Protein Family IF10269
Metagenome
Isolate
316
Members
87
Samples
287
Scaffolds
349.37
Avg Length
Representative Sequence
- ID
- 3300042659|Ga0466733_008948|Ga0466733_008948_6635_7789
- Length
- 384 aa
- Sequence
- MRTFDYSFLENGMLPAGLINIVSTISSLREREKERKENYPVIFTRLESIAKVQSVKGSNAIEGIITSEQRINEIVNQNSAPLNHNEAEIAGYRDALGLVYKGFETMDIREHDILHLHEVMLSYAPVNGGSYKQADNVIMEVDSSGVRRVRFAPTAAVETPETMEQLVFAYIDARNNYNINQLLLIPCFILDFLCIHPFADGNGRISRLLSLLLLYKNGFDAGKYISFEEQINKGKASYYEALRLSSDKWHDRQNTYFPFIENFITTLLYCYKELDKRFSVVNAKNITKQERVSKTVLNSLLPISKQEVCYVLPDVSPTTVEYVLANMVKNGVIEKLGVGKNTKYIKVEKNAAYLDMIDRSMGQLAKGQGTEHELIKKPQTKNPG
Sample Types
Isolate
9.2%
Metagenome
90.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.2%
Unclassified
36.0%
Kalotermitidae
15.1%
Termopsidae
4.7%
Rhinotermitidae
3.5%
Passalidae
2.3%
Hodotermitidae
1.2%
Taxonomy
Archaea
10
Bacteria
264
Eukaryota
0
Viruses
0
Unclassified
42
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 2 | 2820350530 | Unclassified Firmicutes Nt197P3bin37 | Isolate | Unclassified |
| 3 | 2820551407 | Unclassified Firmicutes Emb289P4bin38 | Isolate | Unclassified |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2791354849 | Unclassified Chloroflexi Lab288P3bin29 | Isolate | Unclassified |
| 15 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 16 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 17 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 18 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 27 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 28 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2820833147 | Unclassified Actinobacteria Lab288P4bin85 | Isolate | Unclassified |
| 31 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 32 | 2791354848 | Unclassified Chloroflexi Emb289P3bin155 | Isolate | Unclassified |
| 33 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 36 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 37 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 40 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 41 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 43 | 2820294436 | Unclassified Firmicutes Th196P3bin104 | Isolate | Unclassified |
| 44 | 2820451402 | Unclassified Firmicutes Lab288P3bin174 | Isolate | Unclassified |
| 45 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 46 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 47 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 48 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 49 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 50 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 51 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 52 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 53 | 2820340373 | Unclassified Firmicutes Nt197P3bin67 | Isolate | Unclassified |
| 54 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 55 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 56 | 2820005795 | Unclassified Synergistetes Nt197P3bin106 | Isolate | Unclassified |
| 57 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 58 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 59 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 60 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 61 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 62 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 63 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 64 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 65 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 66 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 67 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 68 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 69 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 70 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 71 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 72 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 73 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 74 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 75 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 76 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 77 | 2820062699 | Unclassified Proteobacteria Nt197P4bin15 | Isolate | Unclassified |
| 78 | 2820292184 | Unclassified Firmicutes Th196P3bin109 | Isolate | Unclassified |
| 79 | 2820323050 | Unclassified Firmicutes Nt197P3bin84 | Isolate | Unclassified |
| 80 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 81 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 82 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 83 | 2820711732 | Unclassified Firmicutes Co191P1bin26 | Isolate | Unclassified |
| 84 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 85 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 86 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 87 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466692_001444 | 3300042591 | Bacteria | 5977 |
| 2 | Ga0466691_201539 | 3300042593 | Bacteria | 2943 |
| 3 | Ga0466691_228454 | 3300042593 | Bacteria | 6499 |
| 4 | Ga0466696_420890 | 3300042596 | Unclassified | 1631 |
| 5 | IMNBL1DRAFT_c0004096 | 3300000062 | Bacteria | 8908 |
| 6 | Ga0466733_028402 | 3300042659 | Bacteria | 2286 |
| 7 | Ga0466705_396966 | 3300042612 | Bacteria | 9877 |
| 8 | Ga0466711_345166 | 3300042615 | Bacteria | 2418 |
| 9 | Ga0466715_370167 | 3300042616 | Bacteria | 6167 |
| 10 | Ga0466726_151797 | 3300042619 | Bacteria | 15203 |
| 11 | Ga0466729_003642 | 3300042621 | Bacteria | 1861 |
| 12 | Ga0466706_039117 | 3300042599 | Bacteria | 16453 |
| 13 | Ga0466707_348098 | 3300042601 | Bacteria | 2061 |
| 14 | Ga0466713_024497 | 3300042602 | Bacteria | 3269 |
| 15 | Ga0466714_010140 | 3300042603 | Bacteria | 2934 |
| 16 | Ga0466703_265419 | 3300042636 | Bacteria | 9636 |
| 17 | Ga0466704_591736 | 3300042643 | Bacteria | 1509 |
| 18 | Ga0466727_193120 | 3300042655 | Bacteria | 1374 |
| 19 | Ga0123357_10083879 | 3300009784 | Bacteria | 4179 |
| 20 | Ga0123356_10011323 | 3300010049 | Bacteria | 8701 |
| 21 | Ga0123356_10204205 | 3300010049 | Bacteria | 2019 |
| 22 | Ga0123353_10406832 | 3300010167 | Bacteria | 2023 |
| 23 | Ga0123354_10188358 | 3300010882 | Archaea | 2322 |
| 24 | Ga0466656_376277 | 3300042550 | Bacteria | 4317 |
| 25 | Ga0466694_159517 | 3300042594 | Bacteria | 2993 |
| 26 | Ga0466694_296783 | 3300042594 | Bacteria | 3301 |
| 27 | Ga0466694_377500 | 3300042594 | Bacteria | 5718 |
| 28 | Ga0466696_029882 | 3300042596 | Bacteria | 1453 |
| 29 | Ga0466696_405944 | 3300042596 | Bacteria | 2208 |
| 30 | IMNBL1DRAFT_c0001292 | 3300000062 | Unclassified | 18860 |
| 31 | IMNBL1DRAFT_c0029787 | 3300000062 | Bacteria | 2013 |
| 32 | JGI24698J34947_10012126 | 3300002449 | Unclassified | 4730 |
| 33 | Ga0466705_286127 | 3300042612 | Archaea | 1760 |
| 34 | Ga0466727_349514 | 3300042655 | Bacteria | 9266 |
| 35 | Ga0466733_165459 | 3300042659 | Bacteria | 3280 |
| 36 | Ga0466711_030575 | 3300042615 | Bacteria | 4540 |
| 37 | Ga0466711_438325 | 3300042615 | Bacteria | 3492 |
| 38 | Ga0466715_287747 | 3300042616 | Bacteria | 6724 |
| 39 | Ga0466715_492699 | 3300042616 | Bacteria | 1773 |
| 40 | Ga0466726_013625 | 3300042619 | Bacteria | 2296 |
| 41 | Ga0466728_044704 | 3300042620 | Bacteria | 1406 |
| 42 | Ga0466706_011603 | 3300042599 | Unclassified | 1597 |
| 43 | Ga0466706_012094 | 3300042599 | Bacteria | 88462 |
| 44 | Ga0466706_249110 | 3300042599 | Bacteria | 5973 |
| 45 | Ga0466707_286616 | 3300042601 | Unclassified | 1313 |
| 46 | Ga0466713_112292 | 3300042602 | Bacteria | 21389 |
| 47 | Ga0466717_121142 | 3300042604 | Bacteria | 3800 |
| 48 | Ga0466735_141100 | 3300042624 | Bacteria | 8902 |
| 49 | Ga0466704_135127 | 3300042643 | Bacteria | 19646 |
| 50 | Ga0466704_276493 | 3300042643 | Bacteria | 11407 |
| 51 | Ga0466704_414711 | 3300042643 | Unclassified | 1801 |
| 52 | Ga0466704_565818 | 3300042643 | Bacteria | 1014 |
| 53 | Ga0466709_120872 | 3300042648 | Bacteria | 1508 |
| 54 | Ga0123357_10108426 | 3300009784 | Bacteria | 3552 |
| 55 | Ga0123353_10202336 | 3300010167 | Bacteria | 3123 |
| 56 | Ga0123353_10224805 | 3300010167 | Bacteria | 2932 |
| 57 | Ga0123353_10535094 | 3300010167 | Bacteria | 1695 |
| 58 | Ga0123353_10699525 | 3300010167 | Bacteria | 1423 |
| 59 | Ga0123353_10792073 | 3300010167 | Bacteria | 1311 |
| 60 | Ga0123354_10325374 | 3300010882 | Unclassified | 1411 |
| 61 | Ga0466690_286779 | 3300042590 | Bacteria | 1792 |
| 62 | Ga0466696_011138 | 3300042596 | Bacteria | 2953 |
| 63 | Ga0466696_357088 | 3300042596 | Bacteria | 5431 |
| 64 | Ga0466696_500182 | 3300042596 | Bacteria | 1536 |
| 65 | AustNasuHG_c1000198 | 3300000089 | Unclassified | 19888 |
| 66 | JGI24702J35022_10068451 | 3300002462 | Bacteria | 1908 |
| 67 | JGI24702J35022_10113527 | 3300002462 | Bacteria | 1491 |
| 68 | JGI24705J35276_12228363 | 3300002504 | Bacteria | 3171 |
| 69 | Ga0072941_1306369 | 3300005201 | Bacteria | 1228 |
| 70 | Ga0466705_049866 | 3300042612 | Bacteria | 7521 |
| 71 | Ga0466705_066095 | 3300042612 | Bacteria | 47031 |
| 72 | Ga0466705_168207 | 3300042612 | Bacteria | 3251 |
| 73 | Ga0466715_272711 | 3300042616 | Bacteria | 1636 |
| 74 | Ga0466726_096010 | 3300042619 | Bacteria | 4307 |
| 75 | Ga0466726_341897 | 3300042619 | Archaea | 4937 |
| 76 | Ga0466728_086390 | 3300042620 | Bacteria | 1137 |
| 77 | Ga0466706_216427 | 3300042599 | Unclassified | 1763 |
| 78 | Ga0466700_062852 | 3300042600 | Bacteria | 1247 |
| 79 | Ga0466717_242218 | 3300042604 | Unclassified | 2526 |
| 80 | Ga0466717_263173 | 3300042604 | Bacteria | 1823 |
| 81 | Ga0466719_508374 | 3300042606 | Unclassified | 1675 |
| 82 | Ga0466722_063833 | 3300042609 | Bacteria | 45893 |
| 83 | Ga0466722_159275 | 3300042609 | Unclassified | 1277 |
| 84 | Ga0466698_177850 | 3300042610 | Bacteria | 2870 |
| 85 | Ga0466698_444768 | 3300042610 | Unclassified | 1343 |
| 86 | Ga0466731_032560 | 3300042622 | Unclassified | 1251 |
| 87 | Ga0466730_081407 | 3300042625 | Bacteria | 2594 |
| 88 | Ga0466704_268472 | 3300042643 | Bacteria | 2512 |
| 89 | Ga0123356_10022505 | 3300010049 | Bacteria | 5951 |
| 90 | Ga0123356_10303070 | 3300010049 | Unclassified | 1704 |
| 91 | Ga0123356_10389960 | 3300010049 | Unclassified | 1528 |
| 92 | Ga0123353_10004292 | 3300010167 | Bacteria | 18318 |
| 93 | Ga0123353_10182952 | 3300010167 | Bacteria | 3316 |
| 94 | Ga0123353_10269681 | 3300010167 | Bacteria | 2623 |
| 95 | Ga0123353_10368732 | 3300010167 | Bacteria | 2154 |
| 96 | Ga0123353_10437272 | 3300010167 | Bacteria | 1931 |
| 97 | Ga0123354_10014874 | 3300010882 | Unclassified | 12121 |
| 98 | Ga0123354_10067423 | 3300010882 | Bacteria | 5212 |
| 99 | Ga0123354_10083614 | 3300010882 | Bacteria | 4489 |
| 100 | Ga0415639_049723 | 3300038395 | Bacteria | 27005 |
| 101 | Ga0466690_198968 | 3300042590 | Bacteria | 28555 |
| 102 | Ga0466691_124544 | 3300042593 | Bacteria | 4843 |
| 103 | Ga0466696_417633 | 3300042596 | Archaea | 1595 |
| 104 | 2227084168 | 2225789004 | Unclassified | 1864 |
| 105 | 2227549076 | 2225789004 | Bacteria | 2877 |
| 106 | IMNBL1DRAFT_c0002351 | 3300000062 | Archaea | 13227 |
| 107 | JGI24695J34938_10016570 | 3300002450 | Bacteria | 3744 |
| 108 | JGI24699J35502_11118289 | 3300002509 | Bacteria | 3086 |
| 109 | Ga0072941_1002561 | 3300005201 | Bacteria | 10570 |
| 110 | Ga0466705_196013 | 3300042612 | Bacteria | 2302 |
| 111 | Ga0466711_407612 | 3300042615 | Bacteria | 1589 |
| 112 | Ga0466711_472882 | 3300042615 | Bacteria | 6753 |
| 113 | Ga0466715_265066 | 3300042616 | Bacteria | 3429 |
| 114 | Ga0466715_328430 | 3300042616 | Bacteria | 54891 |
| 115 | Ga0466715_371409 | 3300042616 | Bacteria | 1797 |
| 116 | Ga0466723_094145 | 3300042618 | Bacteria | 29065 |
| 117 | Ga0466723_146364 | 3300042618 | Bacteria | 9749 |
| 118 | Ga0466723_173229 | 3300042618 | Unclassified | 1484 |
| 119 | Ga0466726_088803 | 3300042619 | Bacteria | 3303 |
| 120 | Ga0466729_067708 | 3300042621 | Unclassified | 1715 |
| 121 | Ga0466706_212250 | 3300042599 | Bacteria | 9958 |
| 122 | Ga0466700_414931 | 3300042600 | Bacteria | 1336 |
| 123 | Ga0466707_333106 | 3300042601 | Bacteria | 18593 |
| 124 | Ga0466714_043915 | 3300042603 | Unclassified | 2012 |
| 125 | Ga0466717_067716 | 3300042604 | Bacteria | 1765 |
| 126 | Ga0466717_169993 | 3300042604 | Bacteria | 10470 |
| 127 | Ga0466719_061728 | 3300042606 | Bacteria | 8366 |
| 128 | Ga0466719_522398 | 3300042606 | Bacteria | 6470 |
| 129 | Ga0466722_226209 | 3300042609 | Bacteria | 3161 |
| 130 | Ga0466734_020414 | 3300042623 | Bacteria | 8289 |
| 131 | Ga0466727_060954 | 3300042655 | Bacteria | 21316 |
| 132 | Ga0123356_10000551 | 3300010049 | Bacteria | 41529 |
| 133 | Ga0123353_10001663 | 3300010167 | Bacteria | 27345 |
| 134 | Ga0123353_10004502 | 3300010167 | Bacteria | 17951 |
| 135 | Ga0123353_10009149 | 3300010167 | Bacteria | 13626 |
| 136 | Ga0123353_10027569 | 3300010167 | Bacteria | 8708 |
| 137 | Ga0123353_10119592 | 3300010167 | Bacteria | 4237 |
| 138 | Ga0123353_10213651 | 3300010167 | Bacteria | 3023 |
| 139 | Ga0123353_10220550 | 3300010167 | Bacteria | 2965 |
| 140 | Ga0415639_155036 | 3300038395 | Unclassified | 1493 |
| 141 | Ga0466690_055136 | 3300042590 | Bacteria | 1770 |
| 142 | Ga0466693_006265 | 3300042592 | Archaea | 2269 |
| 143 | Ga0466694_196881 | 3300042594 | Bacteria | 4202 |
| 144 | Ga0466696_092574 | 3300042596 | Bacteria | 4220 |
| 145 | Ga0466696_096883 | 3300042596 | Bacteria | 16236 |
| 146 | 2227275223 | 2225789004 | Archaea | 30643 |
| 147 | 2227275238 | 2225789004 | Archaea | 30130 |
| 148 | 2227526576 | 2225789004 | Unclassified | 3232 |
| 149 | JGI24695J34938_10001595 | 3300002450 | Bacteria | 19076 |
| 150 | JGI24702J35022_10083705 | 3300002462 | Bacteria | 1730 |
| 151 | JGI24705J35276_12229596 | 3300002504 | Bacteria | 3421 |
| 152 | Ga0068305_10179180 | 3300005083 | Bacteria | 3234 |
| 153 | Ga0072940_1015778 | 3300005200 | Bacteria | 4085 |
| 154 | Ga0466705_296713 | 3300042612 | Bacteria | 5652 |
| 155 | Ga0466705_405064 | 3300042612 | Bacteria | 1867 |
| 156 | Ga0466711_391444 | 3300042615 | Bacteria | 11416 |
| 157 | Ga0466715_337553 | 3300042616 | Bacteria | 1859 |
| 158 | Ga0466718_061034 | 3300042617 | Bacteria | 2559 |
| 159 | Ga0466706_179047 | 3300042599 | Unclassified | 1153 |
| 160 | Ga0466707_204800 | 3300042601 | Bacteria | 1505 |
| 161 | Ga0466717_170357 | 3300042604 | Unclassified | 1083 |
| 162 | Ga0466719_483975 | 3300042606 | Bacteria | 2284 |
| 163 | Ga0466704_082775 | 3300042643 | Bacteria | 14516 |
| 164 | Ga0466709_416292 | 3300042648 | Bacteria | 2176 |
| 165 | Ga0466725_304050 | 3300042654 | Unclassified | 1355 |
| 166 | Ga0466727_073280 | 3300042655 | Bacteria | 3029 |
| 167 | Ga0123356_10081295 | 3300010049 | Unclassified | 3065 |
| 168 | Ga0123356_10112050 | 3300010049 | Bacteria | 2637 |
| 169 | Ga0123356_10189353 | 3300010049 | Bacteria | 2087 |
| 170 | Ga0123356_10497895 | 3300010049 | Bacteria | 1374 |
| 171 | Ga0123353_10000885 | 3300010167 | Bacteria | 36552 |
| 172 | Ga0123353_10069953 | 3300010167 | Bacteria | 5638 |
| 173 | Ga0123353_10111956 | 3300010167 | Bacteria | 4396 |
| 174 | Ga0123353_10133158 | 3300010167 | Bacteria | 3988 |
| 175 | Ga0123353_10227243 | 3300010167 | Bacteria | 2913 |
| 176 | Ga0123354_10117638 | 3300010882 | Bacteria | 3458 |
| 177 | Ga0466690_228318 | 3300042590 | Bacteria | 2679 |
| 178 | Ga0466694_138873 | 3300042594 | Bacteria | 2404 |
| 179 | Ga0466694_247834 | 3300042594 | Bacteria | 4342 |
| 180 | Ga0466694_249369 | 3300042594 | Bacteria | 5206 |
| 181 | Ga0466696_347803 | 3300042596 | Bacteria | 1965 |
| 182 | JGI24702J35022_10001908 | 3300002462 | Bacteria | 12834 |
| 183 | JGI24702J35022_10012810 | 3300002462 | Bacteria | 4653 |
| 184 | JGI24696J40584_12936349 | 3300002834 | Bacteria | 1578 |
| 185 | Ga0072941_1054042 | 3300005201 | Bacteria | 4873 |
| 186 | Ga0466705_120302 | 3300042612 | Bacteria | 5971 |
| 187 | Ga0466733_098123 | 3300042659 | Archaea | 1245 |
| 188 | Ga0466718_081358 | 3300042617 | Bacteria | 1584 |
| 189 | Ga0466723_107173 | 3300042618 | Bacteria | 3127 |
| 190 | Ga0466728_120343 | 3300042620 | Bacteria | 2575 |
| 191 | Ga0466701_056526 | 3300042598 | Bacteria | 1577 |
| 192 | Ga0466706_156916 | 3300042599 | Unclassified | 29703 |
| 193 | Ga0466700_253472 | 3300042600 | Bacteria | 1249 |
| 194 | Ga0466707_132462 | 3300042601 | Unclassified | 1296 |
| 195 | Ga0466707_265827 | 3300042601 | Bacteria | 2237 |
| 196 | Ga0466717_022545 | 3300042604 | Bacteria | 2197 |
| 197 | Ga0466716_527268 | 3300042605 | Bacteria | 4258 |
| 198 | Ga0466719_166029 | 3300042606 | Unclassified | 1639 |
| 199 | Ga0466721_031356 | 3300042608 | Bacteria | 1091 |
| 200 | Ga0466722_200398 | 3300042609 | Unclassified | 1228 |
| 201 | Ga0466730_091920 | 3300042625 | Bacteria | 3872 |
| 202 | Ga0466704_401520 | 3300042643 | Bacteria | 28205 |
| 203 | Ga0123356_10000481 | 3300010049 | Bacteria | 44645 |
| 204 | Ga0123356_10058949 | 3300010049 | Bacteria | 3581 |
| 205 | Ga0123356_10109334 | 3300010049 | Bacteria | 2667 |
| 206 | Ga0123356_10132822 | 3300010049 | Bacteria | 2442 |
| 207 | Ga0123356_10205258 | 3300010049 | Unclassified | 2014 |
| 208 | Ga0123356_10521273 | 3300010049 | Bacteria | 1347 |
| 209 | Ga0123353_10000139 | 3300010167 | Bacteria | 88446 |
| 210 | Ga0123353_10000735 | 3300010167 | Bacteria | 39980 |
| 211 | Ga0123353_10161796 | 3300010167 | Bacteria | 3563 |
| 212 | Ga0123353_10257095 | 3300010167 | Bacteria | 2701 |
| 213 | Ga0123354_10036578 | 3300010882 | Bacteria | 7656 |
| 214 | Ga0123354_10130613 | 3300010882 | Bacteria | 3175 |
| 215 | Ga0466696_109836 | 3300042596 | Bacteria | 40581 |
| 216 | Ga0466696_256699 | 3300042596 | Bacteria | 2347 |
| 217 | 2227474340 | 2225789004 | Unclassified | 4725 |
| 218 | JGI24702J35022_10001843 | 3300002462 | Bacteria | 13052 |
| 219 | JGI24702J35022_10024169 | 3300002462 | Bacteria | 3283 |
| 220 | JGI24703J35330_11658658 | 3300002501 | Bacteria | 1643 |
| 221 | Ga0068302_10013988 | 3300005071 | Bacteria | 12980 |
| 222 | Ga0072941_1044471 | 3300005201 | Bacteria | 3368 |
| 223 | Ga0123357_10001920 | 3300009784 | Bacteria | 22638 |
| 224 | Ga0466705_194785 | 3300042612 | Bacteria | 63063 |
| 225 | Ga0466733_036096 | 3300042659 | Bacteria | 1769 |
| 226 | Ga0466711_144972 | 3300042615 | Bacteria | 1430 |
| 227 | Ga0466715_558880 | 3300042616 | Bacteria | 1462 |
| 228 | Ga0466718_023218 | 3300042617 | Bacteria | 1827 |
| 229 | Ga0466723_019426 | 3300042618 | Unclassified | 5775 |
| 230 | Ga0466723_087062 | 3300042618 | Archaea | 1861 |
| 231 | Ga0466726_098929 | 3300042619 | Bacteria | 23282 |
| 232 | Ga0466726_205193 | 3300042619 | Bacteria | 25199 |
| 233 | Ga0466726_313069 | 3300042619 | Bacteria | 6608 |
| 234 | Ga0466707_042536 | 3300042601 | Bacteria | 80410 |
| 235 | Ga0466713_053166 | 3300042602 | Bacteria | 22730 |
| 236 | Ga0466714_084283 | 3300042603 | Unclassified | 2533 |
| 237 | Ga0466714_097937 | 3300042603 | Bacteria | 5164 |
| 238 | Ga0466731_335015 | 3300042622 | Bacteria | 1331 |
| 239 | Ga0466703_193177 | 3300042636 | Bacteria | 4420 |
| 240 | Ga0466703_222655 | 3300042636 | Unclassified | 2181 |
| 241 | Ga0466704_027720 | 3300042643 | Bacteria | 5962 |
| 242 | Ga0466704_475956 | 3300042643 | Bacteria | 2886 |
| 243 | Ga0466704_509207 | 3300042643 | Bacteria | 7719 |
| 244 | Ga0123357_10187993 | 3300009784 | Bacteria | 2390 |
| 245 | Ga0123356_10030208 | 3300010049 | Bacteria | 5071 |
| 246 | Ga0123356_10040884 | 3300010049 | Unclassified | 4319 |
| 247 | Ga0123356_10099102 | 3300010049 | Bacteria | 2792 |
| 248 | Ga0123356_10188834 | 3300010049 | Unclassified | 2089 |
| 249 | Ga0123353_10076895 | 3300010167 | Bacteria | 5363 |
| 250 | Ga0123353_10420640 | 3300010167 | Bacteria | 1980 |
| 251 | Ga0123353_10485175 | 3300010167 | Unclassified | 1807 |
| 252 | Ga0123353_10809968 | 3300010167 | Bacteria | 1291 |
| 253 | Ga0123354_10184133 | 3300010882 | Bacteria | 2370 |
| 254 | Ga0466691_205153 | 3300042593 | Bacteria | 3979 |
| 255 | Ga0466696_174618 | 3300042596 | Bacteria | 5355 |
| 256 | JGI24702J35022_10015754 | 3300002462 | Bacteria | 4153 |
| 257 | Ga0072941_1033316 | 3300005201 | Bacteria | 10609 |
| 258 | Ga0466705_026119 | 3300042612 | Bacteria | 2336 |
| 259 | Ga0466705_062222 | 3300042612 | Bacteria | 5911 |
| 260 | Ga0466705_070788 | 3300042612 | Bacteria | 3178 |
| 261 | Ga0466733_008948 | 3300042659 | Bacteria | 7914 |
| 262 | Ga0466705_474074 | 3300042612 | Bacteria | 1591 |
| 263 | Ga0466712_089928 | 3300042614 | Bacteria | 37345 |
| 264 | Ga0466711_015525 | 3300042615 | Bacteria | 2535 |
| 265 | Ga0466715_009964 | 3300042616 | Bacteria | 1800 |
| 266 | Ga0466715_438175 | 3300042616 | Bacteria | 38299 |
| 267 | Ga0466715_524256 | 3300042616 | Bacteria | 4443 |
| 268 | Ga0466723_198543 | 3300042618 | Bacteria | 1350 |
| 269 | Ga0466723_357537 | 3300042618 | Bacteria | 2955 |
| 270 | Ga0466701_030032 | 3300042598 | Bacteria | 1411 |
| 271 | Ga0466706_020379 | 3300042599 | Bacteria | 23632 |
| 272 | Ga0466706_104196 | 3300042599 | Bacteria | 6878 |
| 273 | Ga0466706_255146 | 3300042599 | Bacteria | 69704 |
| 274 | Ga0466700_147295 | 3300042600 | Bacteria | 1469 |
| 275 | Ga0466707_073120 | 3300042601 | Bacteria | 3792 |
| 276 | Ga0466714_057224 | 3300042603 | Unclassified | 1388 |
| 277 | Ga0466735_202528 | 3300042624 | Unclassified | 1397 |
| 278 | Ga0466702_088752 | 3300042635 | Bacteria | 3998 |
| 279 | Ga0466702_431244 | 3300042635 | Bacteria | 2500 |
| 280 | Ga0466709_296274 | 3300042648 | Bacteria | 4710 |
| 281 | Ga0123355_10242938 | 3300009826 | Bacteria | 2547 |
| 282 | Ga0123356_10000657 | 3300010049 | Unclassified | 38048 |
| 283 | Ga0123353_10002600 | 3300010167 | Bacteria | 22464 |
| 284 | Ga0123353_10006819 | 3300010167 | Bacteria | 15319 |
| 285 | Ga0123353_10055226 | 3300010167 | Bacteria | 6353 |
| 286 | Ga0123353_10101819 | 3300010167 | Bacteria | 4630 |
| 287 | Ga0123353_10302777 | 3300010167 | Bacteria | 2439 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02661 | Fic | Fic/DOC family | 108 | 214 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.