Protein Family IF10271
Metagenome
Isolate
234
Members
68
Samples
224
Scaffolds
131.89
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_010991|Ga0466733_010991_12246_12704
- Length
- 152 aa
- Sequence
- LDIGCGQFCCSAEYIEKTFLKMTDPIADFLTRIRNAVKAGHKVVEIPASNTKKEITRILHEKGYILSYKFMEEGPQGSIKIALKYHPETKRSAIKDLKRVSTPGLRRYAGVDTMPSVLNGLGVAIVSTSKGLMTDKEARLQNVGGEVLCYVY
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.6%
Kalotermitidae
21.9%
Unclassified
17.2%
Termopsidae
6.2%
Passalidae
4.7%
Rhinotermitidae
4.7%
Armadillidiidae
3.1%
Hodotermitidae
1.6%
Taxonomy
Archaea
0
Bacteria
229
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 26 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 27 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 30 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 34 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 35 | 2820789850 | Unclassified Bacteroidetes Cu122P3bin3 | Isolate | Unclassified |
| 36 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 37 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 38 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 41 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 42 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 43 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 44 | 2509276035 | Saprospira grandis HR1, DSM 2844 | Isolate | |
| 45 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 46 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 47 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 48 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 51 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 52 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 53 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 54 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 55 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 56 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 57 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 58 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 59 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 60 | 2820344559 | Unclassified Firmicutes Nt197P3bin63 | Isolate | Unclassified |
| 61 | 2820141685 | Unclassified Proteobacteria Emb289P3bin118 | Isolate | Unclassified |
| 62 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 63 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 64 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 65 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 66 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 67 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 68 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_206495 | 3300042612 | Bacteria | 9920 |
| 2 | Ga0466732_106734 | 3300042656 | Bacteria | 2077 |
| 3 | Ga0466732_257409 | 3300042656 | Bacteria | 6667 |
| 4 | Ga0466712_091015 | 3300042614 | Bacteria | 1915 |
| 5 | Ga0466711_141717 | 3300042615 | Bacteria | 15726 |
| 6 | Ga0466723_356606 | 3300042618 | Bacteria | 2592 |
| 7 | Ga0466728_013154 | 3300042620 | Bacteria | 8447 |
| 8 | Ga0466729_104642 | 3300042621 | Bacteria | 1562 |
| 9 | Ga0466706_013322 | 3300042599 | Bacteria | 22899 |
| 10 | Ga0466714_061236 | 3300042603 | Bacteria | 3761 |
| 11 | Ga0466714_134793 | 3300042603 | Bacteria | 2217 |
| 12 | Ga0466719_014340 | 3300042606 | Bacteria | 3791 |
| 13 | Ga0466719_262849 | 3300042606 | Bacteria | 2805 |
| 14 | Ga0466722_256311 | 3300042609 | Bacteria | 1187 |
| 15 | Ga0466690_067989 | 3300042590 | Bacteria | 8676 |
| 16 | Ga0466691_154458 | 3300042593 | Bacteria | 3745 |
| 17 | Ga0466696_074985 | 3300042596 | Bacteria | 1333 |
| 18 | Ga0466696_292634 | 3300042596 | Bacteria | 17358 |
| 19 | IMNBL1DRAFT_c0005235 | 3300000062 | Bacteria | 7488 |
| 20 | JGI24702J35022_10006852 | 3300002462 | Bacteria | 6559 |
| 21 | Ga0123356_10363362 | 3300010049 | Unclassified | 1575 |
| 22 | Ga0123353_10037860 | 3300010167 | Bacteria | 7572 |
| 23 | Ga0466703_096430 | 3300042636 | Bacteria | 9512 |
| 24 | Ga0466704_256111 | 3300042643 | Bacteria | 159283 |
| 25 | Ga0466704_601523 | 3300042643 | Bacteria | 55044 |
| 26 | Ga0466709_060190 | 3300042648 | Bacteria | 23292 |
| 27 | Ga0466709_207118 | 3300042648 | Bacteria | 10221 |
| 28 | Ga0466727_126885 | 3300042655 | Bacteria | 7151 |
| 29 | Ga0466697_154536 | 3300042611 | Bacteria | 6155 |
| 30 | Ga0466705_336554 | 3300042612 | Bacteria | 16075 |
| 31 | Ga0466715_275548 | 3300042616 | Bacteria | 29682 |
| 32 | Ga0466723_011230 | 3300042618 | Bacteria | 22564 |
| 33 | Ga0466723_021865 | 3300042618 | Bacteria | 3511 |
| 34 | Ga0466726_360735 | 3300042619 | Bacteria | 24168 |
| 35 | Ga0466726_377525 | 3300042619 | Bacteria | 1161 |
| 36 | Ga0466707_017686 | 3300042601 | Bacteria | 186599 |
| 37 | Ga0466714_001106 | 3300042603 | Bacteria | 7202 |
| 38 | Ga0466719_218070 | 3300042606 | Bacteria | 19356 |
| 39 | Ga0466722_035400 | 3300042609 | Bacteria | 82053 |
| 40 | Ga0160443_107901 | 3300012848 | Bacteria | 1299 |
| 41 | Ga0415639_256415 | 3300038395 | Bacteria | 1482 |
| 42 | Ga0466690_170288 | 3300042590 | Bacteria | 25098 |
| 43 | Ga0466692_107095 | 3300042591 | Bacteria | 3493 |
| 44 | Ga0466696_396970 | 3300042596 | Bacteria | 18436 |
| 45 | Ga0466699_027650 | 3300042597 | Bacteria | 2311 |
| 46 | 2227476227 | 2225789004 | Unclassified | 883 |
| 47 | JGI24702J35022_10004800 | 3300002462 | Bacteria | 7988 |
| 48 | Ga0068305_11099962 | 3300005083 | Bacteria | 651 |
| 49 | Ga0123357_10015501 | 3300009784 | Bacteria | 9995 |
| 50 | Ga0123356_10154027 | 3300010049 | Bacteria | 2286 |
| 51 | Ga0123356_10160906 | 3300010049 | Bacteria | 2242 |
| 52 | Ga0123353_10273588 | 3300010167 | Bacteria | 2600 |
| 53 | Ga0466704_200902 | 3300042643 | Bacteria | 34955 |
| 54 | Ga0466725_100057 | 3300042654 | Bacteria | 1454 |
| 55 | Ga0466705_069841 | 3300042612 | Bacteria | 12967 |
| 56 | Ga0466705_403255 | 3300042612 | Bacteria | 37741 |
| 57 | Ga0466711_007105 | 3300042615 | Bacteria | 19648 |
| 58 | Ga0466715_487149 | 3300042616 | Bacteria | 11128 |
| 59 | Ga0466723_157366 | 3300042618 | Bacteria | 8014 |
| 60 | Ga0466726_486744 | 3300042619 | Bacteria | 4017 |
| 61 | Ga0466701_058898 | 3300042598 | Bacteria | 6195 |
| 62 | Ga0466706_103986 | 3300042599 | Bacteria | 16586 |
| 63 | Ga0466707_331905 | 3300042601 | Bacteria | 1332 |
| 64 | Ga0466714_122639 | 3300042603 | Bacteria | 2835 |
| 65 | Ga0466717_017183 | 3300042604 | Bacteria | 2585 |
| 66 | Ga0466717_112943 | 3300042604 | Bacteria | 2764 |
| 67 | Ga0466716_046815 | 3300042605 | Bacteria | 19887 |
| 68 | Ga0466716_089342 | 3300042605 | Bacteria | 8560 |
| 69 | Ga0466690_147457 | 3300042590 | Bacteria | 20788 |
| 70 | Ga0466690_166742 | 3300042590 | Bacteria | 3173 |
| 71 | Ga0466690_363776 | 3300042590 | Bacteria | 13253 |
| 72 | Ga0466691_037573 | 3300042593 | Bacteria | 71526 |
| 73 | Ga0466694_359793 | 3300042594 | Bacteria | 1879 |
| 74 | Ga0466696_496500 | 3300042596 | Bacteria | 2936 |
| 75 | IMNBGM34_c000179 | 3300000036 | Bacteria | 18779 |
| 76 | JGI24702J35022_10084919 | 3300002462 | Bacteria | 1719 |
| 77 | Ga0068302_10091384 | 3300005071 | Bacteria | 610 |
| 78 | Ga0466704_092701 | 3300042643 | Bacteria | 9103 |
| 79 | Ga0466708_053272 | 3300042652 | Bacteria | 23559 |
| 80 | Ga0466733_028802 | 3300042659 | Bacteria | 1247 |
| 81 | Ga0466733_079037 | 3300042659 | Bacteria | 2512 |
| 82 | Ga0466710_350880 | 3300042613 | Bacteria | 1005 |
| 83 | Ga0466712_110500 | 3300042614 | Bacteria | 2218 |
| 84 | Ga0466723_037812 | 3300042618 | Bacteria | 8832 |
| 85 | Ga0466723_039697 | 3300042618 | Bacteria | 34610 |
| 86 | Ga0466726_097429 | 3300042619 | Bacteria | 22374 |
| 87 | Ga0466726_370771 | 3300042619 | Bacteria | 16090 |
| 88 | Ga0466706_236050 | 3300042599 | Bacteria | 32404 |
| 89 | Ga0466714_019400 | 3300042603 | Bacteria | 4888 |
| 90 | Ga0466714_167415 | 3300042603 | Bacteria | 3324 |
| 91 | Ga0466719_150438 | 3300042606 | Bacteria | 7577 |
| 92 | Ga0466722_163845 | 3300042609 | Bacteria | 26139 |
| 93 | Ga0265387_1000159 | 3300024582 | Bacteria | 12397 |
| 94 | Ga0466690_040168 | 3300042590 | Bacteria | 26767 |
| 95 | Ga0466696_283703 | 3300042596 | Bacteria | 19581 |
| 96 | Ga0466696_395854 | 3300042596 | Bacteria | 4403 |
| 97 | Ga0466699_115841 | 3300042597 | Bacteria | 8554 |
| 98 | Ga0466699_438039 | 3300042597 | Bacteria | 1025 |
| 99 | IMNBL1DRAFT_c0008380 | 3300000062 | Bacteria | 5269 |
| 100 | IMNBL1DRAFT_c0051455 | 3300000062 | Bacteria | 1297 |
| 101 | JGI24698J34947_10067875 | 3300002449 | Bacteria | 1728 |
| 102 | JGI24702J35022_10021145 | 3300002462 | Bacteria | 3529 |
| 103 | JGI24702J35022_10087080 | 3300002462 | Bacteria | 1696 |
| 104 | Ga0123357_10236578 | 3300009784 | Bacteria | 1988 |
| 105 | Ga0123356_12160859 | 3300010049 | Bacteria | 695 |
| 106 | Ga0466727_316709 | 3300042655 | Bacteria | 34486 |
| 107 | Ga0466697_084269 | 3300042611 | Bacteria | 1511 |
| 108 | Ga0466733_173615 | 3300042659 | Bacteria | 1663 |
| 109 | Ga0466723_027283 | 3300042618 | Bacteria | 8488 |
| 110 | Ga0466728_027008 | 3300042620 | Bacteria | 23890 |
| 111 | Ga0466707_027826 | 3300042601 | Bacteria | 1003 |
| 112 | Ga0466714_008744 | 3300042603 | Bacteria | 1703 |
| 113 | Ga0466714_070551 | 3300042603 | Bacteria | 4156 |
| 114 | Ga0466716_266388 | 3300042605 | Bacteria | 1253 |
| 115 | Ga0160455_100183 | 3300012837 | Bacteria | 61401 |
| 116 | Ga0466692_064596 | 3300042591 | Bacteria | 24215 |
| 117 | Ga0466692_120097 | 3300042591 | Bacteria | 76506 |
| 118 | Ga0466696_236491 | 3300042596 | Bacteria | 25393 |
| 119 | IMNBL1DRAFT_c0009342 | 3300000062 | Bacteria | 4850 |
| 120 | JGI24705J35276_12230458 | 3300002504 | Bacteria | 3635 |
| 121 | Ga0123356_10001668 | 3300010049 | Bacteria | 24294 |
| 122 | Ga0123356_10243454 | 3300010049 | Bacteria | 1871 |
| 123 | Ga0123353_10052579 | 3300010167 | Bacteria | 6505 |
| 124 | Ga0123353_10127496 | 3300010167 | Bacteria | 4087 |
| 125 | Ga0123353_10532965 | 3300010167 | Bacteria | 1699 |
| 126 | Ga0123354_10211652 | 3300010882 | Bacteria | 2093 |
| 127 | Ga0466735_221921 | 3300042624 | Bacteria | 30703 |
| 128 | Ga0466703_037151 | 3300042636 | Bacteria | 6018 |
| 129 | Ga0466709_096380 | 3300042648 | Bacteria | 3964 |
| 130 | Ga0466708_135787 | 3300042652 | Bacteria | 29737 |
| 131 | Ga0466733_003819 | 3300042659 | Bacteria | 23682 |
| 132 | Ga0466711_248472 | 3300042615 | Bacteria | 12038 |
| 133 | Ga0466715_008870 | 3300042616 | Bacteria | 9655 |
| 134 | Ga0466726_332711 | 3300042619 | Bacteria | 2659 |
| 135 | Ga0466729_037781 | 3300042621 | Bacteria | 19751 |
| 136 | Ga0466714_006814 | 3300042603 | Bacteria | 3863 |
| 137 | Ga0466714_021817 | 3300042603 | Bacteria | 7986 |
| 138 | Ga0466714_072376 | 3300042603 | Bacteria | 3377 |
| 139 | Ga0466714_120657 | 3300042603 | Bacteria | 2055 |
| 140 | Ga0466714_122808 | 3300042603 | Bacteria | 1866 |
| 141 | Ga0466714_131305 | 3300042603 | Bacteria | 5157 |
| 142 | Ga0466722_033585 | 3300042609 | Bacteria | 11227 |
| 143 | Ga0466656_215471 | 3300042550 | Bacteria | 5868 |
| 144 | Ga0466690_084322 | 3300042590 | Bacteria | 6679 |
| 145 | Ga0466690_386221 | 3300042590 | Bacteria | 3339 |
| 146 | 2227591268 | 2225789004 | Bacteria | 50477 |
| 147 | IMNBL1DRAFT_c0010128 | 3300000062 | Bacteria | 4559 |
| 148 | JGI24698J34947_10003141 | 3300002449 | Bacteria | 8946 |
| 149 | JGI24702J35022_10000164 | 3300002462 | Bacteria | 34496 |
| 150 | Ga0068302_10078363 | 3300005071 | Bacteria | 2025 |
| 151 | Ga0123356_10069677 | 3300010049 | Bacteria | 3298 |
| 152 | Ga0123356_10070298 | 3300010049 | Bacteria | 3283 |
| 153 | Ga0123356_10102750 | 3300010049 | Bacteria | 2744 |
| 154 | Ga0123356_10969108 | 3300010049 | Bacteria | 1021 |
| 155 | Ga0123354_10671371 | 3300010882 | Bacteria | 733 |
| 156 | Ga0466735_176465 | 3300042624 | Bacteria | 8295 |
| 157 | Ga0466703_008003 | 3300042636 | Bacteria | 11175 |
| 158 | Ga0466703_134989 | 3300042636 | Bacteria | 8257 |
| 159 | Ga0466703_260537 | 3300042636 | Unclassified | 1663 |
| 160 | Ga0466703_325817 | 3300042636 | Bacteria | 5487 |
| 161 | Ga0466703_417237 | 3300042636 | Bacteria | 1461 |
| 162 | Ga0466709_217396 | 3300042648 | Bacteria | 210619 |
| 163 | Ga0466727_212656 | 3300042655 | Bacteria | 11289 |
| 164 | Ga0466697_191671 | 3300042611 | Bacteria | 7258 |
| 165 | Ga0466705_038128 | 3300042612 | Bacteria | 49408 |
| 166 | Ga0466732_242870 | 3300042656 | Bacteria | 97652 |
| 167 | Ga0466733_010991 | 3300042659 | Bacteria | 23768 |
| 168 | Ga0466733_031543 | 3300042659 | Bacteria | 31583 |
| 169 | Ga0466733_127261 | 3300042659 | Bacteria | 9314 |
| 170 | Ga0466733_150100 | 3300042659 | Bacteria | 4758 |
| 171 | Ga0466711_214140 | 3300042615 | Bacteria | 14422 |
| 172 | Ga0466715_424271 | 3300042616 | Bacteria | 3117 |
| 173 | Ga0466718_000298 | 3300042617 | Bacteria | 1101 |
| 174 | Ga0466726_377045 | 3300042619 | Bacteria | 2301 |
| 175 | Ga0466701_065767 | 3300042598 | Bacteria | 1711 |
| 176 | Ga0466706_067758 | 3300042599 | Bacteria | 37640 |
| 177 | Ga0466714_010579 | 3300042603 | Bacteria | 1225 |
| 178 | Ga0466714_014428 | 3300042603 | Bacteria | 2564 |
| 179 | Ga0466714_022514 | 3300042603 | Bacteria | 4689 |
| 180 | Ga0466716_483438 | 3300042605 | Bacteria | 16673 |
| 181 | Ga0466722_082172 | 3300042609 | Bacteria | 4514 |
| 182 | Ga0466722_111573 | 3300042609 | Bacteria | 76934 |
| 183 | Ga0466722_261327 | 3300042609 | Bacteria | 19029 |
| 184 | Ga0265387_1011804 | 3300024582 | Unclassified | 1204 |
| 185 | Ga0466690_011065 | 3300042590 | Bacteria | 9665 |
| 186 | Ga0466690_112132 | 3300042590 | Bacteria | 8748 |
| 187 | Ga0466696_261873 | 3300042596 | Bacteria | 1282 |
| 188 | IMNBL1DRAFT_c0002479 | 3300000062 | Bacteria | 12828 |
| 189 | AustNasuHG_c1076474 | 3300000089 | Bacteria | 581 |
| 190 | JGI24699J35502_10675619 | 3300002509 | Unclassified | 743 |
| 191 | JGI24696J40584_12642788 | 3300002834 | Bacteria | 687 |
| 192 | Ga0068302_10062981 | 3300005071 | Bacteria | 3190 |
| 193 | Ga0123356_12548436 | 3300010049 | Bacteria | 640 |
| 194 | Ga0466734_050001 | 3300042623 | Bacteria | 1440 |
| 195 | Ga0466735_114961 | 3300042624 | Bacteria | 12299 |
| 196 | Ga0466704_441700 | 3300042643 | Bacteria | 20268 |
| 197 | Ga0466697_143885 | 3300042611 | Bacteria | 1030 |
| 198 | Ga0466733_017210 | 3300042659 | Bacteria | 20046 |
| 199 | Ga0466733_122413 | 3300042659 | Bacteria | 26318 |
| 200 | Ga0466712_277250 | 3300042614 | Bacteria | 5254 |
| 201 | Ga0466711_169486 | 3300042615 | Bacteria | 18240 |
| 202 | Ga0466715_265570 | 3300042616 | Bacteria | 8841 |
| 203 | Ga0466723_040344 | 3300042618 | Bacteria | 37666 |
| 204 | Ga0466723_254809 | 3300042618 | Bacteria | 13413 |
| 205 | Ga0466723_299798 | 3300042618 | Bacteria | 46375 |
| 206 | Ga0466706_156143 | 3300042599 | Bacteria | 24851 |
| 207 | Ga0466706_170575 | 3300042599 | Bacteria | 3179 |
| 208 | Ga0466700_186627 | 3300042600 | Bacteria | 5186 |
| 209 | Ga0466707_321972 | 3300042601 | Bacteria | 1185 |
| 210 | Ga0466713_077028 | 3300042602 | Bacteria | 7169 |
| 211 | Ga0466714_128318 | 3300042603 | Bacteria | 2375 |
| 212 | Ga0466714_158682 | 3300042603 | Bacteria | 1763 |
| 213 | Ga0466714_169031 | 3300042603 | Bacteria | 152952 |
| 214 | Ga0466719_041964 | 3300042606 | Bacteria | 13223 |
| 215 | Ga0466691_171488 | 3300042593 | Bacteria | 19589 |
| 216 | Ga0466694_399506 | 3300042594 | Bacteria | 2828 |
| 217 | Ga0466696_350760 | 3300042596 | Bacteria | 7322 |
| 218 | Ga0072941_1039792 | 3300005201 | Bacteria | 16891 |
| 219 | Ga0123354_10082829 | 3300010882 | Bacteria | 4519 |
| 220 | Ga0466729_317332 | 3300042621 | Bacteria | 1874 |
| 221 | Ga0466734_096790 | 3300042623 | Bacteria | 1285 |
| 222 | Ga0466703_241993 | 3300042636 | Bacteria | 19818 |
| 223 | Ga0466704_022207 | 3300042643 | Bacteria | 18398 |
| 224 | Ga0466708_076108 | 3300042652 | Bacteria | 112124 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00410 | Ribosomal_S8 | Ribosomal protein S8 | 24 | 152 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.