bacteria | 7688 |
| 14 | Ga0123355_10194099 | 3300009826 | Bacteria | 2982 |
| 15 | Ga0123356_10007648 | 3300010049 | Bacteria | 10768 |
| 16 | Ga0466732_345256 | 3300042656 | Bacteria | 21012 |
| 17 | Ga0466720_058251 | 3300042607 | Bacteria | 15810 |
| 18 | Ga0415639_160236 | 3300038395 | Bacteria | 3146 |
| 19 | Ga0466699_025911 | 3300042597 | Bacteria | 1379 |
| 20 | Ga0466699_352369 | 3300042597 | Unclassified | 3408 |
| 21 | Ga0072940_1040144 | 3300005200 | Bacteria | 2483 |
| 22 | Ga0466702_062256 | 3300042635 | Bacteria | 47552 |
| 23 | Ga0123355_10015896 | 3300009826 | Bacteria | 11841 |
| 24 | Ga0123355_10085404 | 3300009826 | Bacteria | 5022 |
| 25 | Ga0123355_10104473 | 3300009826 | Bacteria | 4448 |
| 26 | Ga0123355_10184821 | 3300009826 | Bacteria | 3085 |
| 27 | Ga0123354_10205825 | 3300010882 | Unclassified | 2146 |
| 28 | Ga0466720_017687 | 3300042607 | Bacteria | 6296 |
| 29 | Ga0264413_130260 | 3300024493 | Bacteria | 12956 |
| 30 | Ga0264413_144958 | 3300024493 | Unclassified | 2356 |
| 31 | Ga0415639_109238 | 3300038395 | Unclassified | 1075 |
| 32 | Ga0466694_099352 | 3300042594 | Bacteria | 3175 |
| 33 | Ga0466699_145077 | 3300042597 | Bacteria | 1852 |
| 34 | 2227425263 | 2225789004 | Bacteria | 5592 |
| 35 | JGI24703J35330_11748536 | 3300002501 | Bacteria | 18955 |
| 36 | Ga0072941_1002494 | 3300005201 | Bacteria | 21470 |
| 37 | Ga0072941_1059881 | 3300005201 | Bacteria | 4663 |
| 38 | Ga0466718_129043 | 3300042617 | Bacteria | 5658 |
| 39 | Ga0123355_10009218 | 3300009826 | Bacteria | 14979 |
| 40 | Ga0123355_10042369 | 3300009826 | Bacteria | 7410 |
| 41 | Ga0123353_10205398 | 3300010167 | Bacteria | 3095 |
| 42 | Ga0123353_10455892 | 3300010167 | Bacteria | 1881 |
| 43 | Ga0123353_10923514 | 3300010167 | Bacteria | 1185 |
| 44 | Ga0123354_10161216 | 3300010882 | Bacteria | 2661 |
| 45 | Ga0466732_231252 | 3300042656 | Bacteria | 1700 |
| 46 | Ga0415639_002342 | 3300038395 | Bacteria | 3203 |
| 47 | Ga0415639_077797 | 3300038395 | Bacteria | 5188 |
| 48 | Ga0466693_156461 | 3300042592 | Unclassified | 1073 |
| 49 | JGI24703J35330_11747963 | 3300002501 | Bacteria | 9478 |
| 50 | Ga0466702_123420 | 3300042635 | Bacteria | 2029 |
| 51 | Ga0466718_091964 | 3300042617 | Bacteria | 11393 |
| 52 | Ga0466718_096178 | 3300042617 | Bacteria | 1051 |
| 53 | Ga0466718_104777 | 3300042617 | Bacteria | 1062 |
| 54 | Ga0123355_10020495 | 3300009826 | Bacteria | 10561 |
| 55 | Ga0123356_10284208 | 3300010049 | Bacteria | 1751 |
| 56 | Ga0466717_022311 | 3300042604 | Bacteria | 3913 |
| 57 | Ga0466720_084103 | 3300042607 | Bacteria | 2975 |
| 58 | Ga0415639_007793 | 3300038395 | Bacteria | 12587 |
| 59 | Ga0466693_244527 | 3300042592 | Bacteria | 2256 |
| 60 | Ga0466699_046077 | 3300042597 | Bacteria | 7412 |
| 61 | Ga0466699_072842 | 3300042597 | Unclassified | 2296 |
| 62 | Ga0466699_141552 | 3300042597 | Bacteria | 9431 |
| 63 | Ga0466699_221090 | 3300042597 | Bacteria | 4884 |
| 64 | JGI24695J34938_10110367 | 3300002450 | Unclassified | 1121 |
| 65 | JGI24703J35330_11647826 | 3300002501 | Bacteria | 1580 |
| 66 | Ga0466702_440566 | 3300042635 | Unclassified | 1036 |
| 67 | Ga0123355_10077423 | 3300009826 | Bacteria | 5316 |
| 68 | Ga0123355_10626513 | 3300009826 | Bacteria | 1265 |
| 69 | Ga0123356_10061823 | 3300010049 | Unclassified | 3498 |
| 70 | Ga0123353_10156182 | 3300010167 | Bacteria | 3636 |
| 71 | Ga0123353_10546235 | 3300010167 | Bacteria | 1673 |
| 72 | Ga0123353_11031342 | 3300010167 | Unclassified | 1101 |
| 73 | Ga0466732_281739 | 3300042656 | Unclassified | 1524 |
| 74 | Ga0466717_242612 | 3300042604 | Unclassified | 1177 |
| 75 | Ga0466720_129776 | 3300042607 | Bacteria | 44546 |
| 76 | Ga0466720_230936 | 3300042607 | Bacteria | 5440 |
| 77 | Ga0415639_060538 | 3300038395 | Bacteria | 4914 |
| 78 | Ga0415639_064318 | 3300038395 | Bacteria | 4781 |
| 79 | Ga0466693_168834 | 3300042592 | Bacteria | 4061 |
| 80 | Ga0466694_025479 | 3300042594 | Bacteria | 30226 |
| 81 | Ga0466699_323298 | 3300042597 | Bacteria | 1045 |
| 82 | IMNBL1DRAFT_c0023769 | 3300000062 | Bacteria | 2394 |
| 83 | JGI24695J34938_10001283 | 3300002450 | Bacteria | 22012 |
| 84 | JGI24705J35276_12238810 | 3300002504 | Bacteria | 153372 |
| 85 | Ga0072941_1088715 | 3300005201 | Unclassified | 9540 |
| 86 | Ga0466702_002025 | 3300042635 | Unclassified | 2085 |
| 87 | Ga0466702_111739 | 3300042635 | Unclassified | 3301 |
| 88 | Ga0466702_385361 | 3300042635 | Bacteria | 1273 |
| 89 | Ga0466718_017125 | 3300042617 | Bacteria | 2152 |
| 90 | Ga0123353_10123295 | 3300010167 | Bacteria | 4165 |
| 91 | Ga0123353_10493655 | 3300010167 | Bacteria | 1786 |
| 92 | Ga0466732_273463 | 3300042656 | Archaea | 2000 |
| 93 | Ga0466706_011360 | 3300042599 | Bacteria | 77012 |
| 94 | Ga0466720_118212 | 3300042607 | Bacteria | 10704 |
| 95 | Ga0264413_109032 | 3300024493 | Bacteria | 20980 |
| 96 | Ga0466693_251270 | 3300042592 | Unclassified | 3080 |
| 97 | Ga0466694_389754 | 3300042594 | Bacteria | 14466 |
| 98 | Ga0466699_046566 | 3300042597 | Bacteria | 4054 |
| 99 | Ga0466699_053478 | 3300042597 | Bacteria | 6145 |
| 100 | Ga0466702_191755 | 3300042635 | Bacteria | 1207 |
| 101 | Ga0466702_329660 | 3300042635 | Bacteria | 6578 |
| 102 | Ga0466702_335754 | 3300042635 | Bacteria | 1586 |
| 103 | Ga0123355_10049263 | 3300009826 | Bacteria | 6850 |
| 104 | Ga0123355_10984726 | 3300009826 | Unclassified | 898 |
| 105 | Ga0123353_10011893 | 3300010167 | Bacteria | 12307 |
| 106 | Ga0123353_10568706 | 3300010167 | Unclassified | 1630 |
| 107 | Ga0466720_123259 | 3300042607 | Unclassified | 6430 |
| 108 | Ga0466720_137382 | 3300042607 | Unclassified | 1597 |
| 109 | Ga0466698_057359 | 3300042610 | Bacteria | 8853 |
| 110 | Ga0415639_191348 | 3300038395 | Bacteria | 1390 |
| 111 | Ga0466693_083397 | 3300042592 | Bacteria | 1571 |
| 112 | Ga0466693_286722 | 3300042592 | Unclassified | 1015 |
| 113 | Ga0466699_116824 | 3300042597 | Bacteria | 1999 |
| 114 | AustNasuHG_c1006334 | 3300000089 | Bacteria | 4229 |
| 115 | JGI24702J35022_10054458 | 3300002462 | Bacteria | 2134 |
| 116 | Ga0072940_1118823 | 3300005200 | Bacteria | 11896 |
| 117 | Ga0074263_101283 | 3300005485 | Bacteria | 3503 |
| 118 | Ga0466718_049337 | 3300042617 | Bacteria | 4391 |
| 119 | Ga0466718_094911 | 3300042617 | Bacteria | 19633 |
| 120 | Ga0466718_102131 | 3300042617 | Bacteria | 2366 |
| 121 | Ga0123355_10000048 | 3300009826 | Bacteria | 122485 |
| 122 | Ga0123355_10159974 | 3300009826 | Bacteria | 3395 |
| 123 | Ga0123355_10312360 | 3300009826 | Bacteria | 2128 |
| 124 | Ga0123355_10322406 | 3300009826 | Bacteria | 2080 |
| 125 | Ga0123353_10137562 | 3300010167 | Bacteria | 3916 |
| 126 | Ga0123353_10371848 | 3300010167 | Bacteria | 2142 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00977 | His_biosynth | Histidine biosynthesis protein | 68 | 297 | 0.96 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00977 | GO:0000105 | L-histidine biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.