Protein Family IF10356
Metagenome
Metatranscriptome
Isolate
331
Members
191
Samples
219
Scaffolds
60.82
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_189636|Ga0466733_189636_242_457
- Length
- 71 aa
- Sequence
- LKKLPDKGQAMSSNQQVKVKLVKSLIGVRELHRATVRGLGLGRLNSVSTLEDTPAVRGMINKVSYLVKVVS
Sample Types
Isolate
33.8%
Metagenome
65.9%
MAG
0.0%
Metatranscriptome
0.3%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
42.6%
Termitidae
15.4%
Unclassified
14.4%
Kalotermitidae
7.4%
Formicidae
4.8%
Culicidae
2.1%
Termopsidae
2.1%
Armadillidiidae
1.6%
Rhinotermitidae
1.6%
Drosophilidae
1.1%
Berytidae
1.1%
Alydidae
1.1%
Largidae
1.1%
Elmidae
1.1%
Passalidae
1.1%
Tenebrionidae
0.5%
Cryptocercidae
0.5%
Hodotermitidae
0.5%
Taxonomy
Archaea
0
Bacteria
313
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 2 | 2820042117 | Unclassified Proteobacteria Th196P4bin58 | Isolate | Unclassified |
| 3 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 4 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 5 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 6 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300005313 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 2 gut | Metagenome | Drosophilidae |
| 9 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 10 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 11 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 14 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 15 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 16 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 17 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 18 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 19 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 20 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 21 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 22 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 23 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 24 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 25 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 26 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 27 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 31 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 34 | 2820121232 | Unclassified Proteobacteria Emb289P4bin32 | Isolate | Unclassified |
| 35 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 36 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 37 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 38 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 39 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 40 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 41 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 42 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 43 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 44 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 45 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 46 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 47 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 48 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 49 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 50 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 51 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 52 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 53 | 3300061800 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D7_PP_a (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 54 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 55 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 56 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 57 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 58 | 2681813507 | Insolitispirillum peregrinum integrum DSM 11589 | Isolate | Unclassified |
| 59 | 2687453742 | Burkholderiales bacterium B_Cag20 | Isolate | Unclassified |
| 60 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 61 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 62 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 63 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 64 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 65 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 66 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 67 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 68 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 69 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 70 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 71 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 72 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 73 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 74 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 75 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 76 | 2889908211 | Bowmanella denitrificans JL63 | Isolate | Unclassified |
| 77 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 78 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 79 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 80 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 81 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 82 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 83 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 84 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 85 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 86 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 87 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 88 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 89 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 90 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 91 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 92 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 93 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 94 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 95 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 96 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 97 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 98 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 99 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 100 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 101 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 102 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 103 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 104 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 105 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 106 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 107 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 108 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 109 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 110 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 111 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 112 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 113 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 114 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 115 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 116 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 117 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 118 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 119 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 120 | 2687453753 | Burkholderiales bacterium B_Cag25 | Isolate | Unclassified |
| 121 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 122 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 123 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 124 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 125 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 126 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 127 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 128 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 129 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 130 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 131 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 132 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 133 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 134 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 135 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 136 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 137 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 138 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 139 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 140 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 141 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 142 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 143 | 2820131053 | Unclassified Proteobacteria Emb289P3bin8 | Isolate | Unclassified |
| 144 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 145 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 146 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 147 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 148 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 149 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 150 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 151 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 152 | 3300010053 | Insect gut microbial communities from Cryptocercus cockroaches from Viginia, USA | Metagenome | Cryptocercidae |
| 153 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 154 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 155 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 156 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 157 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 158 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 159 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 160 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 161 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 162 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 163 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 164 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 165 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 166 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 167 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 168 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 169 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 170 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 171 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 172 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 173 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 174 | 2518285616 | Brachymonas chironomi DSM 19884 | Isolate | Unclassified |
| 175 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 176 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 177 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 178 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 179 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 180 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 181 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 182 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 183 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 184 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 185 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 186 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 187 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 188 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 189 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 190 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 191 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_454651 | 3300042656 | Unclassified | 1132 |
| 2 | Ga0466705_401962 | 3300042612 | Bacteria | 1079 |
| 3 | Ga0466710_038761 | 3300042613 | Bacteria | 64329 |
| 4 | Ga0466729_084932 | 3300042621 | Bacteria | 104590 |
| 5 | Ga0466657_051167 | 3300042582 | Bacteria | 10371 |
| 6 | Ga0466657_402911 | 3300042582 | Bacteria | 3506 |
| 7 | Ga0466690_149138 | 3300042590 | Bacteria | 14715 |
| 8 | Ga0466690_289774 | 3300042590 | Bacteria | 3568 |
| 9 | Ga0466690_321140 | 3300042590 | Bacteria | 25918 |
| 10 | Ga0466701_001027 | 3300042598 | Bacteria | 90142 |
| 11 | Ga0134290_1172992 | 3300010053 | Bacteria | 577 |
| 12 | Ga0123354_10026109 | 3300010882 | Bacteria | 9212 |
| 13 | Ga0466707_106169 | 3300042601 | Bacteria | 14657 |
| 14 | Ga0466707_175120 | 3300042601 | Bacteria | 20435 |
| 15 | Ga0466719_486350 | 3300042606 | Bacteria | 13185 |
| 16 | Ga0466722_202204 | 3300042609 | Bacteria | 5956 |
| 17 | JGI24705J35276_12209643 | 3300002504 | Bacteria | 1803 |
| 18 | Ga0072941_1644046 | 3300005201 | Bacteria | 618 |
| 19 | Ga0466729_244888 | 3300042621 | Bacteria | 1913 |
| 20 | Ga0466734_016107 | 3300042623 | Bacteria | 1849 |
| 21 | Ga0466734_029869 | 3300042623 | Bacteria | 3214 |
| 22 | Ga0466735_141442 | 3300042624 | Bacteria | 1508 |
| 23 | Ga0466703_067078 | 3300042636 | Bacteria | 1133 |
| 24 | Ga0466704_405583 | 3300042643 | Bacteria | 15459 |
| 25 | Ga0466725_164280 | 3300042654 | Bacteria | 17642 |
| 26 | Ga0466725_185939 | 3300042654 | Bacteria | 36509 |
| 27 | Ga0466697_204900 | 3300042611 | Bacteria | 4171 |
| 28 | Ga0466733_059229 | 3300042659 | Bacteria | 36946 |
| 29 | Ga0466710_030998 | 3300042613 | Unclassified | 4849 |
| 30 | Ga0466710_282543 | 3300042613 | Bacteria | 1618 |
| 31 | Ga0466711_381700 | 3300042615 | Bacteria | 1828 |
| 32 | Ga0466711_474329 | 3300042615 | Bacteria | 1182 |
| 33 | Ga0466715_030743 | 3300042616 | Bacteria | 4935 |
| 34 | Ga0466726_067584 | 3300042619 | Bacteria | 4925 |
| 35 | Ga0160433_111222 | 3300012846 | Bacteria | 1145 |
| 36 | Ga0466657_083553 | 3300042582 | Unclassified | 16962 |
| 37 | Ga0466657_299036 | 3300042582 | Bacteria | 3586 |
| 38 | Ga0466692_193948 | 3300042591 | Bacteria | 9758 |
| 39 | Ga0466693_027963 | 3300042592 | Bacteria | 4027 |
| 40 | Ga0123356_10005609 | 3300010049 | Bacteria | 12758 |
| 41 | Ga0123356_10381255 | 3300010049 | Bacteria | 1543 |
| 42 | Ga0123356_13363190 | 3300010049 | Bacteria | 556 |
| 43 | Ga0123353_10056133 | 3300010167 | Unclassified | 6303 |
| 44 | Ga0123353_10192231 | 3300010167 | Bacteria | 3220 |
| 45 | Ga0466701_048756 | 3300042598 | Bacteria | 9025 |
| 46 | Ga0466706_059483 | 3300042599 | Bacteria | 1066 |
| 47 | Ga0466707_276765 | 3300042601 | Unclassified | 1406 |
| 48 | Ga0466719_409832 | 3300042606 | Bacteria | 1115 |
| 49 | JGI24705J35276_12221473 | 3300002504 | Unclassified | 2343 |
| 50 | CVPL005W_1001807 | 3300002934 | Unclassified | 6782 |
| 51 | Ga0068302_10028121 | 3300005071 | Bacteria | 4662 |
| 52 | Ga0072941_1077030 | 3300005201 | Bacteria | 8650 |
| 53 | Ga0074307_1108859 | 3300005313 | Bacteria | 1749 |
| 54 | Ga0102737_1026659 | 3300007142 | Bacteria | 904 |
| 55 | Ga0103264_1000587 | 3300007188 | Bacteria | 23529 |
| 56 | Ga0105005_1021830 | 3300007505 | Bacteria | 8863 |
| 57 | Ga0123357_10000005 | 3300009784 | Bacteria | 295874 |
| 58 | Ga0123357_10001915 | 3300009784 | Bacteria | 22651 |
| 59 | Ga0466734_083453 | 3300042623 | Bacteria | 6358 |
| 60 | Ga0466702_420939 | 3300042635 | Bacteria | 6684 |
| 61 | Ga0466704_551504 | 3300042643 | Bacteria | 2314 |
| 62 | Ga0466727_137609 | 3300042655 | Bacteria | 15927 |
| 63 | Ga0466697_186137 | 3300042611 | Bacteria | 3247 |
| 64 | Ga0466726_188842 | 3300042619 | Bacteria | 15083 |
| 65 | Ga0466729_129497 | 3300042621 | Bacteria | 7258 |
| 66 | Ga0160430_107683 | 3300012852 | Bacteria | 2129 |
| 67 | Ga0466657_090878 | 3300042582 | Unclassified | 3808 |
| 68 | Ga0466657_236485 | 3300042582 | Bacteria | 1326 |
| 69 | Ga0466690_406175 | 3300042590 | Bacteria | 69346 |
| 70 | Ga0466691_084715 | 3300042593 | Bacteria | 1674 |
| 71 | Ga0123354_11008159 | 3300010882 | Unclassified | 535 |
| 72 | Ga0466701_095383 | 3300042598 | Bacteria | 5672 |
| 73 | Ga0466707_214418 | 3300042601 | Bacteria | 1384 |
| 74 | Ga0466719_055618 | 3300042606 | Bacteria | 10384 |
| 75 | Ga0466722_136888 | 3300042609 | Bacteria | 17058 |
| 76 | IMNBGM34_c002094 | 3300000036 | Bacteria | 3021 |
| 77 | JGI24702J35022_10008095 | 3300002462 | Bacteria | 5983 |
| 78 | CVPL005L_10015189 | 3300002938 | Bacteria | 5016 |
| 79 | Ga0102738_1021479 | 3300007141 | Unclassified | 929 |
| 80 | Ga0103264_1000443 | 3300007188 | Bacteria | 21903 |
| 81 | Ga0103264_1005669 | 3300007188 | Bacteria | 9039 |
| 82 | Ga0466729_247611 | 3300042621 | Bacteria | 2252 |
| 83 | Ga0466734_029421 | 3300042623 | Bacteria | 26553 |
| 84 | Ga0466704_473875 | 3300042643 | Bacteria | 7315 |
| 85 | Ga0466709_407126 | 3300042648 | Bacteria | 3997 |
| 86 | Ga0466708_215602 | 3300042652 | Bacteria | 15739 |
| 87 | Ga0466725_017039 | 3300042654 | Bacteria | 50096 |
| 88 | Ga0466727_335351 | 3300042655 | Bacteria | 67580 |
| 89 | Ga0466697_178025 | 3300042611 | Bacteria | 8041 |
| 90 | Ga0466733_189636 | 3300042659 | Bacteria | 2140 |
| 91 | Ga0466710_075507 | 3300042613 | Bacteria | 36861 |
| 92 | Ga0466710_388689 | 3300042613 | Bacteria | 1005 |
| 93 | Ga0466715_193807 | 3300042616 | Bacteria | 17352 |
| 94 | Ga0466723_124011 | 3300042618 | Bacteria | 17539 |
| 95 | Ga0160457_1025150 | 3300012858 | Bacteria | 828 |
| 96 | Ga0466657_087579 | 3300042582 | Bacteria | 8880 |
| 97 | Ga0466692_184437 | 3300042591 | Bacteria | 20938 |
| 98 | Ga0466696_186808 | 3300042596 | Bacteria | 2536 |
| 99 | Ga0123356_10073807 | 3300010049 | Unclassified | 3209 |
| 100 | Ga0466706_231592 | 3300042599 | Bacteria | 4461 |
| 101 | Ga0466700_386178 | 3300042600 | Bacteria | 3495 |
| 102 | Ga0466717_122732 | 3300042604 | Bacteria | 7513 |
| 103 | Ga0466719_047699 | 3300042606 | Bacteria | 11168 |
| 104 | Ga0466719_079825 | 3300042606 | Bacteria | 11953 |
| 105 | Ga0466722_141657 | 3300042609 | Bacteria | 8529 |
| 106 | JGI24702J35022_10009928 | 3300002462 | Bacteria | 5335 |
| 107 | Ga0072941_1289878 | 3300005201 | Bacteria | 6081 |
| 108 | Ga0102737_1005115 | 3300007142 | Unclassified | 2662 |
| 109 | Ga0103264_1000188 | 3300007188 | Bacteria | 52510 |
| 110 | Ga0466731_066537 | 3300042622 | Bacteria | 2550 |
| 111 | Ga0466735_172843 | 3300042624 | Bacteria | 3929 |
| 112 | Ga0466703_229272 | 3300042636 | Bacteria | 5877 |
| 113 | Ga0466704_390892 | 3300042643 | Bacteria | 18750 |
| 114 | Ga0466724_64730 | 3300042649 | Bacteria | 3725 |
| 115 | Ga0466708_088956 | 3300042652 | Bacteria | 13799 |
| 116 | Ga0466708_308504 | 3300042652 | Bacteria | 17035 |
| 117 | Ga0466708_431611 | 3300042652 | Bacteria | 17147 |
| 118 | Ga0466725_399048 | 3300042654 | Bacteria | 14201 |
| 119 | Ga0466697_076409 | 3300042611 | Bacteria | 6519 |
| 120 | Ga0590779_12354 | 3300061800 | Bacteria | 705 |
| 121 | Ga0466710_258693 | 3300042613 | Bacteria | 1227 |
| 122 | Ga0466712_182347 | 3300042614 | Bacteria | 11394 |
| 123 | Ga0466711_109307 | 3300042615 | Bacteria | 29995 |
| 124 | Ga0466715_140159 | 3300042616 | Bacteria | 9478 |
| 125 | Ga0466715_269641 | 3300042616 | Bacteria | 3729 |
| 126 | Ga0160446_106583 | 3300012835 | Unclassified | 1600 |
| 127 | Ga0160472_119760 | 3300012839 | Unclassified | 666 |
| 128 | Ga0160434_112693 | 3300012850 | Bacteria | 1354 |
| 129 | Ga0466656_249702 | 3300042550 | Bacteria | 1152 |
| 130 | Ga0466691_156291 | 3300042593 | Bacteria | 26465 |
| 131 | Ga0466694_381652 | 3300042594 | Bacteria | 4072 |
| 132 | Ga0123354_10002575 | 3300010882 | Bacteria | 24153 |
| 133 | Ga0160471_107937 | 3300012812 | Bacteria | 1261 |
| 134 | Ga0466706_060588 | 3300042599 | Bacteria | 2623 |
| 135 | Ga0466717_117985 | 3300042604 | Bacteria | 1323 |
| 136 | Ga0466716_002165 | 3300042605 | Bacteria | 1984 |
| 137 | Ga0466716_288795 | 3300042605 | Bacteria | 12220 |
| 138 | Ga0466719_142224 | 3300042606 | Bacteria | 4621 |
| 139 | Ga0466722_196355 | 3300042609 | Bacteria | 12120 |
| 140 | Ga0466697_039039 | 3300042611 | Bacteria | 2307 |
| 141 | JGI24702J35022_10163079 | 3300002462 | Bacteria | 1256 |
| 142 | CVPL010W_10006354 | 3300002931 | Bacteria | 21839 |
| 143 | Ga0102736_1000801 | 3300007052 | Bacteria | 5907 |
| 144 | Ga0102734_1142459 | 3300007129 | Bacteria | 533 |
| 145 | Ga0103264_1000021 | 3300007188 | Bacteria | 137150 |
| 146 | Ga0103268_1005123 | 3300007192 | Bacteria | 2657 |
| 147 | Ga0123357_10000387 | 3300009784 | Bacteria | 41806 |
| 148 | Ga0466730_008348 | 3300042625 | Bacteria | 12805 |
| 149 | Ga0466709_083350 | 3300042648 | Bacteria | 4650 |
| 150 | Ga0466708_032942 | 3300042652 | Bacteria | 36683 |
| 151 | Ga0466725_272788 | 3300042654 | Bacteria | 15338 |
| 152 | Ga0466710_051504 | 3300042613 | Bacteria | 4169 |
| 153 | Ga0466710_255496 | 3300042613 | Bacteria | 1178 |
| 154 | Ga0466711_145003 | 3300042615 | Bacteria | 32111 |
| 155 | Ga0466726_344750 | 3300042619 | Bacteria | 1276 |
| 156 | Ga0160445_128098 | 3300012847 | Bacteria | 702 |
| 157 | Ga0160430_124081 | 3300012852 | Bacteria | 806 |
| 158 | Ga0466656_373111 | 3300042550 | Unclassified | 1757 |
| 159 | Ga0466692_058899 | 3300042591 | Bacteria | 20827 |
| 160 | Ga0466691_209335 | 3300042593 | Bacteria | 25069 |
| 161 | Ga0466695_322727 | 3300042595 | Bacteria | 3049 |
| 162 | Ga0466701_030732 | 3300042598 | Bacteria | 1128 |
| 163 | Ga0466706_241347 | 3300042599 | Bacteria | 14034 |
| 164 | Ga0466713_091546 | 3300042602 | Bacteria | 18477 |
| 165 | Ga0466713_109624 | 3300042602 | Bacteria | 13785 |
| 166 | Ga0466719_157184 | 3300042606 | Bacteria | 16488 |
| 167 | Ga0466719_520088 | 3300042606 | Bacteria | 1361 |
| 168 | Ga0466721_399502 | 3300042608 | Bacteria | 7056 |
| 169 | JGI24695J34938_10113597 | 3300002450 | Bacteria | 1103 |
| 170 | JGI24699J35502_11126023 | 3300002509 | Bacteria | 3890 |
| 171 | Ga0466734_149194 | 3300042623 | Unclassified | 2954 |
| 172 | Ga0466735_148577 | 3300042624 | Bacteria | 3513 |
| 173 | Ga0466725_415336 | 3300042654 | Bacteria | 6484 |
| 174 | Ga0466705_069381 | 3300042612 | Unclassified | 7318 |
| 175 | Ga0466710_211598 | 3300042613 | Bacteria | 14971 |
| 176 | Ga0466723_233813 | 3300042618 | Bacteria | 18111 |
| 177 | Ga0415639_240192 | 3300038395 | Bacteria | 1502 |
| 178 | Ga0466692_128697 | 3300042591 | Bacteria | 29218 |
| 179 | Ga0466696_042576 | 3300042596 | Bacteria | 13410 |
| 180 | Ga0123357_10314815 | 3300009784 | Bacteria | 1556 |
| 181 | Ga0123353_11045616 | 3300010167 | Bacteria | 1091 |
| 182 | Ga0123354_10002414 | 3300010882 | Bacteria | 24635 |
| 183 | Ga0123354_10223945 | 3300010882 | Bacteria | 1989 |
| 184 | Ga0160471_100449 | 3300012812 | Bacteria | 11696 |
| 185 | Ga0466701_083530 | 3300042598 | Bacteria | 21770 |
| 186 | Ga0466717_056043 | 3300042604 | Bacteria | 1738 |
| 187 | Ga0466717_091910 | 3300042604 | Bacteria | 9410 |
| 188 | Ga0466721_197708 | 3300042608 | Bacteria | 1705 |
| 189 | IMNBL1DRAFT_c0010256 | 3300000062 | Bacteria | 4516 |
| 190 | Ga0068305_10277852 | 3300005083 | Bacteria | 15502 |
| 191 | Ga0072941_1298474 | 3300005201 | Bacteria | 1241 |
| 192 | Ga0102738_1044092 | 3300007141 | Bacteria | 694 |
| 193 | Ga0466729_213353 | 3300042621 | Bacteria | 3218 |
| 194 | Ga0466734_013970 | 3300042623 | Bacteria | 6316 |
| 195 | Ga0466734_076922 | 3300042623 | Bacteria | 4017 |
| 196 | Ga0466730_077634 | 3300042625 | Unclassified | 1485 |
| 197 | Ga0466703_276609 | 3300042636 | Bacteria | 60964 |
| 198 | Ga0466710_048029 | 3300042613 | Bacteria | 2974 |
| 199 | Ga0466710_449055 | 3300042613 | Bacteria | 1565 |
| 200 | Ga0466711_063795 | 3300042615 | Bacteria | 5388 |
| 201 | Ga0466715_053802 | 3300042616 | Bacteria | 1600 |
| 202 | Ga0466715_438666 | 3300042616 | Bacteria | 23685 |
| 203 | Ga0466723_020620 | 3300042618 | Bacteria | 11703 |
| 204 | Ga0466726_079457 | 3300042619 | Bacteria | 4157 |
| 205 | Ga0466728_181251 | 3300042620 | Bacteria | 18833 |
| 206 | Ga0160452_100151 | 3300012834 | Bacteria | 81696 |
| 207 | Ga0466657_021707 | 3300042582 | Bacteria | 36648 |
| 208 | Ga0466691_106582 | 3300042593 | Bacteria | 7070 |
| 209 | Ga0466696_110075 | 3300042596 | Bacteria | 5185 |
| 210 | Ga0466701_066452 | 3300042598 | Bacteria | 1717 |
| 211 | Ga0466719_112619 | 3300042606 | Bacteria | 9806 |
| 212 | Ga0072941_1321574 | 3300005201 | Bacteria | 1251 |
| 213 | Ga0102737_1062140 | 3300007142 | Bacteria | 607 |
| 214 | Ga0103264_1000132 | 3300007188 | Bacteria | 42832 |
| 215 | Ga0466734_155673 | 3300042623 | Bacteria | 3851 |
| 216 | Ga0466703_060848 | 3300042636 | Bacteria | 8939 |
| 217 | Ga0466703_320420 | 3300042636 | Bacteria | 23900 |
| 218 | Ga0466709_129907 | 3300042648 | Bacteria | 2522 |
| 219 | Ga0466725_062588 | 3300042654 | Bacteria | 5682 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00327 | Ribosomal_L30 | Ribosomal protein L30p/L7e | 17 | 67 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.