Protein Family IF10594
Metagenome
Isolate
234
Members
191
Samples
114
Scaffolds
360.78
Avg Length
Representative Sequence
- ID
- 3300056856|Ga0562375_0164|Ga0562375_0164_169271_170437
- Length
- 388 aa
- Sequence
- MTGSPMTESAAAPASRAADRTYRIAVIAGDGIGTEVMPEGLRSLRAAADRFGFRLEIEEFDWASAGYWQAHGAMLPDDWKDTLSGFDAIFFGAVGWPDVVPDHVSLWGSLLQFRRHFDQYVNLRPVKLLAGVPSPLAGRRPGDVDFFVVRENTEGEYSSVGGKMFEGTDRETVIQETVMTRTGVDRVLRYAFELADRRGGGPGSTGRPQRRHLTSATKSNGIAITMPYWDERVAAMAESYPEVEVDQFHIDILTANFVMHPDWFDVVVASNLFGDILSDLGPACTGTIGIAPSANINPEGAFPSLFEPVHGSAPDIAGRGIANPVGQIWSGALMLDHLGEAEAAAAVQAAFEAVLAGGDAEVLTPDMGGRGTTAALGAAVAEAIAGGR
Sample Types
Isolate
51.3%
Metagenome
48.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
27.5%
Formicidae
14.8%
Unclassified
9.3%
Drosophilidae
7.7%
Termitidae
7.1%
Culicidae
5.5%
Armadillidiidae
4.9%
Kalotermitidae
4.4%
Curculionidae
3.3%
Tenebrionidae
3.3%
Calliphoridae
2.7%
Elmidae
2.2%
Rhinotermitidae
1.1%
Crambidae
1.1%
Cerambycidae
1.1%
Scarabaeidae
0.5%
Trigoniulidae
0.5%
Thripidae
0.5%
Pteromalidae
0.5%
Alydidae
0.5%
Apidae
0.5%
Berytidae
0.5%
Taxonomy
Archaea
0
Bacteria
209
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2856966858 | Pseudonocardia sp. Ae263_Ps1 | Isolate | Formicidae |
| 2 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 3 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 4 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 5 | 2675903497 | Pseudonocardia sp. EC080610-09 | Isolate | Formicidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 13 | 649989992 | Pseudonocardia sp. P1 | Isolate | Formicidae |
| 14 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 15 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 16 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 17 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 18 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 19 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 20 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 21 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 22 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 23 | 2873468275 | Agrobacterium vitis S00131 | Isolate | Elmidae |
| 24 | 2671180625 | Pseudonocardia sp. EC080619-01 | Isolate | Formicidae |
| 25 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 26 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 28 | 3300012818 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG | Metagenome | |
| 29 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 30 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 31 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 32 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 33 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 34 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 35 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 36 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 37 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 38 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 39 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 40 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 41 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 42 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 43 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 44 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 45 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 46 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 47 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 48 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 49 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 50 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 51 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 52 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 53 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 54 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 55 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 56 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 57 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 58 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 59 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 60 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 61 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 62 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 63 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 64 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 65 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 66 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 67 | 2856671350 | Pseudonocardia sp. Ae356_Ps1 | Isolate | Formicidae |
| 68 | 2856947901 | Pseudonocardia sp. Ae168_Ps1 | Isolate | Formicidae |
| 69 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 70 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 71 | 2724678956 | Methylobacterium sp. GXS13 | Isolate | Unclassified |
| 72 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 73 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 74 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 75 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 76 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 77 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 78 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 79 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 80 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 81 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 82 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 83 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 84 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 85 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 86 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 87 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 88 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 89 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 90 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 91 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 92 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 93 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 94 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 95 | 8116947750 | Gluconacetobacter sacchari DSM 12717 | Isolate | Unclassified |
| 96 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 97 | 2864993140 | Agrobacterium vitis S00303 | Isolate | Elmidae |
| 98 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 99 | 2816332114 | Microbacterium saperdae DSM 20169 | Isolate | Unclassified |
| 100 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 101 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 102 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 103 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 104 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 105 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 106 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 107 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 108 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 109 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 110 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 111 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 112 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 113 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 114 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 115 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 116 | 2859977607 | Pseudonocardia sp. Ae707_Ps1 | Isolate | Formicidae |
| 117 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 118 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 119 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 120 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 121 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 122 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 123 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 124 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 125 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 126 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 127 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 128 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 129 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 130 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 131 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 132 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 133 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 134 | 8067598439 | Gluconobacter wancherniae Dm-17 | Isolate | Drosophilidae |
| 135 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 136 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 137 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 138 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 139 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 140 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 141 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 142 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 143 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 144 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 145 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 146 | 2518645556 | Nocardiopsis alba ATCC BAA-2165 | Isolate | Apidae |
| 147 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 148 | 2597490292 | Acetobacter malorum DmCS_005 | Isolate | Drosophilidae |
| 149 | 2718217924 | Pseudonocardia sp. HH130630-07 | Isolate | Formicidae |
| 150 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 151 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 152 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 153 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 154 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 155 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 156 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 157 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 158 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 159 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 160 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 161 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 162 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 163 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 164 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 165 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 166 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 167 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 168 | 2834038347 | Gluconobacter sp. DsW_058 | Isolate | Drosophilidae |
| 169 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 170 | 2858084324 | Acetobacter sp. DsW_54 | Isolate | Drosophilidae |
| 171 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 172 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 173 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 174 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 175 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 176 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 177 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 178 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 179 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 180 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 181 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 182 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 183 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 184 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 185 | 8067604290 | Gluconobacter wancherniae Dm-19 | Isolate | Drosophilidae |
| 186 | 8067607133 | Gluconobacter wancherniae Dm-15 | Isolate | Drosophilidae |
| 187 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 188 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 189 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 190 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 191 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160432_100091 | 3300012818 | Bacteria | 90719 |
| 2 | Ga0160459_100099 | 3300012831 | Bacteria | 86490 |
| 3 | Ga0160444_102035 | 3300012841 | Bacteria | 3244 |
| 4 | Ga0160443_101404 | 3300012848 | Bacteria | 8236 |
| 5 | Ga0466701_015224 | 3300042598 | Bacteria | 55559 |
| 6 | Ga0123355_10358985 | 3300009826 | Unclassified | 1921 |
| 7 | Ga0160466_103238 | 3300012809 | Unclassified | 2763 |
| 8 | Ga0466722_088417 | 3300042609 | Bacteria | 3254 |
| 9 | Ga0466709_177544 | 3300042648 | Bacteria | 6412 |
| 10 | DPOL_contig15831 | 2035918003 | Unclassified | 4223 |
| 11 | CVPL005W_1001408 | 3300002934 | Bacteria | 6396 |
| 12 | CVPL005L_10001488 | 3300002938 | Bacteria | 27016 |
| 13 | Ga0102737_1010955 | 3300007142 | Bacteria | 1515 |
| 14 | Ga0160469_100065 | 3300012824 | Bacteria | 179297 |
| 15 | Ga0160472_100163 | 3300012839 | Bacteria | 91922 |
| 16 | Ga0160433_100349 | 3300012846 | Bacteria | 27261 |
| 17 | Ga0160447_101292 | 3300012849 | Unclassified | 9875 |
| 18 | Ga0466724_12222 | 3300042649 | Bacteria | 23620 |
| 19 | DPOL_contig04748 | 2035918003 | Bacteria | 3938 |
| 20 | CVPL010W_10000563 | 3300002931 | Bacteria | 46161 |
| 21 | CVPL010W_10015848 | 3300002931 | Unclassified | 5198 |
| 22 | CVPL005W_1000001 | 3300002934 | Bacteria | 147007 |
| 23 | Ga0103260_1001768 | 3300007139 | Unclassified | 3800 |
| 24 | Ga0562376_0562 | 3300056857 | Bacteria | 65365 |
| 25 | Ga0160459_100379 | 3300012831 | Unclassified | 19017 |
| 26 | Ga0160455_100019 | 3300012837 | Bacteria | 453457 |
| 27 | Ga0160472_100141 | 3300012839 | Bacteria | 108090 |
| 28 | Ga0160472_103617 | 3300012839 | Bacteria | 2986 |
| 29 | Ga0466711_074124 | 3300042615 | Bacteria | 12614 |
| 30 | Ga0466729_156504 | 3300042621 | Bacteria | 6004 |
| 31 | Ga0160454_100411 | 3300012798 | Bacteria | 20837 |
| 32 | Ga0466730_072298 | 3300042625 | Bacteria | 12550 |
| 33 | Ga0466724_38821 | 3300042649 | Unclassified | 2256 |
| 34 | DPOL_contig00844 | 2035918003 | Bacteria | 20285 |
| 35 | Ga0103266_1000075 | 3300007067 | Bacteria | 36270 |
| 36 | Ga0103266_1001062 | 3300007067 | Bacteria | 5337 |
| 37 | Ga0102737_1012291 | 3300007142 | Bacteria | 1403 |
| 38 | Ga0562375_0611 | 3300056856 | Bacteria | 67999 |
| 39 | Ga0562376_2631 | 3300056857 | Bacteria | 20795 |
| 40 | Ga0160469_100086 | 3300012824 | Bacteria | 152231 |
| 41 | Ga0160458_100627 | 3300012832 | Bacteria | 12431 |
| 42 | Ga0160452_100026 | 3300012834 | Bacteria | 235637 |
| 43 | Ga0160455_100066 | 3300012837 | Bacteria | 189860 |
| 44 | Ga0160443_108446 | 3300012848 | Bacteria | 1235 |
| 45 | Ga0160436_1004870 | 3300012861 | Bacteria | 3171 |
| 46 | Ga0466701_005914 | 3300042598 | Bacteria | 55661 |
| 47 | Ga0466717_199318 | 3300042604 | Bacteria | 1291 |
| 48 | Ga0466730_040865 | 3300042625 | Bacteria | 27737 |
| 49 | Ga0466724_52085 | 3300042649 | Bacteria | 154897 |
| 50 | JGI24705J35276_12237133 | 3300002504 | Bacteria | 9932 |
| 51 | CVPL010W_10016857 | 3300002931 | Bacteria | 5964 |
| 52 | Ga0102739_1006991 | 3300007095 | Bacteria | 2831 |
| 53 | Ga0562375_0164 | 3300056856 | Bacteria | 195314 |
| 54 | Ga0562376_0456 | 3300056857 | Bacteria | 75575 |
| 55 | Ga0160470_100644 | 3300012813 | Unclassified | 11777 |
| 56 | Ga0160443_100528 | 3300012848 | Unclassified | 24722 |
| 57 | Ga0160448_100031 | 3300012854 | Bacteria | 141009 |
| 58 | Ga0466657_037189 | 3300042582 | Bacteria | 3436 |
| 59 | Ga0466696_440195 | 3300042596 | Bacteria | 2017 |
| 60 | Ga0466705_476479 | 3300042612 | Bacteria | 3288 |
| 61 | Ga0466718_114185 | 3300042617 | Bacteria | 1790 |
| 62 | Ga0123356_10021731 | 3300010049 | Bacteria | 6057 |
| 63 | Ga0160471_100620 | 3300012812 | Bacteria | 9106 |
| 64 | Ga0466716_041914 | 3300042605 | Bacteria | 1944 |
| 65 | Ga0466734_016069 | 3300042623 | Bacteria | 26526 |
| 66 | Ga0466734_061715 | 3300042623 | Bacteria | 5422 |
| 67 | CVPL010W_10006857 | 3300002931 | Bacteria | 11473 |
| 68 | Ga0102740_1000665 | 3300007140 | Bacteria | 9309 |
| 69 | Ga0103267_1023746 | 3300007190 | Bacteria | 2032 |
| 70 | Ga0562379_0119 | 3300056790 | Bacteria | 250541 |
| 71 | Ga0562378_0066 | 3300056814 | Unclassified | 303224 |
| 72 | Ga0160440_100101 | 3300012815 | Bacteria | 94359 |
| 73 | Ga0160468_100594 | 3300012819 | Bacteria | 13518 |
| 74 | Ga0160472_100105 | 3300012839 | Bacteria | 135252 |
| 75 | Ga0160445_100101 | 3300012847 | Unclassified | 85437 |
| 76 | Ga0160445_100218 | 3300012847 | Unclassified | 42339 |
| 77 | Ga0160448_100796 | 3300012854 | Bacteria | 10629 |
| 78 | Ga0466723_207182 | 3300042618 | Bacteria | 14429 |
| 79 | Ga0160465_100490 | 3300012803 | Bacteria | 19013 |
| 80 | Ga0466722_172087 | 3300042609 | Bacteria | 19231 |
| 81 | Ga0466724_65308 | 3300042649 | Bacteria | 117345 |
| 82 | FGTW_contig00404 | 2065487013 | Unclassified | 7075 |
| 83 | Ga0063521_1000089 | 3300003973 | Bacteria | 74123 |
| 84 | Ga0102736_1000349 | 3300007052 | Bacteria | 9784 |
| 85 | Ga0103264_1000490 | 3300007188 | Bacteria | 39758 |
| 86 | Ga0160446_100868 | 3300012835 | Unclassified | 8421 |
| 87 | Ga0160472_101103 | 3300012839 | Unclassified | 9131 |
| 88 | Ga0160444_100098 | 3300012841 | Unclassified | 110248 |
| 89 | Ga0160430_101806 | 3300012852 | Bacteria | 7468 |
| 90 | Ga0466690_120650 | 3300042590 | Unclassified | 1499 |
| 91 | Ga0466729_106852 | 3300042621 | Bacteria | 7536 |
| 92 | Ga0123357_10138879 | 3300009784 | Bacteria | 2995 |
| 93 | Ga0160465_101566 | 3300012803 | Unclassified | 6390 |
| 94 | Ga0466701_045275 | 3300042598 | Bacteria | 4351 |
| 95 | Ga0466701_094372 | 3300042598 | Bacteria | 2534 |
| 96 | Ga0466721_255138 | 3300042608 | Bacteria | 1537 |
| 97 | Ga0466724_11717 | 3300042649 | Bacteria | 15309 |
| 98 | Ga0466725_468907 | 3300042654 | Bacteria | 2994 |
| 99 | CVPL010W_10010628 | 3300002931 | Unclassified | 7930 |
| 100 | CVPL010L_1000040 | 3300002932 | Bacteria | 43162 |
| 101 | Ga0103261_1006445 | 3300007083 | Bacteria | 1703 |
| 102 | Ga0102739_1002069 | 3300007095 | Bacteria | 3167 |
| 103 | Ga0104049_1025182 | 3300007103 | Unclassified | 1467 |
| 104 | Ga0530661_000871 | 3300056564 | Bacteria | 18773 |
| 105 | Ga0562374_0855 | 3300057007 | Unclassified | 42781 |
| 106 | Ga0160456_100139 | 3300012820 | Unclassified | 67071 |
| 107 | Ga0160467_100950 | 3300012829 | Unclassified | 16581 |
| 108 | Ga0160446_100043 | 3300012835 | Bacteria | 135017 |
| 109 | Ga0466696_216263 | 3300042596 | Bacteria | 5070 |
| 110 | Ga0123356_10215190 | 3300010049 | Bacteria | 1974 |
| 111 | Ga0466734_069082 | 3300042623 | Bacteria | 4864 |
| 112 | Ga0466734_095707 | 3300042623 | Bacteria | 1439 |
| 113 | Ga0466704_439988 | 3300042643 | Unclassified | 2818 |
| 114 | Ga0466724_19399 | 3300042649 | Bacteria | 81793 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00180 | Iso_dh | Isocitrate/isopropylmalate dehydrogenase | 24 | 378 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.