Protein Family IF10203
Metagenome
Metatranscriptome
Isolate
159
Members
49
Samples
149
Scaffolds
258.07
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_309291|Ga0466727_309291_510_1358
- Length
- 282 aa
- Sequence
- MNIAIIGYGKMGKIIECLALGQEHRIVAAVDPLYGKAQTLSGAPVFKTIQEIALGRSNATVGSNAVDSIDVALEFTRPDTALANIKALADARIPVVVGTTGWLDKLEEARAAVNAAGSSLLWASNFSLGVNIFYRIAFNAAILMDPFDEYDVGGFEAHHNKKADSPSGTAKTLTEGIIKRMKRKETPVYETLARPPLSGELHFPSLRLGSLPGVHSLMFDSPADTIEIRHTARGREGFASGALTAAQWLVNCPGAGQAAGSTRQGIFTMDDVLDELGVKNTK
Sample Types
Isolate
6.3%
Metagenome
93.1%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
57.4%
Unclassified
21.3%
Kalotermitidae
10.6%
Termopsidae
6.4%
Rhinotermitidae
4.3%
Taxonomy
Archaea
3
Bacteria
153
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 12 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 13 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 14 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 15 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 18 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 19 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 20 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 21 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 22 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 25 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 26 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 32 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 35 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 36 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 37 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 38 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 39 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 40 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 44 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 45 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 46 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 47 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10005342 | 3300010049 | Bacteria | 13095 |
| 2 | Ga0123356_10083095 | 3300010049 | Bacteria | 3033 |
| 3 | Ga0123356_10162351 | 3300010049 | Bacteria | 2234 |
| 4 | Ga0123353_10478478 | 3300010167 | Bacteria | 1823 |
| 5 | Ga0123353_11640390 | 3300010167 | Archaea | 809 |
| 6 | Ga0466692_040761 | 3300042591 | Bacteria | 3592 |
| 7 | Ga0466692_057365 | 3300042591 | Bacteria | 7395 |
| 8 | Ga0466694_039131 | 3300042594 | Bacteria | 11291 |
| 9 | Ga0466699_003010 | 3300042597 | Bacteria | 6136 |
| 10 | Ga0466699_087890 | 3300042597 | Unclassified | 1133 |
| 11 | Ga0466699_126948 | 3300042597 | Bacteria | 1107 |
| 12 | Ga0466712_314406 | 3300042614 | Bacteria | 4680 |
| 13 | Ga0466718_077961 | 3300042617 | Bacteria | 2586 |
| 14 | Ga0466718_081719 | 3300042617 | Bacteria | 8245 |
| 15 | Ga0466718_090790 | 3300042617 | Bacteria | 3612 |
| 16 | Ga0466718_122832 | 3300042617 | Bacteria | 1662 |
| 17 | Ga0466726_490200 | 3300042619 | Bacteria | 14288 |
| 18 | Ga0466700_122245 | 3300042600 | Bacteria | 1405 |
| 19 | Ga0466720_184298 | 3300042607 | Bacteria | 1783 |
| 20 | AustNasuHG_c1002690 | 3300000089 | Bacteria | 6409 |
| 21 | AustNasuHG_c1018136 | 3300000089 | Bacteria | 2328 |
| 22 | JGI24698J34947_10001581 | 3300002449 | Bacteria | 12069 |
| 23 | JGI24698J34947_10017287 | 3300002449 | Bacteria | 3910 |
| 24 | JGI24695J34938_10053063 | 3300002450 | Bacteria | 1765 |
| 25 | Ga0072941_1028792 | 3300005201 | Bacteria | 8390 |
| 26 | Ga0466731_098209 | 3300042622 | Bacteria | 1199 |
| 27 | Ga0415639_166454 | 3300038395 | Bacteria | 1595 |
| 28 | Ga0466657_092591 | 3300042582 | Bacteria | 1306 |
| 29 | Ga0466694_095867 | 3300042594 | Bacteria | 7046 |
| 30 | Ga0466699_336638 | 3300042597 | Bacteria | 2295 |
| 31 | Ga0466712_237055 | 3300042614 | Bacteria | 8126 |
| 32 | Ga0466712_256048 | 3300042614 | Bacteria | 11462 |
| 33 | Ga0466715_244638 | 3300042616 | Bacteria | 13867 |
| 34 | Ga0466718_077900 | 3300042617 | Bacteria | 2700 |
| 35 | Ga0466718_132213 | 3300042617 | Bacteria | 1668 |
| 36 | Ga0466720_125409 | 3300042607 | Bacteria | 17575 |
| 37 | Ga0466720_134527 | 3300042607 | Bacteria | 1636 |
| 38 | JGI24698J34947_10033098 | 3300002449 | Bacteria | 2712 |
| 39 | Ga0072941_1008455 | 3300005201 | Unclassified | 8180 |
| 40 | Ga0074263_106538 | 3300005485 | Bacteria | 7302 |
| 41 | Ga0123356_10001153 | 3300010049 | Bacteria | 29214 |
| 42 | Ga0123356_10004991 | 3300010049 | Bacteria | 13608 |
| 43 | Ga0123356_10104769 | 3300010049 | Bacteria | 2720 |
| 44 | Ga0123356_10240241 | 3300010049 | Bacteria | 1882 |
| 45 | Ga0466731_406873 | 3300042622 | Bacteria | 1087 |
| 46 | Ga0466702_152125 | 3300042635 | Bacteria | 8512 |
| 47 | Ga0466702_250488 | 3300042635 | Bacteria | 1101 |
| 48 | Ga0466702_371805 | 3300042635 | Bacteria | 1371 |
| 49 | Ga0456237_0003135 | 3300041968 | Bacteria | 2687 |
| 50 | Ga0466712_220592 | 3300042614 | Bacteria | 1810 |
| 51 | Ga0466715_646645 | 3300042616 | Bacteria | 16949 |
| 52 | Ga0466718_005589 | 3300042617 | Bacteria | 8001 |
| 53 | Ga0466720_000184 | 3300042607 | Bacteria | 5114 |
| 54 | Ga0466720_037399 | 3300042607 | Bacteria | 4743 |
| 55 | Ga0466720_055247 | 3300042607 | Bacteria | 8806 |
| 56 | Ga0466720_204548 | 3300042607 | Bacteria | 5176 |
| 57 | Ga0466698_195093 | 3300042610 | Bacteria | 7942 |
| 58 | AustNasuHG_c1000283 | 3300000089 | Bacteria | 17536 |
| 59 | JGI24695J34938_10012307 | 3300002450 | Bacteria | 4543 |
| 60 | JGI24695J34938_10024663 | 3300002450 | Bacteria | 2885 |
| 61 | JGI24695J34938_10039166 | 3300002450 | Bacteria | 2143 |
| 62 | Ga0072940_1011464 | 3300005200 | Bacteria | 16664 |
| 63 | Ga0123356_10000020 | 3300010049 | Bacteria | 177064 |
| 64 | Ga0123356_10000309 | 3300010049 | Bacteria | 55893 |
| 65 | Ga0123353_10601673 | 3300010167 | Bacteria | 1571 |
| 66 | Ga0466704_030655 | 3300042643 | Bacteria | 5927 |
| 67 | Ga0466727_127637 | 3300042655 | Bacteria | 1173 |
| 68 | Ga0264413_113389 | 3300024493 | Bacteria | 3338 |
| 69 | Ga0415639_076218 | 3300038395 | Bacteria | 3716 |
| 70 | Ga0466691_011938 | 3300042593 | Bacteria | 24022 |
| 71 | Ga0466691_023784 | 3300042593 | Bacteria | 15484 |
| 72 | Ga0466694_023234 | 3300042594 | Bacteria | 1880 |
| 73 | Ga0466694_158574 | 3300042594 | Bacteria | 1005 |
| 74 | Ga0466699_051261 | 3300042597 | Bacteria | 1118 |
| 75 | Ga0466699_292901 | 3300042597 | Bacteria | 1620 |
| 76 | Ga0466721_005171 | 3300042608 | Bacteria | 2015 |
| 77 | AustNasuHG_c1005660 | 3300000089 | Bacteria | 4472 |
| 78 | JGI24695J34938_10004008 | 3300002450 | Bacteria | 9911 |
| 79 | JGI24695J34938_10012891 | 3300002450 | Bacteria | 4410 |
| 80 | JGI24695J34938_10019736 | 3300002450 | Bacteria | 3331 |
| 81 | Ga0072941_1187101 | 3300005201 | Bacteria | 1668 |
| 82 | Ga0123355_10012727 | 3300009826 | Bacteria | 13044 |
| 83 | Ga0123356_10046807 | 3300010049 | Bacteria | 4025 |
| 84 | Ga0466727_309291 | 3300042655 | Bacteria | 2915 |
| 85 | Ga0264413_105377 | 3300024493 | Bacteria | 16111 |
| 86 | Ga0466712_022351 | 3300042614 | Bacteria | 12522 |
| 87 | Ga0466712_043338 | 3300042614 | Bacteria | 16062 |
| 88 | Ga0466712_048199 | 3300042614 | Bacteria | 9394 |
| 89 | Ga0466712_078232 | 3300042614 | Bacteria | 13492 |
| 90 | Ga0466712_275466 | 3300042614 | Bacteria | 8397 |
| 91 | Ga0466712_303680 | 3300042614 | Unclassified | 5555 |
| 92 | Ga0466718_033289 | 3300042617 | Bacteria | 1889 |
| 93 | Ga0466700_213093 | 3300042600 | Bacteria | 1138 |
| 94 | Ga0466714_087548 | 3300042603 | Bacteria | 2982 |
| 95 | Ga0466720_026851 | 3300042607 | Bacteria | 4410 |
| 96 | Ga0466720_118064 | 3300042607 | Bacteria | 7590 |
| 97 | Ga0466720_130243 | 3300042607 | Bacteria | 3754 |
| 98 | AustNasuHG_c1016891 | 3300000089 | Bacteria | 2435 |
| 99 | JGI24698J34947_10002803 | 3300002449 | Bacteria | 9448 |
| 100 | JGI24695J34938_10007211 | 3300002450 | Bacteria | 6550 |
| 101 | JGI24702J35022_10014877 | 3300002462 | Bacteria | 4286 |
| 102 | Ga0466702_173096 | 3300042635 | Bacteria | 10034 |
| 103 | Ga0466727_032110 | 3300042655 | Archaea | 2693 |
| 104 | Ga0466712_044599 | 3300042614 | Bacteria | 16671 |
| 105 | Ga0466712_086270 | 3300042614 | Bacteria | 15074 |
| 106 | Ga0466711_245391 | 3300042615 | Bacteria | 1187 |
| 107 | Ga0466718_008577 | 3300042617 | Bacteria | 1209 |
| 108 | Ga0466718_011967 | 3300042617 | Bacteria | 3320 |
| 109 | Ga0466718_062213 | 3300042617 | Bacteria | 5749 |
| 110 | Ga0466716_335953 | 3300042605 | Bacteria | 2097 |
| 111 | Ga0466720_114857 | 3300042607 | Bacteria | 1570 |
| 112 | JGI24698J34947_10004545 | 3300002449 | Bacteria | 7558 |
| 113 | JGI24698J34947_10045742 | 3300002449 | Bacteria | 2231 |
| 114 | JGI24698J34947_10058462 | 3300002449 | Bacteria | 1909 |
| 115 | Ga0068302_10247467 | 3300005071 | Bacteria | 2084 |
| 116 | Ga0123356_10337678 | 3300010049 | Bacteria | 1626 |
| 117 | Ga0466702_040529 | 3300042635 | Bacteria | 1487 |
| 118 | Ga0466702_249725 | 3300042635 | Bacteria | 2363 |
| 119 | Ga0255786_1001461 | 3300022815 | Bacteria | 2228 |
| 120 | Ga0264413_105378 | 3300024493 | Bacteria | 3409 |
| 121 | Ga0415639_004195 | 3300038395 | Bacteria | 8584 |
| 122 | Ga0415639_045661 | 3300038395 | Bacteria | 19047 |
| 123 | Ga0466694_185074 | 3300042594 | Bacteria | 6719 |
| 124 | Ga0466694_207451 | 3300042594 | Bacteria | 3406 |
| 125 | Ga0466718_163214 | 3300042617 | Bacteria | 9591 |
| 126 | Ga0466726_282543 | 3300042619 | Bacteria | 1101 |
| 127 | 2230954184 | 2228664003 | Bacteria | 30208 |
| 128 | AustNasuHG_c1000763 | 3300000089 | Bacteria | 11473 |
| 129 | AustNasuHG_c1016240 | 3300000089 | Bacteria | 2494 |
| 130 | JGI24698J34947_10003806 | 3300002449 | Bacteria | 8220 |
| 131 | Ga0072940_1023023 | 3300005200 | Bacteria | 3882 |
| 132 | Ga0466732_236591 | 3300042656 | Bacteria | 4239 |
| 133 | Ga0123356_10005080 | 3300010049 | Bacteria | 13494 |
| 134 | Ga0123356_10008189 | 3300010049 | Bacteria | 10402 |
| 135 | Ga0123356_10801249 | 3300010049 | Bacteria | 1113 |
| 136 | Ga0466731_278541 | 3300042622 | Bacteria | 2380 |
| 137 | Ga0466727_203175 | 3300042655 | Bacteria | 1313 |
| 138 | Ga0466727_301170 | 3300042655 | Bacteria | 1634 |
| 139 | Ga0466693_246891 | 3300042592 | Bacteria | 3203 |
| 140 | Ga0466694_138968 | 3300042594 | Archaea | 1910 |
| 141 | Ga0466695_068957 | 3300042595 | Bacteria | 62949 |
| 142 | Ga0466699_101520 | 3300042597 | Bacteria | 1475 |
| 143 | Ga0466699_413904 | 3300042597 | Bacteria | 18269 |
| 144 | Ga0466718_069155 | 3300042617 | Bacteria | 4441 |
| 145 | Ga0466718_157275 | 3300042617 | Bacteria | 1050 |
| 146 | Ga0466700_456237 | 3300042600 | Bacteria | 1382 |
| 147 | Ga0466698_005027 | 3300042610 | Bacteria | 1194 |
| 148 | JGI24698J34947_10003210 | 3300002449 | Bacteria | 8860 |
| 149 | JGI24698J34947_10011085 | 3300002449 | Bacteria | 4946 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.