Protein Family IF11821
Metagenome
Metatranscriptome
Isolate
229
Members
99
Samples
174
Scaffolds
480.61
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125685|2781417103|
- Length
- 497 aa
- Sequence
- MDLCNRKIDEGEFNRSREGVLTQWPTGAQVDMKKAVEFHKKLPKNKLFPLKLEEAKAGHRTLIQPRAGVALVGDHIKLLTYLQNVGEADLLPTTIDSYTRQKRFKEAEDGINESVRSGKSMLNGFPAVNYGVDKCRLIVESLDVPVQIRHGTPDARLLAEISYSGGFTSFEGGGISYNIPYAKSVTLETTIRDWQYVDRLTGLYEERGVRINREPFGPLTGTLVPPCISHSVAIIESLLAAEQGVKSITVGYGQCGNFIQDVAAVCALEKLTEEYLAKYGYDDVVVTTVLHQWMGGFPPDESKAFAVISWGSAVAALAKATKVIVKTPHEAMGVPTMEANAQGLRCTKQAISMLEDQTVMGARFEEEMSIILAETRPIVDKCFELGGGDIATGAVRAFQAGVIDIPFAPSRHNAGVMLPARDNDGAIRILNPGSVPFSRDLLAFHEGKIDERAKQEKRKASFQMVIDDVSAIGHGRLVGRPPEAAVPEKKKGWFGNK
Sample Types
Isolate
24.0%
Metagenome
75.1%
MAG
0.0%
Metatranscriptome
0.9%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
42.9%
Termitidae
23.5%
Kalotermitidae
13.3%
Blattidae
4.1%
Calliphoridae
4.1%
Termopsidae
3.1%
Curculionidae
2.0%
Passalidae
1.0%
Rhopalidae
1.0%
Rhinotermitidae
1.0%
Carabidae
1.0%
Stratiomyidae
1.0%
Cerambycidae
1.0%
Crambidae
1.0%
Taxonomy
Archaea
3
Bacteria
211
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 2 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 3 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 4 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 5 | 2820637417 | Unclassified Firmicutes Emb289P1bin108 | Isolate | Unclassified |
| 6 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 7 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 8 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 9 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 10 | 2820946191 | Unclassified Acidobacteria Nt197P3bin31 | Isolate | Unclassified |
| 11 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 12 | 2963635624 | Unclassified Bacilli bacterium PM5-9 | Isolate | Blattidae |
| 13 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 14 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 15 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 16 | 2820522177 | Unclassified Firmicutes Lab288P1bin22 | Isolate | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 21 | 8030343600 | Proteiniborus sp. MB09-C3 | Isolate | Stratiomyidae |
| 22 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 23 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 24 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 25 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 26 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 27 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 28 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 29 | 2820693137 | Unclassified Firmicutes Co191P1bin70 | Isolate | Unclassified |
| 30 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 31 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 34 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 35 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 36 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 37 | 2820488713 | Unclassified Firmicutes Lab288P1bin69 | Isolate | Unclassified |
| 38 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 39 | 2820696217 | Unclassified Firmicutes Co191P1bin66 | Isolate | Unclassified |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 44 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 45 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 46 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 47 | 2963634138 | Unclassified Bacilli bacterium PM5-3 | Isolate | Blattidae |
| 48 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 49 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 50 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 51 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 52 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 53 | 2820620956 | Unclassified Firmicutes Emb289P1bin128 | Isolate | Unclassified |
| 54 | 2820626145 | Unclassified Firmicutes Emb289P1bin123 | Isolate | Unclassified |
| 55 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 56 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 57 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 58 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 59 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 60 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 61 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 62 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 63 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 64 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 65 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 66 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 67 | 2820676843 | Unclassified Firmicutes Co191P3bin17 | Isolate | Unclassified |
| 68 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 69 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 70 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 71 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 72 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 73 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 74 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 75 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 76 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 77 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 78 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 79 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 80 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 81 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 82 | 2820504582 | Unclassified Firmicutes Lab288P1bin5 | Isolate | Unclassified |
| 83 | 2820587002 | Unclassified Firmicutes Emb289P1bin94 | Isolate | Unclassified |
| 84 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 85 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 86 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 87 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 88 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 89 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 90 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 91 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 92 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 93 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 94 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 95 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 96 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 97 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 98 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 99 | 3300023282 | Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_391740 | 3300042616 | Bacteria | 7851 |
| 2 | Ga0466723_055980 | 3300042618 | Bacteria | 15225 |
| 3 | Ga0466728_008693 | 3300042620 | Bacteria | 5836 |
| 4 | Ga0466728_020168 | 3300042620 | Bacteria | 5831 |
| 5 | Ga0255808_1010710 | 3300023282 | Bacteria | 2186 |
| 6 | Ga0415639_005636 | 3300038395 | Bacteria | 4026 |
| 7 | Ga0466699_020466 | 3300042597 | Unclassified | 4246 |
| 8 | Ga0466713_103029 | 3300042602 | Bacteria | 264074 |
| 9 | Ga0466703_223844 | 3300042636 | Bacteria | 3888 |
| 10 | Ga0466704_126408 | 3300042643 | Bacteria | 28287 |
| 11 | Ga0466704_347426 | 3300042643 | Bacteria | 5554 |
| 12 | Ga0123355_10000128 | 3300009826 | Bacteria | 87781 |
| 13 | Ga0123355_10001005 | 3300009826 | Bacteria | 39113 |
| 14 | Ga0123355_10023288 | 3300009826 | Bacteria | 9946 |
| 15 | Ga0123355_10036535 | 3300009826 | Bacteria | 7987 |
| 16 | Ga0123356_10031861 | 3300010049 | Bacteria | 4933 |
| 17 | Ga0123356_10143675 | 3300010049 | Bacteria | 2357 |
| 18 | Ga0123356_10286435 | 3300010049 | Bacteria | 1745 |
| 19 | Ga0123353_10059859 | 3300010167 | Unclassified | 6108 |
| 20 | Ga0123353_10072779 | 3300010167 | Bacteria | 5523 |
| 21 | Ga0123353_10219446 | 3300010167 | Unclassified | 2975 |
| 22 | Ga0123353_10262697 | 3300010167 | Bacteria | 2665 |
| 23 | Ga0123353_10412011 | 3300010167 | Bacteria | 2006 |
| 24 | Ga0466728_278176 | 3300042620 | Bacteria | 10147 |
| 25 | Ga0415639_010121 | 3300038395 | Bacteria | 32586 |
| 26 | Ga0415639_089127 | 3300038395 | Bacteria | 2583 |
| 27 | Ga0415639_133435 | 3300038395 | Bacteria | 2484 |
| 28 | Ga0466699_398492 | 3300042597 | Bacteria | 2807 |
| 29 | Ga0466716_142376 | 3300042605 | Bacteria | 9954 |
| 30 | DPOL_contig05001 | 2035918003 | Bacteria | 3601 |
| 31 | JGI24695J34938_10001450 | 3300002450 | Bacteria | 20081 |
| 32 | JGI24695J34938_10018044 | 3300002450 | Bacteria | 3540 |
| 33 | Ga0466735_225564 | 3300042624 | Bacteria | 5931 |
| 34 | Ga0466703_197286 | 3300042636 | Bacteria | 21097 |
| 35 | Ga0466725_353000 | 3300042654 | Bacteria | 9872 |
| 36 | Ga0123355_10021468 | 3300009826 | Bacteria | 10334 |
| 37 | Ga0123355_10028289 | 3300009826 | Bacteria | 9063 |
| 38 | Ga0123355_10089636 | 3300009826 | Bacteria | 4881 |
| 39 | Ga0123356_10005226 | 3300010049 | Bacteria | 13258 |
| 40 | Ga0123356_10029844 | 3300010049 | Bacteria | 5104 |
| 41 | Ga0123356_10093039 | 3300010049 | Bacteria | 2877 |
| 42 | Ga0123356_10310277 | 3300010049 | Bacteria | 1686 |
| 43 | Ga0123353_10040321 | 3300010167 | Bacteria | 7366 |
| 44 | Ga0123353_10325238 | 3300010167 | Bacteria | 2331 |
| 45 | Ga0466705_244617 | 3300042612 | Bacteria | 23734 |
| 46 | Ga0466705_253916 | 3300042612 | Bacteria | 32036 |
| 47 | Ga0466723_056343 | 3300042618 | Bacteria | 9755 |
| 48 | Ga0466723_350192 | 3300042618 | Bacteria | 7502 |
| 49 | Ga0466690_077809 | 3300042590 | Bacteria | 5680 |
| 50 | Ga0466699_074862 | 3300042597 | Bacteria | 5689 |
| 51 | Ga0466707_120789 | 3300042601 | Bacteria | 129814 |
| 52 | Ga0466713_142208 | 3300042602 | Bacteria | 57528 |
| 53 | IMNBL1DRAFT_c0010985 | 3300000062 | Bacteria | 4273 |
| 54 | JGI24702J35022_10001954 | 3300002462 | Bacteria | 12709 |
| 55 | Ga0072940_1063558 | 3300005200 | Bacteria | 4620 |
| 56 | Ga0466702_253956 | 3300042635 | Archaea | 1534 |
| 57 | Ga0466703_178681 | 3300042636 | Bacteria | 25243 |
| 58 | Ga0123355_10000321 | 3300009826 | Bacteria | 61754 |
| 59 | Ga0123355_10000967 | 3300009826 | Bacteria | 39727 |
| 60 | Ga0123355_10058278 | 3300009826 | Bacteria | 6247 |
| 61 | Ga0123355_10149329 | 3300009826 | Bacteria | 3555 |
| 62 | Ga0123355_10222535 | 3300009826 | Bacteria | 2711 |
| 63 | Ga0123356_10002100 | 3300010049 | Bacteria | 21494 |
| 64 | Ga0123353_10217269 | 3300010167 | Unclassified | 2993 |
| 65 | Ga0123353_10232746 | 3300010167 | Bacteria | 2871 |
| 66 | Ga0123353_10430844 | 3300010167 | Unclassified | 1950 |
| 67 | Ga0466712_016069 | 3300042614 | Bacteria | 20626 |
| 68 | Ga0466726_420962 | 3300042619 | Bacteria | 8055 |
| 69 | Ga0466695_028549 | 3300042595 | Archaea | 1877 |
| 70 | Ga0466707_104841 | 3300042601 | Bacteria | 69863 |
| 71 | Ga0466713_043119 | 3300042602 | Bacteria | 6814 |
| 72 | Ga0466719_048208 | 3300042606 | Bacteria | 5982 |
| 73 | JGI24695J34938_10000462 | 3300002450 | Bacteria | 39529 |
| 74 | Ga0466731_099552 | 3300042622 | Bacteria | 2866 |
| 75 | Ga0466703_092266 | 3300042636 | Bacteria | 37200 |
| 76 | Ga0466704_052736 | 3300042643 | Bacteria | 18411 |
| 77 | Ga0466708_243123 | 3300042652 | Bacteria | 7120 |
| 78 | Ga0123355_10002244 | 3300009826 | Bacteria | 27276 |
| 79 | Ga0123355_10003033 | 3300009826 | Bacteria | 23931 |
| 80 | Ga0123355_10053293 | 3300009826 | Bacteria | 6558 |
| 81 | Ga0123355_10060716 | 3300009826 | Bacteria | 6104 |
| 82 | Ga0123355_10063635 | 3300009826 | Bacteria | 5947 |
| 83 | Ga0123356_10012604 | 3300010049 | Bacteria | 8197 |
| 84 | Ga0123356_10046479 | 3300010049 | Bacteria | 4039 |
| 85 | Ga0123356_10133884 | 3300010049 | Unclassified | 2433 |
| 86 | Ga0123353_10173826 | 3300010167 | Bacteria | 3417 |
| 87 | Ga0123353_10226246 | 3300010167 | Unclassified | 2920 |
| 88 | Ga0123353_10363206 | 3300010167 | Bacteria | 2175 |
| 89 | Ga0466705_200303 | 3300042612 | Bacteria | 16226 |
| 90 | Ga0466705_335482 | 3300042612 | Bacteria | 3610 |
| 91 | Ga0255808_1004436 | 3300023282 | Bacteria | 5459 |
| 92 | Ga0466719_180187 | 3300042606 | Bacteria | 25290 |
| 93 | JGI24695J34938_10030082 | 3300002450 | Bacteria | 2532 |
| 94 | JGI24702J35022_10000751 | 3300002462 | Bacteria | 20006 |
| 95 | Ga0466709_188442 | 3300042648 | Unclassified | 3704 |
| 96 | Ga0466708_196917 | 3300042652 | Bacteria | 10405 |
| 97 | Ga0123355_10000594 | 3300009826 | Bacteria | 48837 |
| 98 | Ga0123355_10002303 | 3300009826 | Bacteria | 26954 |
| 99 | Ga0123355_10003563 | 3300009826 | Bacteria | 22384 |
| 100 | Ga0123355_10003864 | 3300009826 | Bacteria | 21673 |
| 101 | Ga0123355_10004109 | 3300009826 | Bacteria | 21095 |
| 102 | Ga0123355_10006193 | 3300009826 | Bacteria | 17668 |
| 103 | Ga0123355_10018764 | 3300009826 | Bacteria | 10992 |
| 104 | Ga0123355_10130734 | 3300009826 | Bacteria | 3869 |
| 105 | Ga0123355_10367840 | 3300009826 | Bacteria | 1887 |
| 106 | Ga0123356_10002814 | 3300010049 | Bacteria | 18426 |
| 107 | Ga0123356_10142796 | 3300010049 | Bacteria | 2364 |
| 108 | Ga0123353_10050550 | 3300010167 | Bacteria | 6629 |
| 109 | Ga0466693_434005 | 3300042592 | Bacteria | 4305 |
| 110 | Ga0466696_305521 | 3300042596 | Bacteria | 23613 |
| 111 | Ga0466722_027454 | 3300042609 | Bacteria | 32114 |
| 112 | JGI24700J35501_10926756 | 3300002508 | Bacteria | 6430 |
| 113 | Ga0466703_011664 | 3300042636 | Bacteria | 9112 |
| 114 | Ga0466704_169172 | 3300042643 | Unclassified | 4670 |
| 115 | Ga0123355_10001049 | 3300009826 | Bacteria | 38266 |
| 116 | Ga0123355_10022124 | 3300009826 | Bacteria | 10189 |
| 117 | Ga0123355_10149871 | 3300009826 | Unclassified | 3546 |
| 118 | Ga0123356_10014045 | 3300010049 | Bacteria | 7703 |
| 119 | Ga0123356_10024818 | 3300010049 | Bacteria | 5637 |
| 120 | Ga0123356_10033154 | 3300010049 | Bacteria | 4830 |
| 121 | Ga0123356_10163846 | 3300010049 | Unclassified | 2225 |
| 122 | Ga0123353_10001152 | 3300010167 | Bacteria | 32230 |
| 123 | Ga0123353_10001919 | 3300010167 | Bacteria | 25566 |
| 124 | Ga0123353_10113506 | 3300010167 | Bacteria | 4362 |
| 125 | Ga0123353_10233179 | 3300010167 | Bacteria | 2867 |
| 126 | Ga0123353_10367688 | 3300010167 | Unclassified | 2158 |
| 127 | Ga0123354_10200677 | 3300010882 | Bacteria | 2194 |
| 128 | Ga0123354_10204262 | 3300010882 | Bacteria | 2160 |
| 129 | Ga0466711_089424 | 3300042615 | Bacteria | 8025 |
| 130 | Ga0466715_282623 | 3300042616 | Bacteria | 6393 |
| 131 | Ga0466715_363400 | 3300042616 | Bacteria | 10036 |
| 132 | Ga0466726_438277 | 3300042619 | Bacteria | 1982 |
| 133 | Ga0466656_346656 | 3300042550 | Bacteria | 2517 |
| 134 | Ga0466699_048553 | 3300042597 | Bacteria | 5670 |
| 135 | Ga0466716_395861 | 3300042605 | Bacteria | 23642 |
| 136 | Ga0466722_008569 | 3300042609 | Bacteria | 9082 |
| 137 | Ga0466722_075381 | 3300042609 | Bacteria | 9046 |
| 138 | FGTW_contig15914 | 2065487013 | Bacteria | 7862 |
| 139 | JGI24695J34938_10002862 | 3300002450 | Bacteria | 12572 |
| 140 | Ga0123357_10000232 | 3300009784 | Bacteria | 52582 |
| 141 | Ga0466724_06019 | 3300042649 | Bacteria | 53877 |
| 142 | Ga0466727_342160 | 3300042655 | Bacteria | 4912 |
| 143 | Ga0123355_10001465 | 3300009826 | Bacteria | 32851 |
| 144 | Ga0123355_10056477 | 3300009826 | Bacteria | 6353 |
| 145 | Ga0123355_10299128 | 3300009826 | Bacteria | 2196 |
| 146 | Ga0123356_10003229 | 3300010049 | Bacteria | 17133 |
| 147 | Ga0123356_10390220 | 3300010049 | Bacteria | 1527 |
| 148 | Ga0123353_10195515 | 3300010167 | Bacteria | 3188 |
| 149 | Ga0466723_268262 | 3300042618 | Unclassified | 5133 |
| 150 | Ga0466726_187383 | 3300042619 | Bacteria | 19163 |
| 151 | Ga0466699_176256 | 3300042597 | Bacteria | 1506 |
| 152 | Ga0466717_061340 | 3300042604 | Bacteria | 3467 |
| 153 | Ga0466722_248502 | 3300042609 | Bacteria | 6330 |
| 154 | JGI24695J34938_10014383 | 3300002450 | Bacteria | 4103 |
| 155 | JGI24702J35022_10005391 | 3300002462 | Bacteria | 7484 |
| 156 | Ga0063521_1000048 | 3300003973 | Bacteria | 106555 |
| 157 | Ga0063521_1011667 | 3300003973 | Unclassified | 2116 |
| 158 | Ga0466730_086608 | 3300042625 | Bacteria | 2466 |
| 159 | Ga0466703_080985 | 3300042636 | Bacteria | 3783 |
| 160 | Ga0466703_230159 | 3300042636 | Bacteria | 17794 |
| 161 | Ga0466727_049162 | 3300042655 | Bacteria | 3547 |
| 162 | Ga0123355_10000060 | 3300009826 | Bacteria | 115952 |
| 163 | Ga0123355_10028128 | 3300009826 | Bacteria | 9089 |
| 164 | Ga0123355_10110864 | 3300009826 | Unclassified | 4287 |
| 165 | Ga0123355_10421242 | 3300009826 | Bacteria | 1706 |
| 166 | Ga0123355_10431259 | 3300009826 | Bacteria | 1676 |
| 167 | Ga0123356_10036530 | 3300010049 | Bacteria | 4587 |
| 168 | Ga0123356_10045706 | 3300010049 | Bacteria | 4074 |
| 169 | Ga0123356_10082505 | 3300010049 | Bacteria | 3043 |
| 170 | Ga0123356_10127227 | 3300010049 | Bacteria | 2489 |
| 171 | Ga0123353_10021538 | 3300010167 | Bacteria | 9677 |
| 172 | Ga0123353_10045611 | 3300010167 | Bacteria | 6958 |
| 173 | Ga0123353_10047330 | 3300010167 | Archaea | 6839 |
| 174 | Ga0123353_10211407 | 3300010167 | Bacteria | 3042 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF06368 | Met_asp_mut_E | Methylaspartate mutase E chain (MutE) | 42 | 481 | 1 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.