Protein Family IF10307
Metagenome
Isolate
137
Members
96
Samples
110
Scaffolds
331.18
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_077254|Ga0466733_077254_12179_13291
- Length
- 370 aa
- Sequence
- MGTSITIKLFFSCCKRKKKINFVAFNFNVNLVQINLTTNATMKTAVIGATGMVGQTMIRVLEERNFPITELIPAASEKSVGKEIVFNGKAVKIVSVKEAVEAKPAFAIFSAGASTSRDWAPEFAKNGTVVIDNSSYWRMYPEVPLVVPEINSHAIKKGDMIISNPNCSTIQMVMALAPLHRRYKIKRLVAATYQSVTGTGVKAVRQMENERAGIKGDMAYAHPIDKNCFPHGGSFQDDGYTSEEQKLIDETRKILEDPTIMVTATVARIPVVGGHSEAINIEFEQEFDIEDVKKLIASFPGVTVCDNPAKNEYPMPVTAHNRDEVFVGRIRRDFSREKCLNLWIVSDNIRKGAATNAVQIAEYMAANKLY
Sample Types
Isolate
19.7%
Metagenome
80.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
23.6%
Kalotermitidae
14.6%
Unclassified
10.1%
Culicidae
10.1%
Formicidae
10.1%
Elmidae
9.0%
Armadillidiidae
5.6%
Termopsidae
3.4%
Daphniidae
2.2%
Rhinotermitidae
2.2%
Passalidae
2.2%
Hodotermitidae
1.1%
Diaspididae
1.1%
Hydrophilidae
1.1%
Apidae
1.1%
Pseudophyllodromiidae
1.1%
Cambaridae
1.1%
Taxonomy
Archaea
0
Bacteria
132
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 2 | 2820633305 | Unclassified Firmicutes Emb289P1bin118 | Isolate | Unclassified |
| 3 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 4 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 14 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 15 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 16 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 17 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 18 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 22 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 23 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 24 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 25 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 26 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 34 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 35 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 36 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 37 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 38 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 39 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 40 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 41 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 42 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 43 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 44 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 45 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 46 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 47 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 48 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 49 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 50 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 51 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 52 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 53 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 54 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 55 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 56 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 57 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 58 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 59 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 60 | 2540341063 | Candidatus Uzinura diaspidicola ASNER | Isolate | Diaspididae |
| 61 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 62 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 63 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 64 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 65 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 66 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 67 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 68 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 69 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 70 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 71 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 72 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 73 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 74 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 75 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 76 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 77 | 8065497608 | Tellurirhabdus bombi IE-0392 | Isolate | Apidae |
| 78 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 79 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 80 | 3002031819 | Blattabacterium cuenoti SHELFORDIsp | Isolate | Pseudophyllodromiidae |
| 81 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 82 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 83 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 84 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 85 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 86 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 87 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 88 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 89 | 2921902974 | Chryseobacterium sp. cx-624 | Isolate | Cambaridae |
| 90 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 91 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 92 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 93 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 94 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 95 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 96 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0102736_1000184 | 3300007052 | Bacteria | 23021 |
| 2 | Ga0103267_1000202 | 3300007190 | Bacteria | 33039 |
| 3 | Ga0123353_10445807 | 3300010167 | Bacteria | 1908 |
| 4 | Ga0466705_429957 | 3300042612 | Bacteria | 16344 |
| 5 | Ga0466715_288109 | 3300042616 | Bacteria | 15023 |
| 6 | Ga0466729_165434 | 3300042621 | Bacteria | 8860 |
| 7 | Ga0466735_014927 | 3300042624 | Bacteria | 20694 |
| 8 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 9 | Ga0160446_100002 | 3300012835 | Bacteria | 540874 |
| 10 | Ga0160460_100014 | 3300012845 | Bacteria | 440592 |
| 11 | Ga0160457_1000985 | 3300012858 | Bacteria | 9375 |
| 12 | Ga0466701_022882 | 3300042598 | Unclassified | 9091 |
| 13 | Ga0466697_082880 | 3300042611 | Bacteria | 1208 |
| 14 | IMNBL1DRAFT_c0000084 | 3300000062 | Bacteria | 83865 |
| 15 | IMNBL1DRAFT_c0046673 | 3300000062 | Bacteria | 1404 |
| 16 | Ga0103265_1008335 | 3300007068 | Bacteria | 1370 |
| 17 | Ga0102735_1000103 | 3300007080 | Bacteria | 22156 |
| 18 | Ga0102734_1000235 | 3300007129 | Bacteria | 32292 |
| 19 | Ga0105524_104148 | 3300007733 | Bacteria | 1316 |
| 20 | Ga0123353_10243559 | 3300010167 | Unclassified | 2791 |
| 21 | Ga0466729_264618 | 3300042621 | Bacteria | 4360 |
| 22 | Ga0466703_211767 | 3300042636 | Bacteria | 4044 |
| 23 | Ga0466709_108564 | 3300042648 | Bacteria | 18399 |
| 24 | Ga0160460_100125 | 3300012845 | Bacteria | 96320 |
| 25 | Ga0160448_101885 | 3300012854 | Unclassified | 6669 |
| 26 | Ga0466656_102468 | 3300042550 | Bacteria | 15603 |
| 27 | Ga0466657_208982 | 3300042582 | Bacteria | 2888 |
| 28 | Ga0466706_242576 | 3300042599 | Bacteria | 24640 |
| 29 | Ga0466722_147683 | 3300042609 | Bacteria | 8636 |
| 30 | JGI24702J35022_10002603 | 3300002462 | Bacteria | 10962 |
| 31 | Ga0123354_10125288 | 3300010882 | Bacteria | 3286 |
| 32 | Ga0160465_100046 | 3300012803 | Bacteria | 148835 |
| 33 | Ga0160471_106134 | 3300012812 | Bacteria | 1529 |
| 34 | Ga0466710_125914 | 3300042613 | Bacteria | 2113 |
| 35 | Ga0466703_350642 | 3300042636 | Bacteria | 1805 |
| 36 | Ga0466704_586650 | 3300042643 | Bacteria | 23067 |
| 37 | Ga0466709_412106 | 3300042648 | Bacteria | 58576 |
| 38 | Ga0466724_59158 | 3300042649 | Bacteria | 434991 |
| 39 | Ga0466725_114377 | 3300042654 | Bacteria | 7409 |
| 40 | Ga0160444_105123 | 3300012841 | Unclassified | 1752 |
| 41 | Ga0466691_073914 | 3300042593 | Bacteria | 26545 |
| 42 | Ga0466691_186282 | 3300042593 | Bacteria | 110439 |
| 43 | Ga0466719_042472 | 3300042606 | Bacteria | 2918 |
| 44 | Ga0466719_281821 | 3300042606 | Bacteria | 13621 |
| 45 | Ga0466732_114856 | 3300042656 | Bacteria | 2754 |
| 46 | IMNBGM34_c000492 | 3300000036 | Bacteria | 10564 |
| 47 | Ga0068305_10007123 | 3300005083 | Bacteria | 40292 |
| 48 | Ga0103267_1000377 | 3300007190 | Bacteria | 15024 |
| 49 | Ga0103268_1000072 | 3300007192 | Bacteria | 31082 |
| 50 | Ga0123355_10003911 | 3300009826 | Bacteria | 21550 |
| 51 | Ga0123356_10016007 | 3300010049 | Bacteria | 7169 |
| 52 | Ga0123356_10025756 | 3300010049 | Bacteria | 5529 |
| 53 | Ga0123356_10239071 | 3300010049 | Bacteria | 1886 |
| 54 | Ga0466711_296350 | 3300042615 | Bacteria | 41299 |
| 55 | Ga0466711_469051 | 3300042615 | Bacteria | 13902 |
| 56 | Ga0466726_486054 | 3300042619 | Bacteria | 22749 |
| 57 | Ga0466728_177195 | 3300042620 | Bacteria | 4801 |
| 58 | Ga0160445_100067 | 3300012847 | Bacteria | 116777 |
| 59 | Ga0160457_1000370 | 3300012858 | Bacteria | 24175 |
| 60 | Ga0466657_058689 | 3300042582 | Bacteria | 22650 |
| 61 | Ga0466707_272231 | 3300042601 | Bacteria | 11824 |
| 62 | Ga0466732_114310 | 3300042656 | Bacteria | 4956 |
| 63 | Ga0103265_1000160 | 3300007068 | Bacteria | 10513 |
| 64 | Ga0102740_1002719 | 3300007140 | Bacteria | 3962 |
| 65 | Ga0103267_1002792 | 3300007190 | Bacteria | 4536 |
| 66 | Ga0123355_10000211 | 3300009826 | Bacteria | 73196 |
| 67 | Ga0123353_10818767 | 3300010167 | Bacteria | 1282 |
| 68 | Ga0466723_235118 | 3300042618 | Bacteria | 9214 |
| 69 | Ga0160453_100455 | 3300012814 | Unclassified | 31752 |
| 70 | Ga0160455_100169 | 3300012837 | Bacteria | 69363 |
| 71 | Ga0160447_100004 | 3300012849 | Bacteria | 554359 |
| 72 | Ga0264413_150855 | 3300024493 | Bacteria | 1030 |
| 73 | Ga0466690_236365 | 3300042590 | Bacteria | 6358 |
| 74 | Ga0466693_139991 | 3300042592 | Bacteria | 1334 |
| 75 | Ga0466696_108263 | 3300042596 | Bacteria | 13814 |
| 76 | Ga0466700_491831 | 3300042600 | Bacteria | 27432 |
| 77 | CVPL010W_10002402 | 3300002931 | Bacteria | 21983 |
| 78 | Ga0102734_1000590 | 3300007129 | Bacteria | 10127 |
| 79 | Ga0103264_1000015 | 3300007188 | Bacteria | 118328 |
| 80 | Ga0123355_10032303 | 3300009826 | Bacteria | 8494 |
| 81 | Ga0123356_10650951 | 3300010049 | Bacteria | 1221 |
| 82 | Ga0123353_10373868 | 3300010167 | Bacteria | 2135 |
| 83 | Ga0466711_458678 | 3300042615 | Bacteria | 1335 |
| 84 | Ga0466715_002964 | 3300042616 | Bacteria | 2433 |
| 85 | Ga0466723_004942 | 3300042618 | Bacteria | 30582 |
| 86 | Ga0466709_417454 | 3300042648 | Bacteria | 13610 |
| 87 | Ga0466691_089459 | 3300042593 | Bacteria | 11532 |
| 88 | Ga0466695_359661 | 3300042595 | Bacteria | 1285 |
| 89 | Ga0466696_222221 | 3300042596 | Bacteria | 29066 |
| 90 | Ga0466706_123047 | 3300042599 | Bacteria | 432554 |
| 91 | Ga0466713_041712 | 3300042602 | Bacteria | 19596 |
| 92 | Ga0466722_073935 | 3300042609 | Bacteria | 2346 |
| 93 | JGI24696J40584_12952137 | 3300002834 | Bacteria | 2312 |
| 94 | Ga0123355_10239354 | 3300009826 | Bacteria | 2575 |
| 95 | Ga0160464_101994 | 3300012805 | Bacteria | 4657 |
| 96 | Ga0466705_431708 | 3300042612 | Bacteria | 5627 |
| 97 | Ga0466710_225154 | 3300042613 | Bacteria | 2299 |
| 98 | Ga0466726_191226 | 3300042619 | Bacteria | 12728 |
| 99 | Ga0466708_282092 | 3300042652 | Bacteria | 20526 |
| 100 | Ga0466727_344855 | 3300042655 | Bacteria | 4506 |
| 101 | Ga0160433_100606 | 3300012846 | Bacteria | 14732 |
| 102 | Ga0466701_086544 | 3300042598 | Bacteria | 103634 |
| 103 | Ga0466713_051651 | 3300042602 | Bacteria | 26723 |
| 104 | Ga0466733_077254 | 3300042659 | Bacteria | 26018 |
| 105 | Ga0103265_1000007 | 3300007068 | Bacteria | 131664 |
| 106 | Ga0160464_100177 | 3300012805 | Bacteria | 66931 |
| 107 | Ga0466734_028584 | 3300042623 | Bacteria | 2501 |
| 108 | Ga0466708_271103 | 3300042652 | Bacteria | 8242 |
| 109 | Ga0466694_023426 | 3300042594 | Bacteria | 1814 |
| 110 | Ga0466701_086935 | 3300042598 | Bacteria | 154395 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.