Protein Family IF10303
Metagenome
Isolate
196
Members
60
Samples
190
Scaffolds
133.34
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_072363|Ga0466733_072363_568_1047
- Length
- 159 aa
- Sequence
- MRKYLLDTHTLVWAMLDKGKLSEPVLKILQDSNSQLFVSAVSFWEIAVKHGKGKLELENFLIGDIPGYCRRLRIEQIPLMPEEAINYSELPFFDNHKDPFDRMLIYQCIRDNYTLISKDRMFEQYMDAGLKLAWRNLAVAKNAANKEQPLYMEREQKKN
Sample Types
Isolate
3.1%
Metagenome
96.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
24.1%
Unclassified
12.1%
Rhinotermitidae
6.9%
Termopsidae
5.2%
Hodotermitidae
1.7%
Taxonomy
Archaea
0
Bacteria
161
Eukaryota
0
Viruses
0
Unclassified
35
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 8 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 9 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 10 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 11 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 14 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 27 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 31 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 32 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 33 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 34 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 35 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 36 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 43 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 44 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 45 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 46 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 47 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 48 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 49 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 50 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 51 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 52 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 53 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 54 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 55 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 56 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 57 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 58 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 59 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 60 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_343151 | 3300042616 | Bacteria | 6523 |
| 2 | Ga0466726_145287 | 3300042619 | Bacteria | 10654 |
| 3 | Ga0466691_136138 | 3300042593 | Bacteria | 21997 |
| 4 | Ga0466699_219094 | 3300042597 | Bacteria | 1302 |
| 5 | Ga0466701_045977 | 3300042598 | Bacteria | 2492 |
| 6 | Ga0466700_326399 | 3300042600 | Bacteria | 1021 |
| 7 | Ga0466707_183175 | 3300042601 | Bacteria | 1852 |
| 8 | Ga0466707_206217 | 3300042601 | Bacteria | 11154 |
| 9 | Ga0466722_016514 | 3300042609 | Bacteria | 3194 |
| 10 | AustNasuHG_c1037888 | 3300000089 | Bacteria | 1223 |
| 11 | JGI24695J34938_10000334 | 3300002450 | Bacteria | 46476 |
| 12 | Ga0068302_10125193 | 3300005071 | Bacteria | 1770 |
| 13 | Ga0466729_248667 | 3300042621 | Unclassified | 1318 |
| 14 | Ga0466734_148542 | 3300042623 | Bacteria | 3622 |
| 15 | Ga0466702_025742 | 3300042635 | Bacteria | 1262 |
| 16 | Ga0466703_126815 | 3300042636 | Bacteria | 1486 |
| 17 | Ga0466704_367914 | 3300042643 | Bacteria | 3352 |
| 18 | Ga0466708_237222 | 3300042652 | Unclassified | 1126 |
| 19 | Ga0466708_410766 | 3300042652 | Unclassified | 2031 |
| 20 | Ga0466708_458270 | 3300042652 | Bacteria | 1050 |
| 21 | Ga0466725_299883 | 3300042654 | Bacteria | 2651 |
| 22 | Ga0466727_039761 | 3300042655 | Unclassified | 1819 |
| 23 | Ga0466727_065816 | 3300042655 | Bacteria | 2540 |
| 24 | Ga0123357_10292158 | 3300009784 | Bacteria | 1663 |
| 25 | Ga0123356_10101965 | 3300010049 | Bacteria | 2755 |
| 26 | Ga0123356_10519999 | 3300010049 | Bacteria | 1348 |
| 27 | Ga0466697_231183 | 3300042611 | Unclassified | 1218 |
| 28 | Ga0466697_242460 | 3300042611 | Bacteria | 1253 |
| 29 | Ga0466705_170819 | 3300042612 | Bacteria | 1817 |
| 30 | Ga0466705_372093 | 3300042612 | Bacteria | 2460 |
| 31 | Ga0466712_219434 | 3300042614 | Bacteria | 3983 |
| 32 | Ga0466712_279320 | 3300042614 | Bacteria | 6879 |
| 33 | Ga0466723_177785 | 3300042618 | Bacteria | 7123 |
| 34 | Ga0466726_461470 | 3300042619 | Bacteria | 1641 |
| 35 | Ga0264413_106811 | 3300024493 | Unclassified | 7914 |
| 36 | Ga0264413_125901 | 3300024493 | Bacteria | 3762 |
| 37 | Ga0466656_045592 | 3300042550 | Bacteria | 9087 |
| 38 | Ga0466691_023853 | 3300042593 | Bacteria | 11971 |
| 39 | Ga0466694_209431 | 3300042594 | Bacteria | 5138 |
| 40 | Ga0466694_361920 | 3300042594 | Bacteria | 1051 |
| 41 | Ga0466701_099006 | 3300042598 | Bacteria | 7167 |
| 42 | Ga0466717_098137 | 3300042604 | Bacteria | 2122 |
| 43 | Ga0466716_121392 | 3300042605 | Bacteria | 28760 |
| 44 | Ga0466719_416486 | 3300042606 | Bacteria | 3509 |
| 45 | Ga0466719_487790 | 3300042606 | Unclassified | 2017 |
| 46 | Ga0466697_042553 | 3300042611 | Bacteria | 1057 |
| 47 | JGI24695J34938_10128876 | 3300002450 | Bacteria | 1031 |
| 48 | JGI24702J35022_10211318 | 3300002462 | Bacteria | 1114 |
| 49 | JGI24702J35022_10721667 | 3300002462 | Bacteria | 620 |
| 50 | Ga0068305_10052779 | 3300005083 | Bacteria | 502 |
| 51 | Ga0072940_1029184 | 3300005200 | Unclassified | 1065 |
| 52 | Ga0466731_004442 | 3300042622 | Unclassified | 1278 |
| 53 | Ga0466731_113718 | 3300042622 | Bacteria | 1333 |
| 54 | Ga0466709_213527 | 3300042648 | Bacteria | 23621 |
| 55 | Ga0123357_10072289 | 3300009784 | Bacteria | 4571 |
| 56 | Ga0123356_11133095 | 3300010049 | Bacteria | 950 |
| 57 | Ga0123353_11385966 | 3300010167 | Bacteria | 905 |
| 58 | Ga0123354_10424185 | 3300010882 | Unclassified | 1102 |
| 59 | Ga0466697_060221 | 3300042611 | Bacteria | 1090 |
| 60 | Ga0466718_121077 | 3300042617 | Bacteria | 1511 |
| 61 | Ga0466726_164520 | 3300042619 | Bacteria | 2365 |
| 62 | Ga0466728_167793 | 3300042620 | Bacteria | 2630 |
| 63 | Ga0264413_104132 | 3300024493 | Bacteria | 25431 |
| 64 | Ga0466690_010791 | 3300042590 | Bacteria | 5058 |
| 65 | Ga0466699_054860 | 3300042597 | Bacteria | 1518 |
| 66 | Ga0466706_198488 | 3300042599 | Unclassified | 1959 |
| 67 | Ga0072941_1031060 | 3300005201 | Bacteria | 10004 |
| 68 | Ga0072941_1112085 | 3300005201 | Unclassified | 2375 |
| 69 | Ga0466729_312574 | 3300042621 | Bacteria | 2856 |
| 70 | Ga0466704_468920 | 3300042643 | Bacteria | 1795 |
| 71 | Ga0466708_157271 | 3300042652 | Unclassified | 1833 |
| 72 | Ga0466725_199932 | 3300042654 | Bacteria | 1143 |
| 73 | Ga0123356_11098192 | 3300010049 | Unclassified | 964 |
| 74 | Ga0123356_13502466 | 3300010049 | Bacteria | 544 |
| 75 | Ga0466705_175795 | 3300042612 | Bacteria | 2606 |
| 76 | Ga0466733_078893 | 3300042659 | Bacteria | 1529 |
| 77 | Ga0466733_141686 | 3300042659 | Bacteria | 12353 |
| 78 | Ga0466711_116844 | 3300042615 | Bacteria | 1364 |
| 79 | Ga0466726_049146 | 3300042619 | Bacteria | 5207 |
| 80 | Ga0264413_127705 | 3300024493 | Bacteria | 3540 |
| 81 | Ga0456237_0006149 | 3300041968 | Bacteria | 1890 |
| 82 | Ga0466701_041410 | 3300042598 | Bacteria | 2529 |
| 83 | Ga0466707_015385 | 3300042601 | Bacteria | 25153 |
| 84 | Ga0466707_111455 | 3300042601 | Bacteria | 3759 |
| 85 | Ga0466719_138882 | 3300042606 | Bacteria | 2066 |
| 86 | Ga0466720_045069 | 3300042607 | Bacteria | 18200 |
| 87 | Ga0466722_176111 | 3300042609 | Bacteria | 2377 |
| 88 | Ga0466698_308367 | 3300042610 | Bacteria | 1061 |
| 89 | JGI24695J34938_10252397 | 3300002450 | Bacteria | 749 |
| 90 | JGI24702J35022_10069963 | 3300002462 | Bacteria | 1888 |
| 91 | JGI24702J35022_10139928 | 3300002462 | Bacteria | 1350 |
| 92 | Ga0072940_1180263 | 3300005200 | Bacteria | 870 |
| 93 | Ga0466731_235939 | 3300042622 | Bacteria | 1465 |
| 94 | Ga0466731_403646 | 3300042622 | Bacteria | 1208 |
| 95 | Ga0466703_011960 | 3300042636 | Unclassified | 1014 |
| 96 | Ga0466704_049629 | 3300042643 | Bacteria | 6710 |
| 97 | Ga0466704_573016 | 3300042643 | Bacteria | 11415 |
| 98 | Ga0466709_410831 | 3300042648 | Unclassified | 1829 |
| 99 | Ga0466725_353683 | 3300042654 | Bacteria | 13802 |
| 100 | Ga0466727_069291 | 3300042655 | Bacteria | 1095 |
| 101 | Ga0466727_200015 | 3300042655 | Bacteria | 3087 |
| 102 | Ga0123355_10860950 | 3300009826 | Bacteria | 995 |
| 103 | Ga0123356_10451806 | 3300010049 | Bacteria | 1433 |
| 104 | Ga0123356_12583472 | 3300010049 | Bacteria | 636 |
| 105 | Ga0123356_12977603 | 3300010049 | Bacteria | 591 |
| 106 | Ga0123353_10063678 | 3300010167 | Bacteria | 5915 |
| 107 | Ga0123353_10277281 | 3300010167 | Unclassified | 2578 |
| 108 | Ga0123353_10335551 | 3300010167 | Bacteria | 2286 |
| 109 | Ga0466711_003009 | 3300042615 | Bacteria | 1946 |
| 110 | Ga0466723_028299 | 3300042618 | Bacteria | 6469 |
| 111 | Ga0466693_210222 | 3300042592 | Bacteria | 16607 |
| 112 | Ga0466691_116045 | 3300042593 | Bacteria | 2405 |
| 113 | Ga0466699_010107 | 3300042597 | Bacteria | 11886 |
| 114 | Ga0466707_201578 | 3300042601 | Bacteria | 1177 |
| 115 | Ga0466707_247452 | 3300042601 | Bacteria | 17099 |
| 116 | Ga0466720_004863 | 3300042607 | Unclassified | 1744 |
| 117 | Ga0466721_335303 | 3300042608 | Bacteria | 1585 |
| 118 | Ga0466704_332930 | 3300042643 | Unclassified | 1766 |
| 119 | Ga0466708_011007 | 3300042652 | Unclassified | 1651 |
| 120 | Ga0466708_036871 | 3300042652 | Bacteria | 10315 |
| 121 | Ga0466708_268659 | 3300042652 | Unclassified | 2316 |
| 122 | Ga0123356_10026849 | 3300010049 | Bacteria | 5401 |
| 123 | Ga0466705_196362 | 3300042612 | Bacteria | 6706 |
| 124 | Ga0466705_432689 | 3300042612 | Bacteria | 11828 |
| 125 | Ga0466712_140672 | 3300042614 | Bacteria | 1557 |
| 126 | Ga0466715_189900 | 3300042616 | Bacteria | 1296 |
| 127 | Ga0466726_147772 | 3300042619 | Bacteria | 2869 |
| 128 | Ga0466728_004271 | 3300042620 | Bacteria | 3812 |
| 129 | Ga0466728_119322 | 3300042620 | Unclassified | 1105 |
| 130 | Ga0466692_090077 | 3300042591 | Bacteria | 2290 |
| 131 | Ga0466699_099435 | 3300042597 | Unclassified | 1349 |
| 132 | Ga0466701_060472 | 3300042598 | Bacteria | 2948 |
| 133 | Ga0466700_159960 | 3300042600 | Bacteria | 2599 |
| 134 | Ga0466700_312029 | 3300042600 | Bacteria | 5922 |
| 135 | Ga0466707_402360 | 3300042601 | Bacteria | 1456 |
| 136 | Ga0466719_183553 | 3300042606 | Unclassified | 1122 |
| 137 | Ga0466719_222435 | 3300042606 | Bacteria | 1077 |
| 138 | Ga0466720_191140 | 3300042607 | Bacteria | 11274 |
| 139 | Ga0466698_381291 | 3300042610 | Bacteria | 1724 |
| 140 | Ga0072941_1181765 | 3300005201 | Bacteria | 7743 |
| 141 | Ga0466702_103892 | 3300042635 | Bacteria | 2911 |
| 142 | Ga0466703_086583 | 3300042636 | Bacteria | 2501 |
| 143 | Ga0466704_258618 | 3300042643 | Bacteria | 1676 |
| 144 | Ga0466704_341635 | 3300042643 | Bacteria | 32677 |
| 145 | Ga0466708_414482 | 3300042652 | Bacteria | 1674 |
| 146 | Ga0123356_11214227 | 3300010049 | Bacteria | 920 |
| 147 | Ga0123353_10595966 | 3300010167 | Bacteria | 1581 |
| 148 | Ga0123353_10956661 | 3300010167 | Unclassified | 1157 |
| 149 | Ga0123354_10121014 | 3300010882 | Bacteria | 3381 |
| 150 | Ga0466733_072363 | 3300042659 | Unclassified | 1155 |
| 151 | Ga0466710_414215 | 3300042613 | Bacteria | 2360 |
| 152 | Ga0466712_001059 | 3300042614 | Unclassified | 1296 |
| 153 | Ga0466711_132179 | 3300042615 | Bacteria | 4399 |
| 154 | Ga0466715_104612 | 3300042616 | Bacteria | 8147 |
| 155 | Ga0466718_024692 | 3300042617 | Bacteria | 3486 |
| 156 | Ga0466726_016357 | 3300042619 | Bacteria | 2310 |
| 157 | Ga0264413_125672 | 3300024493 | Unclassified | 3675 |
| 158 | Ga0466696_151999 | 3300042596 | Bacteria | 1659 |
| 159 | Ga0466699_151252 | 3300042597 | Bacteria | 5953 |
| 160 | Ga0466707_162975 | 3300042601 | Bacteria | 1301 |
| 161 | Ga0466707_208689 | 3300042601 | Bacteria | 2015 |
| 162 | Ga0466719_246303 | 3300042606 | Bacteria | 2700 |
| 163 | JGI24698J34947_10123347 | 3300002449 | Unclassified | 1120 |
| 164 | JGI24702J35022_10017686 | 3300002462 | Bacteria | 3893 |
| 165 | JGI24702J35022_10079552 | 3300002462 | Unclassified | 1775 |
| 166 | JGI24702J35022_10985210 | 3300002462 | Bacteria | 525 |
| 167 | Ga0466734_041376 | 3300042623 | Bacteria | 1221 |
| 168 | Ga0466708_096932 | 3300042652 | Bacteria | 1706 |
| 169 | Ga0123356_14006992 | 3300010049 | Bacteria | 507 |
| 170 | Ga0466705_216887 | 3300042612 | Bacteria | 13606 |
| 171 | Ga0466712_314887 | 3300042614 | Bacteria | 10326 |
| 172 | Ga0466728_054375 | 3300042620 | Bacteria | 1677 |
| 173 | Ga0264413_102130 | 3300024493 | Bacteria | 11483 |
| 174 | Ga0466699_214363 | 3300042597 | Unclassified | 1026 |
| 175 | Ga0466707_010264 | 3300042601 | Bacteria | 1052 |
| 176 | Ga0466717_254524 | 3300042604 | Bacteria | 3933 |
| 177 | Ga0466720_192567 | 3300042607 | Bacteria | 1679 |
| 178 | Ga0466720_227306 | 3300042607 | Unclassified | 1711 |
| 179 | Ga0072940_1109721 | 3300005200 | Unclassified | 781 |
| 180 | Ga0072940_1409997 | 3300005200 | Bacteria | 710 |
| 181 | Ga0466731_169735 | 3300042622 | Bacteria | 1662 |
| 182 | Ga0466704_418637 | 3300042643 | Unclassified | 1369 |
| 183 | Ga0466704_514884 | 3300042643 | Bacteria | 3212 |
| 184 | Ga0466708_045495 | 3300042652 | Bacteria | 3222 |
| 185 | Ga0466725_152332 | 3300042654 | Bacteria | 11510 |
| 186 | Ga0466727_053741 | 3300042655 | Bacteria | 1191 |
| 187 | Ga0466727_206302 | 3300042655 | Bacteria | 1287 |
| 188 | Ga0123356_10619326 | 3300010049 | Bacteria | 1248 |
| 189 | Ga0123356_11717661 | 3300010049 | Bacteria | 779 |
| 190 | Ga0123353_10374985 | 3300010167 | Unclassified | 2131 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01850 | PIN | PIN domain | 4 | 125 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.