Protein Family IF11835
Metagenome
Metatranscriptome
Isolate
349
Members
73
Samples
337
Scaffolds
107.99
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125689|2781426537|
- Length
- 130 aa
- Sequence
- MAATKEEILEAIASMTVLEVSELVKMMEEKFGVSAAAPVAVAVGGGGAGGGAPAAAAEEKTEFNVILKAFEESKKIAVIKEVRAVTGLGLKEAKDLVEGAPKPLKENASKDEAAKIKEAVTAAGGTVEIQ
Sample Types
Isolate
3.4%
Metagenome
95.1%
MAG
0.0%
Metatranscriptome
1.4%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.7%
Kalotermitidae
19.7%
Unclassified
18.3%
Rhinotermitidae
4.2%
Termopsidae
4.2%
Blaberidae
1.4%
Hodotermitidae
1.4%
Taxonomy
Archaea
0
Bacteria
250
Eukaryota
0
Viruses
0
Unclassified
99
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 23 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 24 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 33 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 38 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 39 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 40 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 43 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 44 | 3300021238 | Termite gut microbial communities from nest - French Guiana - 6_6 mRNA SA | Metatranscriptome | Termitidae |
| 45 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 46 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 47 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 48 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 49 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 50 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 51 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 52 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 53 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 54 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 55 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 56 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 57 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 58 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 59 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 60 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 61 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 62 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 63 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 64 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 65 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 66 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 67 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 68 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 69 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | FAAS_10580525 | 3300001880 | Bacteria | 558 |
| 2 | JGI24698J34947_10039368 | 3300002449 | Unclassified | 2448 |
| 3 | JGI24698J34947_10207072 | 3300002449 | Unclassified | 763 |
| 4 | JGI24702J35022_10082505 | 3300002462 | Bacteria | 1742 |
| 5 | Ga0222431_1000875 | 3300021190 | Bacteria | 1666 |
| 6 | Ga0466690_007249 | 3300042590 | Bacteria | 17772 |
| 7 | Ga0466694_159985 | 3300042594 | Bacteria | 1173 |
| 8 | Ga0466694_402014 | 3300042594 | Unclassified | 2088 |
| 9 | Ga0466696_067471 | 3300042596 | Bacteria | 14760 |
| 10 | Ga0466696_137049 | 3300042596 | Bacteria | 2123 |
| 11 | Ga0466696_190385 | 3300042596 | Bacteria | 26854 |
| 12 | Ga0466696_306215 | 3300042596 | Bacteria | 3183 |
| 13 | Ga0466699_180959 | 3300042597 | Bacteria | 5301 |
| 14 | Ga0466699_227845 | 3300042597 | Bacteria | 18629 |
| 15 | Ga0466699_289964 | 3300042597 | Unclassified | 1567 |
| 16 | Ga0466712_020715 | 3300042614 | Unclassified | 1460 |
| 17 | Ga0466712_283945 | 3300042614 | Bacteria | 1220 |
| 18 | Ga0466712_314892 | 3300042614 | Bacteria | 1805 |
| 19 | Ga0466715_392152 | 3300042616 | Bacteria | 2681 |
| 20 | Ga0466715_416021 | 3300042616 | Unclassified | 3169 |
| 21 | Ga0466718_077322 | 3300042617 | Bacteria | 31469 |
| 22 | Ga0466723_317522 | 3300042618 | Bacteria | 3563 |
| 23 | Ga0466726_287547 | 3300042619 | Bacteria | 6080 |
| 24 | Ga0466726_359064 | 3300042619 | Bacteria | 1763 |
| 25 | Ga0466726_433814 | 3300042619 | Bacteria | 1102 |
| 26 | Ga0466728_162198 | 3300042620 | Bacteria | 1376 |
| 27 | Ga0466702_376717 | 3300042635 | Unclassified | 1822 |
| 28 | Ga0466703_083527 | 3300042636 | Bacteria | 18804 |
| 29 | Ga0466703_330300 | 3300042636 | Unclassified | 2250 |
| 30 | Ga0466709_060483 | 3300042648 | Bacteria | 14406 |
| 31 | Ga0466709_261489 | 3300042648 | Unclassified | 1463 |
| 32 | Ga0466701_045382 | 3300042598 | Unclassified | 1070 |
| 33 | Ga0466706_128720 | 3300042599 | Bacteria | 33388 |
| 34 | Ga0466707_037385 | 3300042601 | Bacteria | 3652 |
| 35 | Ga0466707_238109 | 3300042601 | Bacteria | 2514 |
| 36 | Ga0466719_294162 | 3300042606 | Unclassified | 4641 |
| 37 | Ga0466719_371283 | 3300042606 | Bacteria | 6314 |
| 38 | Ga0466720_033982 | 3300042607 | Bacteria | 4484 |
| 39 | Ga0466720_117754 | 3300042607 | Unclassified | 3645 |
| 40 | Ga0466722_101149 | 3300042609 | Bacteria | 14736 |
| 41 | Ga0466722_108308 | 3300042609 | Bacteria | 42621 |
| 42 | Ga0466698_200106 | 3300042610 | Unclassified | 2574 |
| 43 | Ga0466698_206852 | 3300042610 | Bacteria | 3531 |
| 44 | Ga0123355_10950270 | 3300009826 | Unclassified | 923 |
| 45 | Ga0123356_10657667 | 3300010049 | Bacteria | 1215 |
| 46 | Ga0123353_10112776 | 3300010167 | Unclassified | 4377 |
| 47 | Ga0123353_10279296 | 3300010167 | Bacteria | 2566 |
| 48 | Ga0466705_035029 | 3300042612 | Bacteria | 4347 |
| 49 | Ga0466705_221175 | 3300042612 | Bacteria | 3509 |
| 50 | Ga0466733_134402 | 3300042659 | Unclassified | 1458 |
| 51 | AustNasuHG_c1007749 | 3300000089 | Bacteria | 3811 |
| 52 | JGI24698J34947_10206627 | 3300002449 | Unclassified | 764 |
| 53 | JGI24698J34947_10319532 | 3300002449 | Unclassified | 553 |
| 54 | JGI24695J34938_10026294 | 3300002450 | Bacteria | 2767 |
| 55 | Ga0264413_106766 | 3300024493 | Unclassified | 6219 |
| 56 | Ga0466691_100834 | 3300042593 | Bacteria | 22486 |
| 57 | Ga0466696_156531 | 3300042596 | Bacteria | 6876 |
| 58 | Ga0466705_449836 | 3300042612 | Bacteria | 1809 |
| 59 | Ga0466705_500237 | 3300042612 | Bacteria | 4733 |
| 60 | Ga0466712_055419 | 3300042614 | Bacteria | 7618 |
| 61 | Ga0466711_133365 | 3300042615 | Bacteria | 16038 |
| 62 | Ga0466715_574702 | 3300042616 | Unclassified | 1827 |
| 63 | Ga0466723_005924 | 3300042618 | Bacteria | 37995 |
| 64 | Ga0466723_256170 | 3300042618 | Bacteria | 2697 |
| 65 | Ga0466728_164671 | 3300042620 | Bacteria | 3753 |
| 66 | Ga0466728_335928 | 3300042620 | Bacteria | 8489 |
| 67 | Ga0466729_266662 | 3300042621 | Bacteria | 1196 |
| 68 | Ga0466729_282797 | 3300042621 | Unclassified | 1011 |
| 69 | Ga0466734_089191 | 3300042623 | Unclassified | 1029 |
| 70 | Ga0466703_302657 | 3300042636 | Bacteria | 56159 |
| 71 | Ga0466704_133027 | 3300042643 | Bacteria | 4734 |
| 72 | Ga0466704_291003 | 3300042643 | Bacteria | 20080 |
| 73 | Ga0466709_092008 | 3300042648 | Bacteria | 19165 |
| 74 | Ga0466709_134791 | 3300042648 | Bacteria | 15610 |
| 75 | Ga0466709_149267 | 3300042648 | Bacteria | 13000 |
| 76 | Ga0466709_224667 | 3300042648 | Bacteria | 4374 |
| 77 | Ga0466709_326377 | 3300042648 | Bacteria | 2241 |
| 78 | Ga0466709_368160 | 3300042648 | Bacteria | 7834 |
| 79 | Ga0466708_175154 | 3300042652 | Bacteria | 5154 |
| 80 | Ga0466707_180518 | 3300042601 | Bacteria | 1464 |
| 81 | Ga0466707_398452 | 3300042601 | Unclassified | 2128 |
| 82 | Ga0466716_434731 | 3300042605 | Unclassified | 2342 |
| 83 | Ga0466719_145243 | 3300042606 | Bacteria | 2272 |
| 84 | Ga0123355_10294562 | 3300009826 | Bacteria | 2221 |
| 85 | Ga0123355_10885467 | 3300009826 | Unclassified | 974 |
| 86 | Ga0123356_10159713 | 3300010049 | Unclassified | 2250 |
| 87 | Ga0123353_10095701 | 3300010167 | Unclassified | 4784 |
| 88 | Ga0123353_10282971 | 3300010167 | Bacteria | 2545 |
| 89 | Ga0466705_038272 | 3300042612 | Bacteria | 31317 |
| 90 | Ga0466705_384880 | 3300042612 | Bacteria | 9917 |
| 91 | Nasutiter_Contig47490 | 2030936001 | Bacteria | 1977 |
| 92 | JGI24698J34947_10018162 | 3300002449 | Unclassified | 3804 |
| 93 | JGI24698J34947_10062410 | 3300002449 | Unclassified | 1830 |
| 94 | JGI24698J34947_10084883 | 3300002449 | Unclassified | 1473 |
| 95 | JGI24698J34947_10103605 | 3300002449 | Unclassified | 1273 |
| 96 | JGI24695J34938_10000406 | 3300002450 | Bacteria | 41980 |
| 97 | JGI24695J34938_10002418 | 3300002450 | Bacteria | 14320 |
| 98 | JGI24705J35276_12157354 | 3300002504 | Bacteria | 1214 |
| 99 | JGI24699J35502_11065731 | 3300002509 | Bacteria | 1787 |
| 100 | JGI24699J35502_11133241 | 3300002509 | Bacteria | 9370 |
| 101 | Ga0223681_1001784 | 3300021238 | Unclassified | 1330 |
| 102 | Ga0466657_047561 | 3300042582 | Bacteria | 1867 |
| 103 | Ga0466692_168214 | 3300042591 | Bacteria | 5263 |
| 104 | Ga0466691_060408 | 3300042593 | Bacteria | 4224 |
| 105 | Ga0466694_012465 | 3300042594 | Bacteria | 5288 |
| 106 | Ga0466694_102442 | 3300042594 | Unclassified | 1729 |
| 107 | Ga0466699_070921 | 3300042597 | Bacteria | 15430 |
| 108 | Ga0466699_127144 | 3300042597 | Bacteria | 16580 |
| 109 | Ga0466699_130322 | 3300042597 | Unclassified | 2324 |
| 110 | Ga0466699_165886 | 3300042597 | Unclassified | 1154 |
| 111 | Ga0466699_305470 | 3300042597 | Bacteria | 2713 |
| 112 | Ga0466705_424213 | 3300042612 | Bacteria | 13610 |
| 113 | Ga0466712_075027 | 3300042614 | Bacteria | 25514 |
| 114 | Ga0466712_172012 | 3300042614 | Bacteria | 6690 |
| 115 | Ga0466712_174861 | 3300042614 | Unclassified | 1995 |
| 116 | Ga0466711_023306 | 3300042615 | Bacteria | 21263 |
| 117 | Ga0466715_392293 | 3300042616 | Bacteria | 14951 |
| 118 | Ga0466715_546006 | 3300042616 | Bacteria | 5528 |
| 119 | Ga0466723_090892 | 3300042618 | Bacteria | 2907 |
| 120 | Ga0466723_362598 | 3300042618 | Bacteria | 2042 |
| 121 | Ga0466726_144112 | 3300042619 | Bacteria | 4753 |
| 122 | Ga0466728_017609 | 3300042620 | Bacteria | 3684 |
| 123 | Ga0466728_206819 | 3300042620 | Bacteria | 2063 |
| 124 | Ga0466731_258549 | 3300042622 | Unclassified | 1027 |
| 125 | Ga0466731_311278 | 3300042622 | Bacteria | 1003 |
| 126 | Ga0466735_129792 | 3300042624 | Bacteria | 2548 |
| 127 | Ga0466703_416676 | 3300042636 | Bacteria | 1231 |
| 128 | Ga0466704_061807 | 3300042643 | Unclassified | 13580 |
| 129 | Ga0466704_088928 | 3300042643 | Bacteria | 5116 |
| 130 | Ga0466704_168972 | 3300042643 | Bacteria | 3412 |
| 131 | Ga0466724_31078 | 3300042649 | Bacteria | 1568 |
| 132 | Ga0466708_165937 | 3300042652 | Bacteria | 27077 |
| 133 | Ga0466708_243516 | 3300042652 | Bacteria | 3998 |
| 134 | Ga0466727_022238 | 3300042655 | Bacteria | 20910 |
| 135 | Ga0466727_332187 | 3300042655 | Bacteria | 2325 |
| 136 | Ga0466716_022504 | 3300042605 | Bacteria | 7037 |
| 137 | Ga0466719_181685 | 3300042606 | Bacteria | 12435 |
| 138 | Ga0466719_182326 | 3300042606 | Bacteria | 8554 |
| 139 | Ga0466719_241071 | 3300042606 | Bacteria | 5300 |
| 140 | Ga0466719_401129 | 3300042606 | Bacteria | 3411 |
| 141 | Ga0466698_016678 | 3300042610 | Bacteria | 13071 |
| 142 | Ga0466697_001081 | 3300042611 | Bacteria | 2130 |
| 143 | Ga0123355_10468895 | 3300009826 | Bacteria | 1575 |
| 144 | Ga0123356_10398985 | 3300010049 | Bacteria | 1512 |
| 145 | Ga0123353_10002061 | 3300010167 | Bacteria | 24829 |
| 146 | Ga0123353_10649175 | 3300010167 | Unclassified | 1494 |
| 147 | Ga0123354_10140041 | 3300010882 | Unclassified | 2999 |
| 148 | Ga0123354_10723723 | 3300010882 | Unclassified | 689 |
| 149 | Ga0466705_196225 | 3300042612 | Unclassified | 2176 |
| 150 | Ga0466732_407284 | 3300042656 | Bacteria | 22255 |
| 151 | AustNasuHG_c1009536 | 3300000089 | Bacteria | 3403 |
| 152 | JGI24698J34947_10000266 | 3300002449 | Bacteria | 22368 |
| 153 | JGI24698J34947_10038565 | 3300002449 | Unclassified | 2477 |
| 154 | JGI24698J34947_10129939 | 3300002449 | Unclassified | 1078 |
| 155 | JGI24695J34938_10000605 | 3300002450 | Bacteria | 34496 |
| 156 | JGI24695J34938_10003330 | 3300002450 | Bacteria | 11311 |
| 157 | JGI24695J34938_10008298 | 3300002450 | Bacteria | 5938 |
| 158 | JGI24695J34938_10045691 | 3300002450 | Bacteria | 1941 |
| 159 | Ga0466693_033746 | 3300042592 | Unclassified | 2668 |
| 160 | Ga0466693_111318 | 3300042592 | Bacteria | 6452 |
| 161 | Ga0466691_126548 | 3300042593 | Bacteria | 4010 |
| 162 | Ga0466691_203313 | 3300042593 | Bacteria | 1557 |
| 163 | Ga0466691_215021 | 3300042593 | Bacteria | 4146 |
| 164 | Ga0466694_072643 | 3300042594 | Bacteria | 15075 |
| 165 | Ga0466705_479965 | 3300042612 | Bacteria | 20919 |
| 166 | Ga0466712_020257 | 3300042614 | Bacteria | 9948 |
| 167 | Ga0466712_132883 | 3300042614 | Bacteria | 18326 |
| 168 | Ga0466723_157871 | 3300042618 | Bacteria | 4169 |
| 169 | Ga0466723_306730 | 3300042618 | Bacteria | 1334 |
| 170 | Ga0466729_039061 | 3300042621 | Unclassified | 1033 |
| 171 | Ga0466702_180637 | 3300042635 | Bacteria | 1539 |
| 172 | Ga0466702_231968 | 3300042635 | Unclassified | 2464 |
| 173 | Ga0466703_156606 | 3300042636 | Bacteria | 7268 |
| 174 | Ga0466703_243841 | 3300042636 | Bacteria | 17504 |
| 175 | Ga0466704_083362 | 3300042643 | Bacteria | 3189 |
| 176 | Ga0466709_047026 | 3300042648 | Unclassified | 1548 |
| 177 | Ga0466709_269973 | 3300042648 | Bacteria | 3894 |
| 178 | Ga0466708_150210 | 3300042652 | Bacteria | 8651 |
| 179 | Ga0466727_017331 | 3300042655 | Bacteria | 1296 |
| 180 | Ga0466700_422185 | 3300042600 | Unclassified | 1408 |
| 181 | Ga0466713_124370 | 3300042602 | Bacteria | 1989 |
| 182 | Ga0466722_178936 | 3300042609 | Bacteria | 1505 |
| 183 | Ga0123357_10598124 | 3300009784 | Bacteria | 848 |
| 184 | Ga0123356_10816930 | 3300010049 | Unclassified | 1103 |
| 185 | Ga0123356_13524029 | 3300010049 | Unclassified | 542 |
| 186 | Ga0123354_10340642 | 3300010882 | Unclassified | 1352 |
| 187 | Ga0466705_187019 | 3300042612 | Bacteria | 4087 |
| 188 | Ga0466733_204097 | 3300042659 | Bacteria | 1947 |
| 189 | JGI24702J35022_10003014 | 3300002462 | Bacteria | 10190 |
| 190 | JGI24702J35022_10016369 | 3300002462 | Bacteria | 4065 |
| 191 | Ga0072940_1074265 | 3300005200 | Unclassified | 1098 |
| 192 | Ga0074263_103383 | 3300005485 | Unclassified | 2278 |
| 193 | Ga0255786_1003983 | 3300022815 | Unclassified | 1414 |
| 194 | Ga0466690_423654 | 3300042590 | Bacteria | 5745 |
| 195 | Ga0466692_101657 | 3300042591 | Bacteria | 10037 |
| 196 | Ga0466693_085912 | 3300042592 | Bacteria | 2128 |
| 197 | Ga0466693_236433 | 3300042592 | Bacteria | 8743 |
| 198 | Ga0466694_079552 | 3300042594 | Bacteria | 2773 |
| 199 | Ga0466694_150349 | 3300042594 | Bacteria | 2092 |
| 200 | Ga0466696_021215 | 3300042596 | Bacteria | 10369 |
| 201 | Ga0466699_226020 | 3300042597 | Unclassified | 1078 |
| 202 | Ga0466712_031720 | 3300042614 | Bacteria | 10734 |
| 203 | Ga0466712_117568 | 3300042614 | Unclassified | 2566 |
| 204 | Ga0466715_011846 | 3300042616 | Bacteria | 5810 |
| 205 | Ga0466715_052684 | 3300042616 | Unclassified | 2656 |
| 206 | Ga0466715_222898 | 3300042616 | Bacteria | 2658 |
| 207 | Ga0466715_317113 | 3300042616 | Bacteria | 3431 |
| 208 | Ga0466715_357213 | 3300042616 | Bacteria | 5047 |
| 209 | Ga0466715_554762 | 3300042616 | Bacteria | 2767 |
| 210 | Ga0466718_089148 | 3300042617 | Unclassified | 1602 |
| 211 | Ga0466726_238586 | 3300042619 | Bacteria | 3744 |
| 212 | Ga0466726_471977 | 3300042619 | Bacteria | 1789 |
| 213 | Ga0466728_106020 | 3300042620 | Bacteria | 13273 |
| 214 | Ga0466728_482190 | 3300042620 | Bacteria | 3653 |
| 215 | Ga0466735_070012 | 3300042624 | Bacteria | 1486 |
| 216 | Ga0466735_070020 | 3300042624 | Unclassified | 1068 |
| 217 | Ga0466730_100096 | 3300042625 | Bacteria | 2034 |
| 218 | Ga0466703_033540 | 3300042636 | Bacteria | 5037 |
| 219 | Ga0466703_323758 | 3300042636 | Bacteria | 6443 |
| 220 | Ga0466704_031855 | 3300042643 | Bacteria | 22665 |
| 221 | Ga0466704_391832 | 3300042643 | Bacteria | 4866 |
| 222 | Ga0466708_253153 | 3300042652 | Bacteria | 7615 |
| 223 | Ga0466727_162864 | 3300042655 | Bacteria | 2423 |
| 224 | Ga0466700_124474 | 3300042600 | Bacteria | 21452 |
| 225 | Ga0123353_10147238 | 3300010167 | Bacteria | 3764 |
| 226 | Ga0123354_10241047 | 3300010882 | Unclassified | 1860 |
| 227 | Ga0123354_10302834 | 3300010882 | Bacteria | 1509 |
| 228 | Ga0466732_033946 | 3300042656 | Bacteria | 4552 |
| 229 | Ga0466733_205671 | 3300042659 | Bacteria | 2430 |
| 230 | FAAS_10113925 | 3300001880 | Unclassified | 509 |
| 231 | JGI24698J34947_10004025 | 3300002449 | Bacteria | 7991 |
| 232 | JGI24698J34947_10043356 | 3300002449 | Unclassified | 2307 |
| 233 | JGI24695J34938_10005661 | 3300002450 | Bacteria | 7719 |
| 234 | JGI24695J34938_10024458 | 3300002450 | Bacteria | 2901 |
| 235 | JGI24702J35022_10085033 | 3300002462 | Unclassified | 1717 |
| 236 | Ga0466690_171320 | 3300042590 | Bacteria | 2193 |
| 237 | Ga0466690_392260 | 3300042590 | Unclassified | 1693 |
| 238 | Ga0466692_095952 | 3300042591 | Unclassified | 1467 |
| 239 | Ga0466691_038805 | 3300042593 | Bacteria | 9978 |
| 240 | Ga0466691_098562 | 3300042593 | Bacteria | 11503 |
| 241 | Ga0466694_079766 | 3300042594 | Unclassified | 3080 |
| 242 | Ga0466694_240018 | 3300042594 | Unclassified | 1784 |
| 243 | Ga0466696_088095 | 3300042596 | Bacteria | 3510 |
| 244 | Ga0466699_199314 | 3300042597 | Unclassified | 3124 |
| 245 | Ga0466705_407576 | 3300042612 | Bacteria | 5845 |
| 246 | Ga0466712_011481 | 3300042614 | Bacteria | 16833 |
| 247 | Ga0466712_078414 | 3300042614 | Unclassified | 3191 |
| 248 | Ga0466712_087898 | 3300042614 | Unclassified | 2032 |
| 249 | Ga0466712_132951 | 3300042614 | Bacteria | 5362 |
| 250 | Ga0466712_140692 | 3300042614 | Unclassified | 2748 |
| 251 | Ga0466711_325408 | 3300042615 | Bacteria | 8662 |
| 252 | Ga0466723_002213 | 3300042618 | Bacteria | 5507 |
| 253 | Ga0466731_352443 | 3300042622 | Bacteria | 5547 |
| 254 | Ga0466735_010594 | 3300042624 | Bacteria | 17619 |
| 255 | Ga0466702_131138 | 3300042635 | Bacteria | 32512 |
| 256 | Ga0466702_143572 | 3300042635 | Bacteria | 21943 |
| 257 | Ga0466703_168917 | 3300042636 | Bacteria | 27431 |
| 258 | Ga0466703_289170 | 3300042636 | Bacteria | 24893 |
| 259 | Ga0466704_074511 | 3300042643 | Unclassified | 5606 |
| 260 | Ga0466704_606958 | 3300042643 | Bacteria | 82552 |
| 261 | Ga0466708_186420 | 3300042652 | Bacteria | 13891 |
| 262 | Ga0466700_199963 | 3300042600 | Bacteria | 1656 |
| 263 | Ga0466700_328408 | 3300042600 | Bacteria | 1064 |
| 264 | Ga0466707_237874 | 3300042601 | Unclassified | 1196 |
| 265 | Ga0466716_263638 | 3300042605 | Unclassified | 2296 |
| 266 | Ga0466722_001021 | 3300042609 | Bacteria | 11786 |
| 267 | Ga0466722_154651 | 3300042609 | Bacteria | 5939 |
| 268 | Ga0466698_198192 | 3300042610 | Unclassified | 1177 |
| 269 | Ga0123355_10008997 | 3300009826 | Bacteria | 15135 |
| 270 | Ga0123356_11114670 | 3300010049 | Unclassified | 957 |
| 271 | Ga0123356_11369673 | 3300010049 | Unclassified | 869 |
| 272 | Ga0123356_13031547 | 3300010049 | Unclassified | 586 |
| 273 | Ga0123353_10860300 | 3300010167 | Unclassified | 1241 |
| 274 | Ga0466705_105380 | 3300042612 | Bacteria | 5107 |
| 275 | Ga0466705_153188 | 3300042612 | Unclassified | 5452 |
| 276 | Ga0466705_324953 | 3300042612 | Bacteria | 4837 |
| 277 | JGI24698J34947_10311144 | 3300002449 | Bacteria | 564 |
| 278 | JGI24695J34938_10000099 | 3300002450 | Bacteria | 75735 |
| 279 | JGI24702J35022_10018315 | 3300002462 | Bacteria | 3820 |
| 280 | Ga0466690_043149 | 3300042590 | Unclassified | 1465 |
| 281 | Ga0466690_368189 | 3300042590 | Unclassified | 1800 |
| 282 | Ga0466692_180024 | 3300042591 | Bacteria | 3352 |
| 283 | Ga0466691_069971 | 3300042593 | Bacteria | 6837 |
| 284 | Ga0466691_090851 | 3300042593 | Bacteria | 7660 |
| 285 | Ga0466696_340442 | 3300042596 | Bacteria | 7495 |
| 286 | Ga0466699_231126 | 3300042597 | Unclassified | 1639 |
| 287 | Ga0466712_013067 | 3300042614 | Unclassified | 1850 |
| 288 | Ga0466726_037702 | 3300042619 | Bacteria | 1396 |
| 289 | Ga0466728_006919 | 3300042620 | Bacteria | 20488 |
| 290 | Ga0466728_267247 | 3300042620 | Unclassified | 1239 |
| 291 | Ga0466731_179036 | 3300042622 | Bacteria | 1247 |
| 292 | Ga0466735_152241 | 3300042624 | Unclassified | 1041 |
| 293 | Ga0466703_294621 | 3300042636 | Bacteria | 4686 |
| 294 | Ga0466704_051117 | 3300042643 | Bacteria | 19320 |
| 295 | Ga0466704_366669 | 3300042643 | Bacteria | 8554 |
| 296 | Ga0466727_250254 | 3300042655 | Bacteria | 8801 |
| 297 | Ga0466719_286488 | 3300042606 | Bacteria | 5179 |
| 298 | Ga0466719_477128 | 3300042606 | Bacteria | 5887 |
| 299 | Ga0466722_230678 | 3300042609 | Unclassified | 1460 |
| 300 | Ga0123353_11968576 | 3300010167 | Bacteria | 717 |
| 301 | Ga0466705_078763 | 3300042612 | Bacteria | 55629 |
| 302 | AustNasuHG_c1014277 | 3300000089 | Unclassified | 2705 |
| 303 | JGI24698J34947_10007412 | 3300002449 | Bacteria | 6031 |
| 304 | JGI24695J34938_10022878 | 3300002450 | Unclassified | 3024 |
| 305 | Ga0255786_1006505 | 3300022815 | Bacteria | 1534 |
| 306 | Ga0255809_1003564 | 3300022820 | Unclassified | 873 |
| 307 | Ga0466657_111943 | 3300042582 | Unclassified | 2095 |
| 308 | Ga0466690_276501 | 3300042590 | Unclassified | 1063 |
| 309 | Ga0466692_157391 | 3300042591 | Bacteria | 9170 |
| 310 | Ga0466691_054990 | 3300042593 | Bacteria | 8155 |
| 311 | Ga0466705_485258 | 3300042612 | Bacteria | 18362 |
| 312 | Ga0466712_100729 | 3300042614 | Bacteria | 39851 |
| 313 | Ga0466711_031313 | 3300042615 | Bacteria | 12860 |
| 314 | Ga0466711_209444 | 3300042615 | Unclassified | 1755 |
| 315 | Ga0466715_239988 | 3300042616 | Bacteria | 5399 |
| 316 | Ga0466718_072376 | 3300042617 | Bacteria | 10012 |
| 317 | Ga0466702_373858 | 3300042635 | Bacteria | 3853 |
| 318 | Ga0466703_065263 | 3300042636 | Unclassified | 3243 |
| 319 | Ga0466704_002559 | 3300042643 | Bacteria | 6127 |
| 320 | Ga0466704_180057 | 3300042643 | Bacteria | 11893 |
| 321 | Ga0466704_541031 | 3300042643 | Bacteria | 11510 |
| 322 | Ga0466709_373885 | 3300042648 | Unclassified | 3996 |
| 323 | Ga0466708_067629 | 3300042652 | Bacteria | 18635 |
| 324 | Ga0466708_164750 | 3300042652 | Bacteria | 41705 |
| 325 | Ga0466727_075589 | 3300042655 | Bacteria | 1937 |
| 326 | Ga0466706_265070 | 3300042599 | Bacteria | 1630 |
| 327 | Ga0466716_065971 | 3300042605 | Bacteria | 8389 |
| 328 | Ga0466719_231448 | 3300042606 | Bacteria | 1629 |
| 329 | Ga0466722_103923 | 3300042609 | Bacteria | 1027 |
| 330 | Ga0123355_10040034 | 3300009826 | Bacteria | 7629 |
| 331 | Ga0123356_10207671 | 3300010049 | Unclassified | 2004 |
| 332 | Ga0123356_11565957 | 3300010049 | Unclassified | 815 |
| 333 | Ga0123356_13067936 | 3300010049 | Bacteria | 582 |
| 334 | Ga0123353_10481679 | 3300010167 | Bacteria | 1815 |
| 335 | Ga0123353_10628186 | 3300010167 | Bacteria | 1527 |
| 336 | Ga0123353_11106252 | 3300010167 | Bacteria | 1051 |
| 337 | Ga0123353_12453320 | 3300010167 | Unclassified | 622 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.