Protein Family IF11061
Metagenome
Isolate
161
Members
70
Samples
133
Scaffolds
340.91
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2593339125|2595066000|
- Length
- 382 aa
- Sequence
- MQRMNLKGYFRSCNRYITKSLKKILLIIRYTYTKLPNNDGGTKMKKIKTTEAVGNVICHDITQIIKGEKKDVAFKKGHIVTEEDIPVLLSIGKDNLYVWEKKEGMLHENEAAEILCKICKSDYMSATKVKEGKIELIAAEDGLFKIDIEKLRKINSLGEMMIATRHSNFPVKKGDKLAGTRIIPLVIEQKKMDEAVKLAGDKPLMEILPFIHKKAGIVTTGNEVFYGRIKDTFGPVIREKLAEYNVEVLGQKILSDDPKLITEAIKDFIKEGAELIICTGGMSVDPDDTTPTAIQNTGAKIVSYGAPVLPGAMFLLAYYNDTLPVIGLPGCVMYAKRTIFDLVLPRVMVDDKITLEDISNLGHGGLCLSCDICTFPNCGFGK
Sample Types
Isolate
17.4%
Metagenome
82.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
31.9%
Unclassified
31.9%
Kalotermitidae
17.4%
Blattidae
4.3%
Rhinotermitidae
4.3%
Passalidae
2.9%
Termopsidae
2.9%
Hodotermitidae
1.4%
Scarabaeidae
1.4%
Tenebrionidae
1.4%
Taxonomy
Archaea
0
Bacteria
158
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940241992 | Fusobacterium sp. PH5-29 | Isolate | Blattidae |
| 2 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 3 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 6 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 7 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 2940373808 | Fusobacterium sp. PH5-7 | Isolate | Blattidae |
| 13 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 14 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 20 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 21 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 22 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 23 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 24 | 2820730639 | Unclassified Chloroflexi Th196P4bin31 | Isolate | Unclassified |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 2940349480 | Fusobacterium sp. PH5-44 | Isolate | Blattidae |
| 33 | 2820364642 | Unclassified Firmicutes Nt197P3bin107 | Isolate | Unclassified |
| 34 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 35 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 38 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 39 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 40 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 41 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 44 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 45 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 46 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 47 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 48 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 49 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 50 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 51 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 52 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 53 | 2820327087 | Unclassified Firmicutes Nt197P3bin79 | Isolate | Unclassified |
| 54 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 55 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 56 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 57 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 58 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 59 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 60 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 61 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 62 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 63 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 64 | 2593339125 | Clostridium sp. 5 | Isolate | Termitidae |
| 65 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 66 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 67 | 2820731983 | Unclassified Chloroflexi Nt197P3bin126 | Isolate | Unclassified |
| 68 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 69 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 70 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0456237_0003852 | 3300041968 | Bacteria | 2422 |
| 2 | Ga0466692_143489 | 3300042591 | Bacteria | 4679 |
| 3 | Ga0466693_417692 | 3300042592 | Bacteria | 20246 |
| 4 | Ga0466691_116012 | 3300042593 | Bacteria | 7367 |
| 5 | Ga0466724_63674 | 3300042649 | Bacteria | 1897 |
| 6 | Ga0466705_479965 | 3300042612 | Bacteria | 20919 |
| 7 | Ga0466707_014389 | 3300042601 | Bacteria | 75654 |
| 8 | Ga0466719_571022 | 3300042606 | Bacteria | 1298 |
| 9 | Ga0466720_063332 | 3300042607 | Bacteria | 12713 |
| 10 | Ga0123357_10395014 | 3300009784 | Bacteria | 1266 |
| 11 | Ga0123353_10099602 | 3300010167 | Bacteria | 4684 |
| 12 | Ga0466732_243562 | 3300042656 | Bacteria | 11049 |
| 13 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 14 | Ga0264413_101022 | 3300024493 | Bacteria | 3553 |
| 15 | Ga0415639_235125 | 3300038395 | Bacteria | 3362 |
| 16 | Ga0466699_182827 | 3300042597 | Bacteria | 45951 |
| 17 | Ga0466723_144132 | 3300042618 | Bacteria | 7381 |
| 18 | Ga0466726_044528 | 3300042619 | Bacteria | 29828 |
| 19 | Ga0466706_176499 | 3300042599 | Bacteria | 6126 |
| 20 | Ga0466720_044705 | 3300042607 | Bacteria | 17060 |
| 21 | Ga0466720_152531 | 3300042607 | Bacteria | 7566 |
| 22 | Ga0123356_10059104 | 3300010049 | Bacteria | 3576 |
| 23 | Ga0123356_10107854 | 3300010049 | Bacteria | 2684 |
| 24 | Ga0123356_10167077 | 3300010049 | Bacteria | 2206 |
| 25 | Ga0068305_10428648 | 3300005083 | Bacteria | 7880 |
| 26 | Ga0466733_210407 | 3300042659 | Bacteria | 8951 |
| 27 | Ga0264413_105753 | 3300024493 | Bacteria | 1916 |
| 28 | Ga0466690_187650 | 3300042590 | Bacteria | 9765 |
| 29 | Ga0466694_205617 | 3300042594 | Bacteria | 3280 |
| 30 | Ga0466696_300951 | 3300042596 | Bacteria | 5540 |
| 31 | Ga0466709_152210 | 3300042648 | Bacteria | 18824 |
| 32 | Ga0466718_164300 | 3300042617 | Bacteria | 2908 |
| 33 | Ga0466720_032145 | 3300042607 | Bacteria | 21125 |
| 34 | Ga0123356_10003854 | 3300010049 | Bacteria | 15620 |
| 35 | Ga0123356_10057271 | 3300010049 | Bacteria | 3632 |
| 36 | Ga0123356_10084392 | 3300010049 | Unclassified | 3010 |
| 37 | Ga0123353_10010938 | 3300010167 | Bacteria | 12723 |
| 38 | Ga0123353_10081325 | 3300010167 | Bacteria | 5209 |
| 39 | Ga0123353_10129493 | 3300010167 | Bacteria | 4052 |
| 40 | Ga0123353_10142258 | 3300010167 | Bacteria | 3841 |
| 41 | Ga0123353_10204525 | 3300010167 | Bacteria | 3103 |
| 42 | 2227499634 | 2225789004 | Unclassified | 19437 |
| 43 | IMNBL1DRAFT_c0023793 | 3300000062 | Bacteria | 2392 |
| 44 | JGI24702J35022_10000288 | 3300002462 | Bacteria | 29450 |
| 45 | Ga0466690_071752 | 3300042590 | Bacteria | 48946 |
| 46 | Ga0466735_062986 | 3300042624 | Bacteria | 1630 |
| 47 | Ga0466713_037915 | 3300042602 | Bacteria | 12221 |
| 48 | Ga0466713_137341 | 3300042602 | Bacteria | 1448 |
| 49 | Ga0466719_533500 | 3300042606 | Bacteria | 2678 |
| 50 | Ga0466720_223616 | 3300042607 | Bacteria | 2980 |
| 51 | Ga0466722_001589 | 3300042609 | Bacteria | 7489 |
| 52 | Ga0466722_211220 | 3300042609 | Bacteria | 6534 |
| 53 | Ga0123356_10000140 | 3300010049 | Bacteria | 81836 |
| 54 | Ga0562377_0538 | 3300056842 | Bacteria | 59511 |
| 55 | Ga0264413_100391 | 3300024493 | Bacteria | 6645 |
| 56 | Ga0264413_101172 | 3300024493 | Bacteria | 3614 |
| 57 | Ga0466699_015261 | 3300042597 | Bacteria | 2563 |
| 58 | Ga0466699_274103 | 3300042597 | Bacteria | 22431 |
| 59 | Ga0466715_046838 | 3300042616 | Bacteria | 8323 |
| 60 | Ga0466715_209291 | 3300042616 | Bacteria | 20063 |
| 61 | Ga0466718_014723 | 3300042617 | Bacteria | 10181 |
| 62 | Ga0466723_055810 | 3300042618 | Bacteria | 20174 |
| 63 | Ga0466707_076357 | 3300042601 | Bacteria | 224161 |
| 64 | Ga0466720_010845 | 3300042607 | Bacteria | 17725 |
| 65 | Ga0466720_046061 | 3300042607 | Bacteria | 9587 |
| 66 | Ga0466720_116740 | 3300042607 | Bacteria | 72912 |
| 67 | Ga0123356_10259262 | 3300010049 | Bacteria | 1821 |
| 68 | Ga0123356_10688736 | 3300010049 | Bacteria | 1191 |
| 69 | IMNBL1DRAFT_c0001830 | 3300000062 | Bacteria | 15499 |
| 70 | AustNasuHG_c1000808 | 3300000089 | Bacteria | 11230 |
| 71 | JGI24705J35276_12238080 | 3300002504 | Bacteria | 15669 |
| 72 | Ga0072940_1035784 | 3300005200 | Bacteria | 5817 |
| 73 | Ga0466733_122844 | 3300042659 | Bacteria | 20067 |
| 74 | Ga0264413_112649 | 3300024493 | Bacteria | 3686 |
| 75 | Ga0466692_133006 | 3300042591 | Bacteria | 12247 |
| 76 | Ga0466699_051861 | 3300042597 | Bacteria | 28735 |
| 77 | Ga0466703_026451 | 3300042636 | Bacteria | 14174 |
| 78 | Ga0466715_481771 | 3300042616 | Bacteria | 30259 |
| 79 | Ga0466718_061107 | 3300042617 | Bacteria | 3255 |
| 80 | Ga0466728_274274 | 3300042620 | Bacteria | 22423 |
| 81 | Ga0466706_221283 | 3300042599 | Bacteria | 43471 |
| 82 | Ga0466717_042591 | 3300042604 | Bacteria | 2282 |
| 83 | Ga0466716_073641 | 3300042605 | Bacteria | 7197 |
| 84 | Ga0466719_033626 | 3300042606 | Bacteria | 45932 |
| 85 | Ga0466720_101077 | 3300042607 | Bacteria | 10045 |
| 86 | Ga0123355_10325567 | 3300009826 | Bacteria | 2065 |
| 87 | Ga0123356_10176074 | 3300010049 | Bacteria | 2156 |
| 88 | Ga0123356_10538295 | 3300010049 | Bacteria | 1328 |
| 89 | Ga0123356_10741285 | 3300010049 | Bacteria | 1152 |
| 90 | Ga0123353_10000319 | 3300010167 | Bacteria | 59439 |
| 91 | Ga0123353_10056291 | 3300010167 | Bacteria | 6293 |
| 92 | Ga0123353_10241625 | 3300010167 | Bacteria | 2805 |
| 93 | Ga0123353_10620793 | 3300010167 | Bacteria | 1539 |
| 94 | IMNBL1DRAFT_c0001432 | 3300000062 | Bacteria | 17846 |
| 95 | IMNBL1DRAFT_c0004395 | 3300000062 | Bacteria | 8498 |
| 96 | JGI24702J35022_10017748 | 3300002462 | Bacteria | 3885 |
| 97 | Ga0466705_219837 | 3300042612 | Bacteria | 6870 |
| 98 | Ga0466732_117934 | 3300042656 | Bacteria | 5090 |
| 99 | Ga0264413_101021 | 3300024493 | Bacteria | 7582 |
| 100 | Ga0466704_308552 | 3300042643 | Bacteria | 41896 |
| 101 | Ga0466718_068121 | 3300042617 | Bacteria | 3967 |
| 102 | Ga0466707_193454 | 3300042601 | Bacteria | 2720 |
| 103 | Ga0466707_324286 | 3300042601 | Bacteria | 1717 |
| 104 | Ga0466720_029698 | 3300042607 | Bacteria | 1419 |
| 105 | Ga0466720_238607 | 3300042607 | Bacteria | 1381 |
| 106 | Ga0123355_10052033 | 3300009826 | Unclassified | 6646 |
| 107 | Ga0123356_10000918 | 3300010049 | Bacteria | 32588 |
| 108 | Ga0123356_10076506 | 3300010049 | Bacteria | 3154 |
| 109 | Ga0123356_10207428 | 3300010049 | Bacteria | 2005 |
| 110 | Ga0123353_10007556 | 3300010167 | Bacteria | 14723 |
| 111 | JGI24702J35022_10015404 | 3300002462 | Bacteria | 4209 |
| 112 | Ga0264413_101023 | 3300024493 | Bacteria | 4567 |
| 113 | Ga0264413_101171 | 3300024493 | Bacteria | 7160 |
| 114 | Ga0466692_126673 | 3300042591 | Bacteria | 21184 |
| 115 | Ga0466692_202211 | 3300042591 | Bacteria | 4585 |
| 116 | Ga0466696_434331 | 3300042596 | Bacteria | 1892 |
| 117 | Ga0466699_188412 | 3300042597 | Bacteria | 1227 |
| 118 | Ga0466709_209552 | 3300042648 | Bacteria | 15383 |
| 119 | Ga0466725_407550 | 3300042654 | Bacteria | 2544 |
| 120 | Ga0466714_083417 | 3300042603 | Bacteria | 15765 |
| 121 | Ga0466717_305009 | 3300042604 | Bacteria | 7110 |
| 122 | Ga0466720_018749 | 3300042607 | Bacteria | 13625 |
| 123 | Ga0466720_051991 | 3300042607 | Bacteria | 3599 |
| 124 | Ga0466720_153303 | 3300042607 | Bacteria | 2794 |
| 125 | Ga0123355_10203748 | 3300009826 | Bacteria | 2884 |
| 126 | Ga0123356_10015556 | 3300010049 | Bacteria | 7286 |
| 127 | Ga0123356_10113538 | 3300010049 | Bacteria | 2621 |
| 128 | Ga0123353_10099667 | 3300010167 | Bacteria | 4682 |
| 129 | Ga0123353_10160418 | 3300010167 | Bacteria | 3581 |
| 130 | Ga0123353_10174531 | 3300010167 | Bacteria | 3409 |
| 131 | Ga0123353_10399040 | 3300010167 | Bacteria | 2048 |
| 132 | IMNBL1DRAFT_c0000349 | 3300000062 | Bacteria | 39000 |
| 133 | Ga0072940_1523198 | 3300005200 | Bacteria | 1547 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00994 | MoCF_biosynth | Probable molybdopterin binding domain | 216 | 347 | 0.84 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.