Protein Family IF11799
Metagenome
Isolate
321
Members
84
Samples
289
Scaffolds
333.47
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125661|2781333094|
- Length
- 392 aa
- Sequence
- VIGNKHQSQNSTTNHHEPSRKATRFRIKSSWFSRGSWSNKKSIILCFLISMLLIIAASSLGSTNISFFNTIQIVLHKIFGLAISQDINPANVSIVWILRLPRVLLAFLVGGSLAMSGAVCQSILRNPLASPYILGVSSGASLGAGIIIITGITLPFLYGFSLPLTGFIFGLLTVFFVASFSSRIDKSMSNNTIILCGMVLSLFLNAILTTLSAVFSDDLRRIALWQMGSFAMRGWTYVGLLLPFLLIGVAGIFLYTKEMDILSFGDEQAKSAGIETGALRKKLLALCAVLTGAAVALSGVIGFVDLIAPHAARRIIGSRHKYLIPMSFFLGGSLMVCTDLIARTVISPSELPVGAITALIGAPFFVWVYFRKRGSHGGTEAQRTRSKRMGNK
Sample Types
Isolate
10.0%
Metagenome
90.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
41.5%
Termitidae
36.6%
Kalotermitidae
12.2%
Rhinotermitidae
4.9%
Termopsidae
3.7%
Hodotermitidae
1.2%
Taxonomy
Archaea
1
Bacteria
298
Eukaryota
0
Viruses
1
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 2 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 3 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 4 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 5 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 6 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 7 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 8 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 9 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 10 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 11 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 12 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 13 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 14 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 15 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 19 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 28 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 32 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 33 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 34 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 35 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 36 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 37 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 38 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 39 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 40 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 41 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 42 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 44 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 45 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 46 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 47 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 48 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 49 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 50 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 51 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 52 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 53 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 54 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 55 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 56 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 57 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 58 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 59 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 60 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 61 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 62 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 63 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 64 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 65 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 66 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 67 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 68 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 69 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 70 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 71 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 72 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 73 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 74 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 75 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 76 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 77 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 78 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 79 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 80 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 81 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 82 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 83 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 84 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_034444 | 3300042656 | Bacteria | 16888 |
| 2 | Ga0466732_325706 | 3300042656 | Bacteria | 7227 |
| 3 | Ga0466732_374085 | 3300042656 | Bacteria | 26427 |
| 4 | Ga0123355_10023705 | 3300009826 | Bacteria | 9857 |
| 5 | Ga0123356_10007725 | 3300010049 | Bacteria | 10710 |
| 6 | Ga0466707_253648 | 3300042601 | Bacteria | 23791 |
| 7 | Ga0466720_080609 | 3300042607 | Bacteria | 4313 |
| 8 | Ga0466720_097658 | 3300042607 | Bacteria | 2330 |
| 9 | Ga0466698_433451 | 3300042610 | Bacteria | 9958 |
| 10 | AustNasuHG_c1001778 | 3300000089 | Bacteria | 7805 |
| 11 | JGI24698J34947_10033577 | 3300002449 | Bacteria | 2691 |
| 12 | JGI24698J34947_10041271 | 3300002449 | Bacteria | 2377 |
| 13 | JGI24695J34938_10000936 | 3300002450 | Bacteria | 26633 |
| 14 | JGI24695J34938_10007921 | 3300002450 | Bacteria | 6142 |
| 15 | JGI24695J34938_10027126 | 3300002450 | Bacteria | 2712 |
| 16 | JGI24695J34938_10027743 | 3300002450 | Bacteria | 2672 |
| 17 | Ga0466712_023799 | 3300042614 | Bacteria | 49566 |
| 18 | Ga0466718_048624 | 3300042617 | Bacteria | 7254 |
| 19 | Ga0466718_062277 | 3300042617 | Bacteria | 6887 |
| 20 | Ga0466718_087862 | 3300042617 | Bacteria | 2702 |
| 21 | Ga0466726_378532 | 3300042619 | Bacteria | 3049 |
| 22 | Ga0466693_122307 | 3300042592 | Bacteria | 22832 |
| 23 | Ga0466691_177002 | 3300042593 | Bacteria | 59641 |
| 24 | Ga0466694_003748 | 3300042594 | Bacteria | 2230 |
| 25 | Ga0466694_010047 | 3300042594 | Bacteria | 5471 |
| 26 | Ga0466694_326218 | 3300042594 | Bacteria | 2225 |
| 27 | Ga0466699_040226 | 3300042597 | Bacteria | 7738 |
| 28 | Ga0466699_259294 | 3300042597 | Bacteria | 2327 |
| 29 | Ga0466735_089353 | 3300042624 | Bacteria | 4403 |
| 30 | Ga0466704_032950 | 3300042643 | Bacteria | 11962 |
| 31 | Ga0466725_311765 | 3300042654 | Bacteria | 1345 |
| 32 | Ga0466727_072998 | 3300042655 | Bacteria | 1593 |
| 33 | Ga0123355_10012289 | 3300009826 | Bacteria | 13262 |
| 34 | Ga0466706_248191 | 3300042599 | Bacteria | 2764 |
| 35 | Ga0466716_451319 | 3300042605 | Bacteria | 2576 |
| 36 | Ga0466719_034413 | 3300042606 | Bacteria | 1436 |
| 37 | Ga0466720_019228 | 3300042607 | Bacteria | 36389 |
| 38 | Ga0466720_051091 | 3300042607 | Bacteria | 2348 |
| 39 | Ga0466720_073328 | 3300042607 | Unclassified | 1836 |
| 40 | Ga0466720_093610 | 3300042607 | Bacteria | 3291 |
| 41 | AustNasuHG_c1000629 | 3300000089 | Bacteria | 12486 |
| 42 | AustNasuHG_c1012747 | 3300000089 | Bacteria | 2898 |
| 43 | JGI24698J34947_10000815 | 3300002449 | Unclassified | 15534 |
| 44 | JGI24698J34947_10010055 | 3300002449 | Bacteria | 5184 |
| 45 | JGI24698J34947_10011000 | 3300002449 | Unclassified | 4965 |
| 46 | JGI24698J34947_10019034 | 3300002449 | Bacteria | 3707 |
| 47 | JGI24698J34947_10051150 | 3300002449 | Unclassified | 2079 |
| 48 | JGI24695J34938_10001148 | 3300002450 | Bacteria | 23641 |
| 49 | JGI24695J34938_10031125 | 3300002450 | Bacteria | 2479 |
| 50 | JGI24695J34938_10032010 | 3300002450 | Bacteria | 2434 |
| 51 | JGI24695J34938_10070747 | 3300002450 | Bacteria | 1459 |
| 52 | JGI24705J35276_12235433 | 3300002504 | Unclassified | 6521 |
| 53 | JGI24697J35500_11259729 | 3300002507 | Bacteria | 2936 |
| 54 | Ga0072940_1004763 | 3300005200 | Archaea | 2939 |
| 55 | Ga0466712_064413 | 3300042614 | Bacteria | 4177 |
| 56 | Ga0466712_074900 | 3300042614 | Bacteria | 1540 |
| 57 | Ga0466712_117232 | 3300042614 | Bacteria | 3481 |
| 58 | Ga0466726_056852 | 3300042619 | Bacteria | 24025 |
| 59 | Ga0415639_025566 | 3300038395 | Bacteria | 6660 |
| 60 | Ga0466692_186537 | 3300042591 | Unclassified | 2130 |
| 61 | Ga0466696_036767 | 3300042596 | Bacteria | 15685 |
| 62 | Ga0466699_038732 | 3300042597 | Bacteria | 6455 |
| 63 | Ga0466699_283888 | 3300042597 | Unclassified | 2818 |
| 64 | Ga0466699_430260 | 3300042597 | Bacteria | 1247 |
| 65 | Ga0466703_051255 | 3300042636 | Bacteria | 36806 |
| 66 | Ga0466704_019733 | 3300042643 | Bacteria | 17046 |
| 67 | Ga0466704_288417 | 3300042643 | Bacteria | 52572 |
| 68 | Ga0466727_326258 | 3300042655 | Bacteria | 1420 |
| 69 | Ga0466705_096296 | 3300042612 | Unclassified | 7476 |
| 70 | Ga0123356_10087052 | 3300010049 | Bacteria | 2967 |
| 71 | Ga0123356_10160706 | 3300010049 | Bacteria | 2243 |
| 72 | Ga0123356_10667752 | 3300010049 | Bacteria | 1207 |
| 73 | Ga0123353_10075561 | 3300010167 | Bacteria | 5413 |
| 74 | Ga0466720_034306 | 3300042607 | Bacteria | 5733 |
| 75 | Ga0466720_091059 | 3300042607 | Bacteria | 5196 |
| 76 | Ga0466720_101410 | 3300042607 | Bacteria | 24290 |
| 77 | Ga0466720_133528 | 3300042607 | Bacteria | 4922 |
| 78 | Ga0466722_176535 | 3300042609 | Bacteria | 18475 |
| 79 | Ga0466722_194154 | 3300042609 | Bacteria | 9508 |
| 80 | Ga0466698_076490 | 3300042610 | Bacteria | 6308 |
| 81 | Ga0466698_197643 | 3300042610 | Bacteria | 1792 |
| 82 | AustNasuHG_c1003403 | 3300000089 | Bacteria | 5746 |
| 83 | JGI24695J34938_10083743 | 3300002450 | Bacteria | 1315 |
| 84 | JGI24702J35022_10008411 | 3300002462 | Bacteria | 5841 |
| 85 | JGI24699J35502_11125207 | 3300002509 | Bacteria | 3762 |
| 86 | Ga0072941_1091288 | 3300005201 | Bacteria | 5958 |
| 87 | Ga0074263_109971 | 3300005485 | Bacteria | 2222 |
| 88 | Ga0466712_028538 | 3300042614 | Bacteria | 6645 |
| 89 | Ga0466712_038353 | 3300042614 | Bacteria | 13126 |
| 90 | Ga0466712_045049 | 3300042614 | Bacteria | 38257 |
| 91 | Ga0466712_117418 | 3300042614 | Bacteria | 15932 |
| 92 | Ga0466712_137295 | 3300042614 | Bacteria | 31963 |
| 93 | Ga0466712_150659 | 3300042614 | Bacteria | 9540 |
| 94 | Ga0466712_171584 | 3300042614 | Bacteria | 15258 |
| 95 | Ga0466712_174633 | 3300042614 | Bacteria | 3179 |
| 96 | Ga0466712_237960 | 3300042614 | Unclassified | 1963 |
| 97 | Ga0466712_314887 | 3300042614 | Bacteria | 10326 |
| 98 | Ga0466715_122284 | 3300042616 | Bacteria | 12370 |
| 99 | Ga0466718_050159 | 3300042617 | Bacteria | 12154 |
| 100 | Ga0466718_072075 | 3300042617 | Bacteria | 21323 |
| 101 | Ga0466718_164918 | 3300042617 | Bacteria | 2309 |
| 102 | Ga0264413_119862 | 3300024493 | Bacteria | 3604 |
| 103 | Ga0466693_051248 | 3300042592 | Bacteria | 30350 |
| 104 | Ga0466694_066805 | 3300042594 | Bacteria | 10123 |
| 105 | Ga0466694_270808 | 3300042594 | Bacteria | 3488 |
| 106 | Ga0466696_333620 | 3300042596 | Bacteria | 2572 |
| 107 | Ga0466699_220899 | 3300042597 | Bacteria | 1642 |
| 108 | Ga0466699_223614 | 3300042597 | Unclassified | 2580 |
| 109 | Ga0466731_172419 | 3300042622 | Bacteria | 2280 |
| 110 | Ga0466727_216586 | 3300042655 | Bacteria | 4346 |
| 111 | Ga0466732_058680 | 3300042656 | Bacteria | 9244 |
| 112 | Ga0123355_10009088 | 3300009826 | Bacteria | 15065 |
| 113 | Ga0123356_10016318 | 3300010049 | Bacteria | 7092 |
| 114 | Ga0123356_10453180 | 3300010049 | Bacteria | 1431 |
| 115 | Ga0466706_013542 | 3300042599 | Bacteria | 2216 |
| 116 | Ga0466713_096294 | 3300042602 | Bacteria | 5599 |
| 117 | Ga0466720_042400 | 3300042607 | Bacteria | 20745 |
| 118 | Ga0466720_061122 | 3300042607 | Bacteria | 8477 |
| 119 | Ga0466720_088656 | 3300042607 | Bacteria | 2742 |
| 120 | Ga0466720_112462 | 3300042607 | Bacteria | 6483 |
| 121 | Ga0466720_129692 | 3300042607 | Bacteria | 9475 |
| 122 | Ga0466720_185104 | 3300042607 | Bacteria | 5646 |
| 123 | Ga0466721_021911 | 3300042608 | Bacteria | 1765 |
| 124 | Ga0466722_000067 | 3300042609 | Bacteria | 2545 |
| 125 | JGI24698J34947_10000496 | 3300002449 | Bacteria | 18520 |
| 126 | JGI24698J34947_10002745 | 3300002449 | Bacteria | 9524 |
| 127 | JGI24698J34947_10003121 | 3300002449 | Bacteria | 8978 |
| 128 | JGI24698J34947_10058974 | 3300002449 | Bacteria | 1899 |
| 129 | JGI24695J34938_10001054 | 3300002450 | Bacteria | 24995 |
| 130 | JGI24695J34938_10002237 | 3300002450 | Bacteria | 15013 |
| 131 | Ga0072940_1009090 | 3300005200 | Bacteria | 11761 |
| 132 | Ga0074263_104986 | 3300005485 | Bacteria | 5096 |
| 133 | Ga0074263_107145 | 3300005485 | Bacteria | 2529 |
| 134 | Ga0074263_113987 | 3300005485 | Bacteria | 2745 |
| 135 | Ga0466712_001891 | 3300042614 | Unclassified | 9670 |
| 136 | Ga0466712_015183 | 3300042614 | Bacteria | 5342 |
| 137 | Ga0466712_022064 | 3300042614 | Bacteria | 3077 |
| 138 | Ga0466712_034257 | 3300042614 | Bacteria | 5007 |
| 139 | Ga0466712_054773 | 3300042614 | Bacteria | 5486 |
| 140 | Ga0466712_151889 | 3300042614 | Bacteria | 3853 |
| 141 | Ga0466718_101744 | 3300042617 | Bacteria | 13490 |
| 142 | Ga0466723_249986 | 3300042618 | Bacteria | 6277 |
| 143 | Ga0466726_185048 | 3300042619 | Bacteria | 2352 |
| 144 | Ga0466692_157835 | 3300042591 | Bacteria | 3818 |
| 145 | Ga0466699_052234 | 3300042597 | Bacteria | 17896 |
| 146 | Ga0466699_386280 | 3300042597 | Bacteria | 2236 |
| 147 | Ga0466704_313411 | 3300042643 | Unclassified | 13413 |
| 148 | Ga0123356_10000809 | 3300010049 | Bacteria | 34751 |
| 149 | Ga0123356_10002746 | 3300010049 | Bacteria | 18715 |
| 150 | Ga0123356_10038375 | 3300010049 | Bacteria | 4463 |
| 151 | Ga0123356_10124936 | 3300010049 | Bacteria | 2510 |
| 152 | Ga0466720_042275 | 3300042607 | Bacteria | 7327 |
| 153 | Ga0466720_064546 | 3300042607 | Bacteria | 4650 |
| 154 | Ga0466720_069914 | 3300042607 | Unclassified | 3263 |
| 155 | Ga0466720_186210 | 3300042607 | Bacteria | 2340 |
| 156 | Ga0466720_197873 | 3300042607 | Bacteria | 9160 |
| 157 | Ga0466722_208141 | 3300042609 | Bacteria | 2065 |
| 158 | JGI24698J34947_10011869 | 3300002449 | Bacteria | 4783 |
| 159 | JGI24698J34947_10019820 | 3300002449 | Bacteria | 3625 |
| 160 | JGI24698J34947_10035042 | 3300002449 | Unclassified | 2622 |
| 161 | JGI24698J34947_10089149 | 3300002449 | Bacteria | 1421 |
| 162 | JGI24695J34938_10001668 | 3300002450 | Bacteria | 18429 |
| 163 | JGI24695J34938_10030049 | 3300002450 | Bacteria | 2534 |
| 164 | JGI24695J34938_10037911 | 3300002450 | Bacteria | 2186 |
| 165 | JGI24702J35022_10000472 | 3300002462 | Bacteria | 24252 |
| 166 | JGI24700J35501_10930790 | 3300002508 | Bacteria | 24125 |
| 167 | JGI24699J35502_11123614 | 3300002509 | Bacteria | 3570 |
| 168 | Ga0074263_101902 | 3300005485 | Bacteria | 1577 |
| 169 | Ga0074263_104093 | 3300005485 | Bacteria | 2015 |
| 170 | Ga0466712_133118 | 3300042614 | Bacteria | 15943 |
| 171 | Ga0466718_001254 | 3300042617 | Bacteria | 1823 |
| 172 | Ga0466718_008358 | 3300042617 | Bacteria | 2847 |
| 173 | Ga0466718_119220 | 3300042617 | Bacteria | 1235 |
| 174 | Ga0264413_106655 | 3300024493 | Unclassified | 4042 |
| 175 | Ga0466699_203766 | 3300042597 | Bacteria | 1985 |
| 176 | Ga0466699_219846 | 3300042597 | Bacteria | 2075 |
| 177 | Ga0466699_260571 | 3300042597 | Bacteria | 6643 |
| 178 | Ga0466699_273534 | 3300042597 | Bacteria | 4562 |
| 179 | Ga0466699_438688 | 3300042597 | Bacteria | 9400 |
| 180 | Ga0466731_043148 | 3300042622 | Bacteria | 5552 |
| 181 | Ga0466702_116319 | 3300042635 | Bacteria | 2491 |
| 182 | Ga0466705_023719 | 3300042612 | Unclassified | 5389 |
| 183 | Ga0466732_123933 | 3300042656 | Unclassified | 1489 |
| 184 | Ga0123356_10000059 | 3300010049 | Bacteria | 117133 |
| 185 | Ga0123356_10002227 | 3300010049 | Bacteria | 20880 |
| 186 | Ga0123356_10020428 | 3300010049 | Bacteria | 6267 |
| 187 | Ga0123353_10075327 | 3300010167 | Bacteria | 5423 |
| 188 | Ga0466720_019256 | 3300042607 | Bacteria | 11597 |
| 189 | AustNasuHG_c1013794 | 3300000089 | Bacteria | 2762 |
| 190 | JGI24698J34947_10007840 | 3300002449 | Bacteria | 5862 |
| 191 | JGI24698J34947_10011196 | 3300002449 | Bacteria | 4924 |
| 192 | JGI24698J34947_10056880 | 3300002449 | Bacteria | 1943 |
| 193 | JGI24695J34938_10000069 | 3300002450 | Bacteria | 86031 |
| 194 | JGI24695J34938_10003182 | 3300002450 | Bacteria | 11655 |
| 195 | JGI24695J34938_10004699 | 3300002450 | Bacteria | 8848 |
| 196 | JGI24695J34938_10005127 | 3300002450 | Bacteria | 8294 |
| 197 | JGI24695J34938_10030954 | 3300002450 | Bacteria | 2488 |
| 198 | JGI24695J34938_10041118 | 3300002450 | Bacteria | 2077 |
| 199 | Ga0072940_1004765 | 3300005200 | Bacteria | 3681 |
| 200 | Ga0072940_1026371 | 3300005200 | Bacteria | 2793 |
| 201 | Ga0466712_017121 | 3300042614 | Bacteria | 19701 |
| 202 | Ga0466712_070772 | 3300042614 | Bacteria | 13209 |
| 203 | Ga0466718_068594 | 3300042617 | Bacteria | 3107 |
| 204 | Ga0466729_145789 | 3300042621 | Bacteria | 1137 |
| 205 | Ga0264413_102977 | 3300024493 | Bacteria | 25558 |
| 206 | Ga0415639_026631 | 3300038395 | Bacteria | 2213 |
| 207 | Ga0415639_065501 | 3300038395 | Bacteria | 1991 |
| 208 | Ga0456237_0001209 | 3300041968 | Bacteria | 4077 |
| 209 | Ga0466694_214886 | 3300042594 | Bacteria | 1967 |
| 210 | Ga0466699_206958 | 3300042597 | Bacteria | 6484 |
| 211 | Ga0466703_146775 | 3300042636 | Bacteria | 2886 |
| 212 | Ga0466705_258299 | 3300042612 | Bacteria | 4466 |
| 213 | Ga0466732_266625 | 3300042656 | Bacteria | 1446 |
| 214 | Ga0123355_10184529 | 3300009826 | Bacteria | 3088 |
| 215 | Ga0123356_10000870 | 3300010049 | Bacteria | 33535 |
| 216 | Ga0123356_10020964 | 3300010049 | Bacteria | 6182 |
| 217 | Ga0123356_10021033 | 3300010049 | Bacteria | 6171 |
| 218 | Ga0466700_477827 | 3300042600 | Bacteria | 1317 |
| 219 | Ga0466713_002052 | 3300042602 | Bacteria | 2551 |
| 220 | Ga0466719_124569 | 3300042606 | Bacteria | 9392 |
| 221 | Ga0466720_068647 | 3300042607 | Bacteria | 29893 |
| 222 | Ga0466720_148375 | 3300042607 | Bacteria | 8231 |
| 223 | JGI24698J34947_10002241 | 3300002449 | Bacteria | 10359 |
| 224 | JGI24698J34947_10015897 | 3300002449 | Bacteria | 4092 |
| 225 | JGI24698J34947_10024882 | 3300002449 | Bacteria | 3191 |
| 226 | JGI24695J34938_10021069 | 3300002450 | Bacteria | 3196 |
| 227 | Ga0072940_1004766 | 3300005200 | Bacteria | 4743 |
| 228 | Ga0074263_111473 | 3300005485 | Bacteria | 2134 |
| 229 | Ga0466712_048853 | 3300042614 | Bacteria | 7900 |
| 230 | Ga0466712_066862 | 3300042614 | Bacteria | 7613 |
| 231 | Ga0466712_199819 | 3300042614 | Bacteria | 2986 |
| 232 | Ga0466711_283491 | 3300042615 | Bacteria | 20486 |
| 233 | Ga0466718_007117 | 3300042617 | Bacteria | 3481 |
| 234 | Ga0466718_033331 | 3300042617 | Unclassified | 6267 |
| 235 | Ga0466726_261677 | 3300042619 | Bacteria | 2518 |
| 236 | Ga0466726_399546 | 3300042619 | Bacteria | 1648 |
| 237 | Ga0264413_102978 | 3300024493 | Bacteria | 8322 |
| 238 | Ga0264413_115334 | 3300024493 | Bacteria | 21247 |
| 239 | Ga0456237_0002054 | 3300041968 | Bacteria | 3249 |
| 240 | Ga0466692_069882 | 3300042591 | Bacteria | 61867 |
| 241 | Ga0466693_042667 | 3300042592 | Bacteria | 5465 |
| 242 | Ga0466694_038838 | 3300042594 | Bacteria | 8987 |
| 243 | Ga0466694_064886 | 3300042594 | Bacteria | 3308 |
| 244 | Ga0466699_060334 | 3300042597 | Bacteria | 14480 |
| 245 | Ga0466699_176442 | 3300042597 | Bacteria | 16824 |
| 246 | Ga0466731_383347 | 3300042622 | Viruses | 2760 |
| 247 | Ga0466735_031215 | 3300042624 | Bacteria | 16362 |
| 248 | Ga0466704_257226 | 3300042643 | Unclassified | 1612 |
| 249 | Ga0123355_10326743 | 3300009826 | Bacteria | 2060 |
| 250 | Ga0123356_10000619 | 3300010049 | Bacteria | 39296 |
| 251 | Ga0123356_10005337 | 3300010049 | Bacteria | 13107 |
| 252 | Ga0123356_10060098 | 3300010049 | Bacteria | 3546 |
| 253 | Ga0123353_10068904 | 3300010167 | Bacteria | 5682 |
| 254 | Ga0123353_10105836 | 3300010167 | Bacteria | 4534 |
| 255 | Ga0123353_10204968 | 3300010167 | Bacteria | 3099 |
| 256 | Ga0466717_040174 | 3300042604 | Bacteria | 3209 |
| 257 | Ga0466720_035278 | 3300042607 | Bacteria | 7668 |
| 258 | Ga0466720_182539 | 3300042607 | Bacteria | 3427 |
| 259 | Ga0466720_226909 | 3300042607 | Bacteria | 7856 |
| 260 | Ga0466721_353714 | 3300042608 | Bacteria | 27763 |
| 261 | Ga0466722_175630 | 3300042609 | Bacteria | 2523 |
| 262 | 2230930064 | 2228664001 | Bacteria | 3658 |
| 263 | JGI24698J34947_10004061 | 3300002449 | Bacteria | 7953 |
| 264 | JGI24698J34947_10009962 | 3300002449 | Bacteria | 5207 |
| 265 | JGI24698J34947_10010080 | 3300002449 | Unclassified | 5178 |
| 266 | JGI24698J34947_10011862 | 3300002449 | Bacteria | 4785 |
| 267 | JGI24698J34947_10014051 | 3300002449 | Bacteria | 4362 |
| 268 | JGI24698J34947_10016898 | 3300002449 | Bacteria | 3959 |
| 269 | JGI24698J34947_10023192 | 3300002449 | Bacteria | 3321 |
| 270 | JGI24698J34947_10024319 | 3300002449 | Bacteria | 3235 |
| 271 | JGI24695J34938_10000054 | 3300002450 | Bacteria | 90526 |
| 272 | JGI24695J34938_10042535 | 3300002450 | Bacteria | 2032 |
| 273 | JGI24695J34938_10044690 | 3300002450 | Bacteria | 1969 |
| 274 | JGI24696J40584_12958794 | 3300002834 | Bacteria | 4409 |
| 275 | Ga0466712_028926 | 3300042614 | Bacteria | 19762 |
| 276 | Ga0466712_137279 | 3300042614 | Unclassified | 1338 |
| 277 | Ga0466712_165394 | 3300042614 | Bacteria | 17360 |
| 278 | Ga0466712_186556 | 3300042614 | Bacteria | 4559 |
| 279 | Ga0466718_091594 | 3300042617 | Bacteria | 9856 |
| 280 | Ga0466718_100809 | 3300042617 | Bacteria | 13973 |
| 281 | Ga0466694_173930 | 3300042594 | Bacteria | 2217 |
| 282 | Ga0466694_242316 | 3300042594 | Bacteria | 8194 |
| 283 | Ga0466696_232286 | 3300042596 | Bacteria | 18470 |
| 284 | Ga0466696_315100 | 3300042596 | Bacteria | 9690 |
| 285 | Ga0466699_019749 | 3300042597 | Bacteria | 1138 |
| 286 | Ga0466699_139751 | 3300042597 | Bacteria | 3086 |
| 287 | Ga0466699_168846 | 3300042597 | Bacteria | 8383 |
| 288 | Ga0466729_257838 | 3300042621 | Bacteria | 1713 |
| 289 | Ga0466725_101891 | 3300042654 | Bacteria | 1218 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01032 | FecCD | FecCD transport family | 51 | 371 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.