Protein Family IF10545

Metagenome Isolate
183 Members
116 Samples
127 Scaffolds
340.11 Avg Length

🧬 Representative Sequence

ID
3300056842|Ga0562377_0063|Ga0562377_0063_162046_163233
Length
395 aa
Sequence
MSIFQLSLSILFSLLLFIKVFLLILYLNLQKDVIIYEKSLTMISVICYNILKIRSDRMTIDWANLGFDYIKTPFRYLSIWKDGQWDQGKLTEDNTLHINEGSAALHYGQQCFEGLKAYRCKDGSINLFRVDQNAKRMNRSAKQLLMPEVPEEKFIQAVEEVVRANSEFVPPYGSGATLYIRPLLIGIGEGIGVQPAPEYLFTVFCMPVGAYFKGGLTPTNFVVSEYDRAAPQGTGAIKVGGNYAASLYPGKLAKERHFSDCIYLDPATHTKIEEVGSANFFGITKDNRFVTPLSPSILPSITKYSLLYLAEHHLGMEAVEEDVYLDSLDKFTEAGACGTAAVISPIGGIQVGDDFHVFYSETEVGPVTQKLYDTLTKIQLGDIEAPAGWIRNIKN

📊 Sample Types

Isolate 30.6%
Metagenome 69.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 27.5%
Unclassified 17.6%
Kalotermitidae 10.8%
Tenebrionidae 7.8%
Drosophilidae 5.9%
Scarabaeidae 4.9%
Elmidae 2.9%
Rhinotermitidae 2.9%
Curculionidae 2.9%
Termopsidae 2.9%
Blattidae 2.0%
Apidae 2.0%
Vespidae 1.0%
Sarcophagidae 1.0%
Bombycidae 1.0%
Hodotermitidae 1.0%
Stratiomyidae 1.0%
Gomphidae 1.0%
Hydrophilidae 1.0%
Cerambycidae 1.0%
Libellulidae 1.0%
Formicidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 173
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2864853652 Pseudomonas rhodesiae S00114 Isolate Elmidae
2 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
3 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
4 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
5 2517487021 Wohlfahrtiimonas chitiniclastica DSM 18708 Isolate Sarcophagidae
6 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
7 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
10 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
11 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
12 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
13 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
14 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
15 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
16 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
17 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
18 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
23 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
24 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
25 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 2032320009 Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine Metagenome Curculionidae
29 2791354930 Wohlfahrtiimonas larvae kbl006 Isolate Stratiomyidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
32 8007223943 Enterococcus sp. MSG2901 Isolate
33 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
34 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
35 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
36 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
37 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
38 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
39 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
40 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
41 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
42 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
43 2651870343 Fructobacillus sp. EFB-N1 Isolate Apidae
44 8114555646 Enterococcus sp. DIV1094 Isolate
45 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
46 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
47 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
48 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
49 2593339124 Clostridium sp. 4 Isolate Termitidae
50 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
51 2740892547 Fibrobacteria bacterium GUT77 MC_77 Isolate Unclassified
52 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
53 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
54 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
55 8108568626 Enterococcus sp. DIV1094 Isolate
56 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
57 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
58 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
59 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
60 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
61 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
62 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
63 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
64 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
65 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
66 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
67 2590828840 Clostridium sp. 2 Isolate Termitidae
68 2634166424 Clostridium sp. L74 Isolate Scarabaeidae
69 2756170272 Convivina intestini DSM 28795 Isolate Unclassified
70 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
71 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
72 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
73 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
74 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
75 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
76 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
77 8007237282 Enterococcus sp. DIV0212c Isolate
78 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
79 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
80 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
81 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
82 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
83 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
84 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
85 2864745180 Pseudomonas rhodesiae S00002 Isolate Elmidae
86 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
87 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
88 2044078006 Dendroctonus frontalis bacterial communities from Mississippi, USA Metagenome Curculionidae
89 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
90 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
91 2820411483 Unclassified Firmicutes Lab288P4bin76 Isolate Unclassified
92 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
93 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
94 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
95 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
96 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
97 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
98 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
99 2834540479 Leuconostoc citreum DmW_111 Isolate Drosophilidae
100 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
101 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
102 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
103 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
104 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
105 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
106 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
107 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
108 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
109 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
110 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
111 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
112 2864926767 Pseudomonas nitritireducens S00179 Isolate Elmidae
113 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
114 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
115 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
116 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_168128 3300042611 Bacteria 8488
2 Ga0466733_105728 3300042659 Bacteria 55485
3 Ga0562379_1431 3300056790 Bacteria 27299
4 Ga0562378_0004 3300056814 Bacteria 2423881
5 Ga0123353_10604262 3300010167 Bacteria 1567
6 AglaG_contig17681 2084038013 Bacteria 12660
7 JGI24698J34947_10063810 3300002449 Bacteria 1804
8 JGI24695J34938_10015462 3300002450 Bacteria 3917
9 Ga0072941_1027298 3300005201 Bacteria 45039
10 Ga0072941_1217220 3300005201 Bacteria 2067
11 Ga0466702_144352 3300042635 Bacteria 3965
12 Ga0466702_152782 3300042635 Bacteria 1434
13 Ga0466724_20253 3300042649 Bacteria 42482
14 Ga0466700_346138 3300042600 Bacteria 85747
15 Ga0466707_330441 3300042601 Bacteria 6048
16 Ga0466713_140716 3300042602 Bacteria 27446
17 Ga0562379_0014 3300056790 Bacteria 1325122
18 Ga0562375_0201 3300056856 Bacteria 169177
19 Ga0562375_1619 3300056856 Unclassified 29325
20 Ga0466712_115267 3300042614 Bacteria 1636
21 Ga0466715_091994 3300042616 Bacteria 112451
22 Ga0466718_092441 3300042617 Bacteria 32224
23 Ga0123357_10335615 3300009784 Bacteria 1470
24 Ga0123356_10005132 3300010049 Bacteria 13414
25 SPBB_contig10488 2044078006 Bacteria 139292
26 JGI24700J35501_10930903 3300002508 Bacteria 38981
27 Ga0068302_10009967 3300005071 Unclassified 8369
28 Ga0466702_084727 3300042635 Bacteria 31799
29 Ga0466702_191984 3300042635 Bacteria 1730
30 Ga0466703_221241 3300042636 Bacteria 10286
31 Ga0466701_059773 3300042598 Bacteria 11360
32 Ga0466719_400369 3300042606 Bacteria 5602
33 Ga0466720_035894 3300042607 Bacteria 4232
34 Ga0562374_0659 3300057007 Bacteria 52209
35 Ga0562374_0931 3300057007 Bacteria 40155
36 Ga0466692_179022 3300042591 Bacteria 7995
37 Ga0466705_502533 3300042612 Bacteria 8242
38 Ga0466710_226644 3300042613 Bacteria 1574
39 Ga0466715_258463 3300042616 Bacteria 28150
40 Ga0123357_10254659 3300009784 Unclassified 1870
41 Ga0072941_1002486 3300005201 Bacteria 46319
42 Ga0072941_1086793 3300005201 Bacteria 6529
43 Ga0123357_10001038 3300009784 Bacteria 28515
44 Ga0466703_168718 3300042636 Bacteria 3445
45 Ga0466704_320623 3300042643 Bacteria 11414
46 Ga0466727_228045 3300042655 Bacteria 5387
47 Ga0466701_079511 3300042598 Bacteria 6378
48 Ga0466706_028935 3300042599 Bacteria 40791
49 Ga0466732_392954 3300042656 Bacteria 18734
50 Ga0562379_5374 3300056790 Unclassified 4348
51 Ga0562375_0013 3300056856 Bacteria 1229523
52 Ga0562374_0008 3300057007 Bacteria 1999653
53 Ga0466657_277839 3300042582 Bacteria 5111
54 Ga0466690_059913 3300042590 Bacteria 43148
55 Ga0466715_206410 3300042616 Bacteria 29967
56 Ga0466723_136025 3300042618 Bacteria 5131
57 Ga0123354_10145699 3300010882 Bacteria 2900
58 Ga0123354_10170795 3300010882 Bacteria 2532
59 AustNasuHG_c1003562 3300000089 Bacteria 5626
60 JGI24702J35022_10123144 3300002462 Bacteria 1434
61 JGI24700J35501_10860748 3300002508 Bacteria 2099
62 Ga0072941_1017195 3300005201 Unclassified 7106
63 Ga0466701_026062 3300042598 Bacteria 3161
64 Ga0466722_182659 3300042609 Bacteria 26051
65 Ga0466722_242098 3300042609 Bacteria 2409
66 Ga0530661_003342 3300056564 Bacteria 5299
67 Ga0562379_0051 3300056790 Bacteria 505432
68 Ga0562374_2397 3300057007 Bacteria 16551
69 Ga0466691_037573 3300042593 Bacteria 71526
70 Ga0466691_214266 3300042593 Bacteria 3621
71 Ga0123357_10104810 3300009784 Bacteria 3629
72 Ga0123356_10663510 3300010049 Bacteria 1210
73 Ga0123354_10172394 3300010882 Bacteria 2511
74 Ga0072941_1156619 3300005201 Bacteria 3069
75 Ga0074263_101426 3300005485 Bacteria 5070
76 Ga0466724_30737 3300042649 Bacteria 3730
77 Ga0466701_045352 3300042598 Bacteria 6411
78 Ga0466706_025624 3300042599 Bacteria 47672
79 Ga0466720_061685 3300042607 Bacteria 25501
80 Ga0466705_286694 3300042612 Bacteria 89956
81 Ga0562377_0063 3300056842 Bacteria 461046
82 Ga0562377_0373 3300056842 Unclassified 83266
83 Ga0562375_0301 3300056856 Bacteria 123351
84 Ga0562375_1311 3300056856 Unclassified 34879
85 Ga0562374_0006 3300057007 Bacteria 2178283
86 Ga0264413_114889 3300024493 Bacteria 19681
87 Ga0466711_182931 3300042615 Bacteria 5894
88 Ga0466726_030368 3300042619 Bacteria 4685
89 Ga0123355_10222578 3300009826 Bacteria 2711
90 Ga0123356_10216277 3300010049 Bacteria 1969
91 JGI24698J34947_10030178 3300002449 Bacteria 2861
92 Ga0068302_10015776 3300005071 Bacteria 1705
93 Ga0104050_1000274 3300007153 Bacteria 1952
94 Ga0466703_018268 3300042636 Bacteria 2276
95 Ga0466704_028038 3300042643 Bacteria 8092
96 Ga0466700_478677 3300042600 Bacteria 44650
97 Ga0466732_290410 3300042656 Bacteria 4801
98 Ga0562378_0003 3300056814 Bacteria 2474150
99 Ga0562378_0668 3300056814 Bacteria 51149
100 Ga0562376_2172 3300056857 Bacteria 24553
101 Ga0264413_127036 3300024493 Unclassified 10580
102 Ga0466705_461507 3300042612 Bacteria 4974
103 Ga0466718_047926 3300042617 Bacteria 5313
104 Ga0466726_344696 3300042619 Bacteria 87368
105 Ga0123356_10061062 3300010049 Bacteria 3519
106 Nasutiter_Contig02421 2030936001 Bacteria 4179
107 HBC_ctgsDRAFT_1000070 3300000333 Bacteria 26032
108 JGI24695J34938_10013556 3300002450 Bacteria 4274
109 Ga0072940_1092147 3300005200 Bacteria 3413
110 Ga0072940_1234061 3300005200 Bacteria 2840
111 Ga0105553_1036539 3300007767 Bacteria 7245
112 Ga0466709_084188 3300042648 Bacteria 5019
113 Ga0466708_021463 3300042652 Bacteria 4913
114 Ga0562374_0145 3300057007 Bacteria 168686
115 Ga0466691_090807 3300042593 Bacteria 6537
116 Ga0466699_014657 3300042597 Bacteria 5098
117 Ga0466701_004898 3300042598 Bacteria 2228
118 Ga0466715_489311 3300042616 Bacteria 15153
119 Ga0123357_10208851 3300009784 Bacteria 2200
120 Ga0123354_10240901 3300010882 Unclassified 1861
121 DPO_contig06910 2032320009 Bacteria 17392
122 DPO_contig06911 2032320009 Unclassified 13465
123 Ga0466724_08980 3300042649 Bacteria 3298
124 Ga0466706_233747 3300042599 Bacteria 2960
125 Ga0466713_060305 3300042602 Bacteria 8341
126 Ga0466713_129121 3300042602 Bacteria 7495
127 Ga0466722_252821 3300042609 Bacteria 235840

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01063 Aminotran_4 Amino-transferase class IV 110 347 0.95

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01063 GO:0003824 catalytic activity MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.