Protein Family IF11921
Metagenome
Isolate
158
Members
110
Samples
100
Scaffolds
264.72
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820004052|2820004277|
- Length
- 303 aa
- Sequence
- LEEQESVVSQDAVQEESGNPENEEGQTLEKEEPKIPEKEKAHVIVVTSGKGGVGKTTSTSNIAVALAKLGKKVVAVDADIGLRNLDVVMGLENRVVYNFVDVLEGNCRLNQALVRDKRVDQLYLLPAAQTRTKDAVNQEQMIKLCDMLRDEFDYILLDCPAGIEGGFKNAAVGADEALIVVTPEVPSVRDADRIIGMLESMGKSPIRLIVNRIRPDMVRGGDMLDVPDIIEILAIGLIGIVPEDDNVIKAANRGEPMAFSNKAPAAQAYMNIAGRILGNDVPFLNLDTKPRGLLGNIKKILGM
Sample Types
Isolate
36.7%
Metagenome
63.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
31.1%
Termitidae
21.7%
Kalotermitidae
11.3%
Blattidae
8.5%
Elmidae
3.8%
Scarabaeidae
2.8%
Armadillidiidae
2.8%
Noctuidae
2.8%
Apidae
1.9%
Drosophilidae
1.9%
Rhinotermitidae
1.9%
Termopsidae
1.9%
Tenebrionidae
0.9%
Hodotermitidae
0.9%
Penaeidae
0.9%
Formicidae
0.9%
Passalidae
0.9%
Euphausiidae
0.9%
Stratiomyidae
0.9%
Nephropidae
0.9%
Taxonomy
Archaea
0
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 2 | 2820004052 | Unclassified Synergistetes Nt197P3bin25 | Isolate | Unclassified |
| 3 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 4 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 5 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 6 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 7 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 8 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 14 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 15 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 16 | 2820401926 | Unclassified Firmicutes Mp193P1bin2 | Isolate | Unclassified |
| 17 | 2820459456 | Unclassified Firmicutes Lab288P3bin148 | Isolate | Unclassified |
| 18 | 2820528380 | Unclassified Firmicutes Lab288P1bin143 | Isolate | Unclassified |
| 19 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 20 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 21 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 22 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 23 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 24 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 25 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 26 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 27 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 28 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 29 | 2820008971 | Unclassified Synergistetes Lab288P3bin103 | Isolate | Unclassified |
| 30 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 31 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 32 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 33 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 34 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 35 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 36 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 37 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 40 | 2819999932 | Unclassified Synergistetes Th196P4bin51 | Isolate | Unclassified |
| 41 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 42 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 43 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 44 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 45 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 46 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 47 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 48 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 49 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 50 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 51 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 52 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 53 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 54 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 55 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 56 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 57 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 58 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 59 | 2820369699 | Unclassified Firmicutes Nt197P3bin103 | Isolate | Unclassified |
| 60 | 2035265002 | Agrotis sp. gut microbial communities from Texas A and M University, USA | Metagenome | Noctuidae |
| 61 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 62 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 63 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 64 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 65 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 66 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 67 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 68 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 69 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 70 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 71 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 72 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 73 | 2820398208 | Unclassified Firmicutes Nc150P1bin1 | Isolate | Unclassified |
| 74 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 75 | 2834951433 | Brochothrix thermosphacta CD 337 | Isolate | Unclassified |
| 76 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 77 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 78 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 79 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 80 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 81 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 82 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 83 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 84 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 85 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 86 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 87 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 88 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 89 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 90 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 91 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 92 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 93 | 2820713307 | Unclassified Firmicutes Co191P1bin2 | Isolate | Unclassified |
| 94 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 95 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 96 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 97 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 98 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 99 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 100 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 101 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 102 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 103 | 2820356982 | Unclassified Firmicutes Nt197P3bin19 | Isolate | Unclassified |
| 104 | 2820439761 | Unclassified Firmicutes Lab288P3bin203 | Isolate | Unclassified |
| 105 | 2820565217 | Unclassified Firmicutes Emb289P3bin51 | Isolate | Unclassified |
| 106 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 107 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 108 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 109 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 110 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24697J35500_11272124 | 3300002507 | Bacteria | 4803 |
| 2 | Ga0466731_099474 | 3300042622 | Bacteria | 3192 |
| 3 | Ga0466706_235324 | 3300042599 | Bacteria | 4464 |
| 4 | Ga0123357_10404220 | 3300009784 | Bacteria | 1239 |
| 5 | Ga0123355_10000069 | 3300009826 | Bacteria | 109930 |
| 6 | Ga0123356_10028272 | 3300010049 | Bacteria | 5253 |
| 7 | Ga0466656_017416 | 3300042550 | Bacteria | 2207 |
| 8 | Ga0466705_330170 | 3300042612 | Bacteria | 5261 |
| 9 | Ga0466732_091585 | 3300042656 | Bacteria | 45413 |
| 10 | Ga0466730_070274 | 3300042625 | Bacteria | 1352 |
| 11 | Ga0466703_374114 | 3300042636 | Unclassified | 1816 |
| 12 | Ga0466725_393218 | 3300042654 | Bacteria | 1233 |
| 13 | Ga0466707_014061 | 3300042601 | Bacteria | 2670 |
| 14 | Ga0123355_10000163 | 3300009826 | Bacteria | 81520 |
| 15 | Ga0123355_10000761 | 3300009826 | Bacteria | 43990 |
| 16 | Ga0123355_10088265 | 3300009826 | Bacteria | 4926 |
| 17 | Ga0123353_10005204 | 3300010167 | Bacteria | 17009 |
| 18 | Ga0466657_020985 | 3300042582 | Bacteria | 4183 |
| 19 | 2211830526 | 2209111004 | Bacteria | 25086 |
| 20 | Ga0466729_277079 | 3300042621 | Bacteria | 6672 |
| 21 | Ga0466731_000114 | 3300042622 | Bacteria | 3956 |
| 22 | Ga0466704_482059 | 3300042643 | Bacteria | 1055 |
| 23 | Ga0466706_013581 | 3300042599 | Bacteria | 2826 |
| 24 | Ga0466706_059794 | 3300042599 | Bacteria | 8358 |
| 25 | Ga0466706_238936 | 3300042599 | Bacteria | 1273 |
| 26 | Ga0466717_170841 | 3300042604 | Bacteria | 6176 |
| 27 | Ga0123355_10034253 | 3300009826 | Bacteria | 8251 |
| 28 | Ga0123356_10019908 | 3300010049 | Bacteria | 6356 |
| 29 | Ga0160444_116514 | 3300012841 | Bacteria | 841 |
| 30 | Ga0466694_216246 | 3300042594 | Bacteria | 3247 |
| 31 | Ga0466705_338429 | 3300042612 | Bacteria | 1460 |
| 32 | JGI24705J35276_12221812 | 3300002504 | Bacteria | 2370 |
| 33 | JGI24705J35276_12238566 | 3300002504 | Bacteria | 26902 |
| 34 | JGI24705J35276_12238723 | 3300002504 | Bacteria | 45356 |
| 35 | Ga0466715_229067 | 3300042616 | Bacteria | 8164 |
| 36 | Ga0466728_255537 | 3300042620 | Bacteria | 51069 |
| 37 | Ga0466729_152338 | 3300042621 | Bacteria | 104951 |
| 38 | Ga0466716_192066 | 3300042605 | Bacteria | 5407 |
| 39 | Ga0466719_404864 | 3300042606 | Bacteria | 2896 |
| 40 | Ga0466697_030714 | 3300042611 | Bacteria | 5712 |
| 41 | Ga0123353_10141991 | 3300010167 | Bacteria | 3845 |
| 42 | Ga0123353_10941754 | 3300010167 | Bacteria | 1170 |
| 43 | Ga0160452_100181 | 3300012834 | Bacteria | 71782 |
| 44 | Ga0160455_102000 | 3300012837 | Bacteria | 4843 |
| 45 | Ga0466690_062986 | 3300042590 | Bacteria | 21835 |
| 46 | Ga0466694_070517 | 3300042594 | Bacteria | 1413 |
| 47 | Ga0466696_231199 | 3300042596 | Bacteria | 1453 |
| 48 | Ga0466705_116336 | 3300042612 | Bacteria | 6866 |
| 49 | Ga0466733_059913 | 3300042659 | Bacteria | 7456 |
| 50 | JGI24702J35022_10000581 | 3300002462 | Bacteria | 22183 |
| 51 | Ga0072941_1122178 | 3300005201 | Bacteria | 10197 |
| 52 | Ga0466707_014324 | 3300042601 | Bacteria | 12983 |
| 53 | Ga0466717_105600 | 3300042604 | Unclassified | 5179 |
| 54 | Ga0123355_10335456 | 3300009826 | Bacteria | 2020 |
| 55 | Ga0123355_10399677 | 3300009826 | Unclassified | 1773 |
| 56 | Ga0123356_10033065 | 3300010049 | Bacteria | 4837 |
| 57 | Ga0123353_10051823 | 3300010167 | Bacteria | 6550 |
| 58 | Ga0123353_10109926 | 3300010167 | Bacteria | 4441 |
| 59 | Ga0160453_100836 | 3300012814 | Bacteria | 16178 |
| 60 | Ga0466705_271379 | 3300042612 | Bacteria | 5133 |
| 61 | Ga0530661_000001 | 3300056564 | Bacteria | 684835 |
| 62 | CwormDRAF_NODE_3409_len_5032_cov_190_581482 | 2035265002 | Bacteria | 5062 |
| 63 | IMNBL1DRAFT_c0002525 | 3300000062 | Bacteria | 12673 |
| 64 | IMNBL1DRAFT_c0010526 | 3300000062 | Bacteria | 4413 |
| 65 | Ga0052191_101970 | 3300003097 | Unclassified | 5062 |
| 66 | Ga0068305_10325553 | 3300005083 | Bacteria | 1627 |
| 67 | Ga0105524_101199 | 3300007733 | Bacteria | 4135 |
| 68 | Ga0466715_392047 | 3300042616 | Bacteria | 6357 |
| 69 | Ga0466715_413313 | 3300042616 | Bacteria | 3840 |
| 70 | Ga0466718_099223 | 3300042617 | Bacteria | 4076 |
| 71 | Ga0466706_001339 | 3300042599 | Bacteria | 59214 |
| 72 | Ga0466722_183673 | 3300042609 | Bacteria | 1625 |
| 73 | Ga0123355_10112618 | 3300009826 | Bacteria | 4246 |
| 74 | Ga0123355_10249728 | 3300009826 | Bacteria | 2500 |
| 75 | Ga0123354_10052380 | 3300010882 | Bacteria | 6149 |
| 76 | Ga0068305_10004896 | 3300005083 | Bacteria | 18292 |
| 77 | Ga0072940_1484483 | 3300005200 | Bacteria | 1225 |
| 78 | Ga0466705_464781 | 3300042612 | Unclassified | 22005 |
| 79 | Ga0466715_010717 | 3300042616 | Bacteria | 24838 |
| 80 | Ga0466726_459743 | 3300042619 | Bacteria | 2573 |
| 81 | Ga0466734_023933 | 3300042623 | Bacteria | 1066 |
| 82 | Ga0466707_026924 | 3300042601 | Bacteria | 1442 |
| 83 | Ga0466707_423372 | 3300042601 | Bacteria | 7354 |
| 84 | Ga0466719_262340 | 3300042606 | Bacteria | 3124 |
| 85 | Ga0123355_10096219 | 3300009826 | Bacteria | 4677 |
| 86 | Ga0123355_10367935 | 3300009826 | Bacteria | 1886 |
| 87 | Ga0160452_100480 | 3300012834 | Bacteria | 26661 |
| 88 | Ga0466697_198760 | 3300042611 | Bacteria | 7959 |
| 89 | JGI24703J35330_11562341 | 3300002501 | Bacteria | 1256 |
| 90 | JGI24705J35276_12238817 | 3300002504 | Bacteria | 232340 |
| 91 | Ga0466711_040755 | 3300042615 | Bacteria | 16989 |
| 92 | Ga0466704_436948 | 3300042643 | Bacteria | 1860 |
| 93 | Ga0466709_068776 | 3300042648 | Bacteria | 148378 |
| 94 | Ga0466727_179590 | 3300042655 | Bacteria | 18826 |
| 95 | Ga0466722_138341 | 3300042609 | Bacteria | 84934 |
| 96 | Ga0123357_10282862 | 3300009784 | Bacteria | 1710 |
| 97 | Ga0123355_10215693 | 3300009826 | Bacteria | 2771 |
| 98 | Ga0123353_10579904 | 3300010167 | Bacteria | 1609 |
| 99 | Ga0160445_101164 | 3300012847 | Bacteria | 8170 |
| 100 | Ga0466694_357441 | 3300042594 | Bacteria | 5766 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01656 | CbiA | CobQ/CobB/MinD/ParA nucleotide binding domain | 44 | 256 | 0.96 |
| PF02374 | ArsA_ATPase | Anion-transporting ATPase | 44 | 79 | 0.92 |
| PF00142 | Fer4_NifH | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family | 46 | 79 | 0.89 |
| PF13614 | AAA_31 | AAA domain | 42 | 201 | 0.86 |
| PF06564 | CBP_BcsQ | Cellulose biosynthesis protein BcsQ | 43 | 186 | 0.81 |
| PF10609 | ParA | NUBPL iron-transfer P-loop NTPase | 41 | 276 | 0.79 |
| PF09140 | MipZ | ATPase MipZ | 42 | 194 | 0.7 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.