Protein Family IF10165
Metagenome
Isolate
315
Members
106
Samples
268
Scaffolds
221.96
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_202853|Ga0466727_202853_1303_2112
- Length
- 269 aa
- Sequence
- MPAIPDPITKKSNLCIITQKINEIQECKVTKKILHLYFQTGTYSFYFKMIDVKIEQSWKERLTPEFAKPYFKTLTDFIKQEYATTCIYPKGSLIFNAFDKTTFDAVKVVILGQDPYHEPGQAHGLCFSVNDGVALPPSLLNIYKEMQDDLGIPLRTSGNLSHWAEQGVLLLNATLTVKAHHAGSHQNKGWEEFTDAVIHKIAEEKEHVVFILWGSYAQKKGAFIDPFRHLVLKSPHPSPLSVYRGFFGSRPFSKANRYLEQNGQTPIHW
Sample Types
Isolate
14.9%
Metagenome
85.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
28.6%
Unclassified
23.8%
Kalotermitidae
13.3%
Apidae
10.5%
Halictidae
8.6%
Blattidae
3.8%
Termopsidae
3.8%
Rhinotermitidae
2.9%
Passalidae
1.9%
Hodotermitidae
1.0%
Carabidae
1.0%
Tenebrionidae
1.0%
Taxonomy
Archaea
0
Bacteria
308
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 2 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 3 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 4 | 2820741847 | Unclassified Bacteroidetes Th196P3bin71 | Isolate | Unclassified |
| 5 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 8 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 9 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 12 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 13 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 14 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 17 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 20 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 21 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 24 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 29 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 34 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 37 | 2820288918 | Unclassified Firmicutes Th196P3bin137 | Isolate | Unclassified |
| 38 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 39 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 40 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 41 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 42 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 43 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 44 | 2989426036 | Spiroplasma platyhelix PALS-1 | Isolate | Unclassified |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 49 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 50 | 2820453354 | Unclassified Firmicutes Lab288P3bin172 | Isolate | Unclassified |
| 51 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 52 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 53 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 54 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 55 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 56 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 57 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 58 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 59 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 60 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 61 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 62 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 63 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 64 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 65 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 66 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 67 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 68 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 69 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 70 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 71 | 2675903377 | Apilactobacillus kunkeei AR114 | Isolate | Unclassified |
| 72 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 73 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 74 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 75 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 76 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 77 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 78 | 8118997823 | Spiroplasma platyhelix PALS-1 | Isolate | Unclassified |
| 79 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 80 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 81 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 82 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 83 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 84 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 85 | 8002448939 | Spiroplasma endosymbiont of 'Nebria riversi' Nriv7 | Isolate | Carabidae |
| 86 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 87 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 88 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 89 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 90 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 91 | 2820319488 | Unclassified Firmicutes Nt197P3bin88 | Isolate | Unclassified |
| 92 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 93 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 94 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 95 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 96 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 97 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 98 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 99 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 100 | 2877522083 | Apilactobacillus bombintestini BHWM-4 | Isolate | Apidae |
| 101 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 102 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 103 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 104 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 105 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 106 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 2 | Ga0415639_084336 | 3300038395 | Unclassified | 3481 |
| 3 | Ga0466657_324936 | 3300042582 | Bacteria | 1819 |
| 4 | Ga0466695_048459 | 3300042595 | Bacteria | 1475 |
| 5 | Ga0466696_371711 | 3300042596 | Bacteria | 3994 |
| 6 | Ga0466696_380924 | 3300042596 | Bacteria | 2053 |
| 7 | Ga0466706_211978 | 3300042599 | Bacteria | 2218 |
| 8 | Ga0466700_398767 | 3300042600 | Bacteria | 3987 |
| 9 | Ga0466707_007269 | 3300042601 | Bacteria | 2092 |
| 10 | Ga0466707_043479 | 3300042601 | Bacteria | 15448 |
| 11 | Ga0466707_194608 | 3300042601 | Bacteria | 2798 |
| 12 | Ga0466707_399872 | 3300042601 | Bacteria | 25092 |
| 13 | Ga0466707_402583 | 3300042601 | Bacteria | 1072 |
| 14 | Ga0466716_203050 | 3300042605 | Bacteria | 4143 |
| 15 | Ga0466716_543224 | 3300042605 | Bacteria | 1988 |
| 16 | Ga0466719_094709 | 3300042606 | Bacteria | 5719 |
| 17 | Ga0466698_190750 | 3300042610 | Bacteria | 1259 |
| 18 | Ga0466735_073069 | 3300042624 | Bacteria | 2189 |
| 19 | Ga0466735_203802 | 3300042624 | Bacteria | 1471 |
| 20 | Ga0466702_034739 | 3300042635 | Bacteria | 3361 |
| 21 | Ga0466703_034294 | 3300042636 | Bacteria | 2344 |
| 22 | Ga0466727_253174 | 3300042655 | Bacteria | 42635 |
| 23 | Ga0466712_125365 | 3300042614 | Bacteria | 2135 |
| 24 | Ga0466715_646020 | 3300042616 | Bacteria | 3893 |
| 25 | Ga0123356_11257443 | 3300010049 | Bacteria | 905 |
| 26 | Ga0123353_10068406 | 3300010167 | Bacteria | 5703 |
| 27 | Ga0123353_10083267 | 3300010167 | Bacteria | 5147 |
| 28 | Ga0123354_10155423 | 3300010882 | Bacteria | 2747 |
| 29 | 2227496861 | 2225789004 | Bacteria | 19707 |
| 30 | IMNBL1DRAFT_c0000929 | 3300000062 | Bacteria | 22641 |
| 31 | IMNBL1DRAFT_c0077057 | 3300000062 | Bacteria | 944 |
| 32 | JGI24702J35022_10078077 | 3300002462 | Bacteria | 1791 |
| 33 | JGI24699J35502_11134191 | 3300002509 | Bacteria | 50084 |
| 34 | Ga0123357_10002896 | 3300009784 | Bacteria | 19337 |
| 35 | Ga0466657_389886 | 3300042582 | Bacteria | 3677 |
| 36 | Ga0466692_178451 | 3300042591 | Bacteria | 1874 |
| 37 | Ga0466691_088148 | 3300042593 | Bacteria | 9832 |
| 38 | Ga0466701_080595 | 3300042598 | Bacteria | 4940 |
| 39 | Ga0466706_053899 | 3300042599 | Bacteria | 3547 |
| 40 | Ga0466713_044517 | 3300042602 | Bacteria | 6012 |
| 41 | Ga0466713_119564 | 3300042602 | Unclassified | 4427 |
| 42 | Ga0466713_139999 | 3300042602 | Bacteria | 4655 |
| 43 | Ga0466719_391527 | 3300042606 | Bacteria | 7511 |
| 44 | Ga0466729_242755 | 3300042621 | Bacteria | 78927 |
| 45 | Ga0466735_008272 | 3300042624 | Bacteria | 10144 |
| 46 | Ga0466735_013639 | 3300042624 | Bacteria | 2593 |
| 47 | Ga0466735_073966 | 3300042624 | Bacteria | 12662 |
| 48 | Ga0466709_130410 | 3300042648 | Bacteria | 4761 |
| 49 | Ga0466727_228459 | 3300042655 | Bacteria | 3317 |
| 50 | Ga0466711_001227 | 3300042615 | Bacteria | 8655 |
| 51 | Ga0466711_171422 | 3300042615 | Bacteria | 12098 |
| 52 | Ga0466723_226672 | 3300042618 | Bacteria | 2003 |
| 53 | Ga0466726_488716 | 3300042619 | Bacteria | 1124 |
| 54 | Ga0123357_10003745 | 3300009784 | Bacteria | 17568 |
| 55 | Ga0123357_10032876 | 3300009784 | Bacteria | 7046 |
| 56 | Ga0123357_10033027 | 3300009784 | Bacteria | 7030 |
| 57 | Ga0123356_11203493 | 3300010049 | Bacteria | 924 |
| 58 | Ga0123353_10626791 | 3300010167 | Bacteria | 1529 |
| 59 | Ga0123354_10000084 | 3300010882 | Bacteria | 69544 |
| 60 | 2227108017 | 2225789004 | Bacteria | 1758 |
| 61 | IMNBL1DRAFT_c0000056 | 3300000062 | Bacteria | 106919 |
| 62 | JGI24702J35022_10002240 | 3300002462 | Bacteria | 11889 |
| 63 | Ga0123357_10000491 | 3300009784 | Bacteria | 38307 |
| 64 | Ga0123357_10000746 | 3300009784 | Bacteria | 32751 |
| 65 | Ga0466705_042187 | 3300042612 | Bacteria | 4299 |
| 66 | Ga0466692_177084 | 3300042591 | Bacteria | 11918 |
| 67 | Ga0466691_038829 | 3300042593 | Bacteria | 5536 |
| 68 | Ga0466696_014420 | 3300042596 | Bacteria | 1220 |
| 69 | Ga0466696_102682 | 3300042596 | Bacteria | 2861 |
| 70 | Ga0466696_281938 | 3300042596 | Bacteria | 34413 |
| 71 | Ga0466701_097914 | 3300042598 | Bacteria | 14792 |
| 72 | Ga0466706_017683 | 3300042599 | Bacteria | 37282 |
| 73 | Ga0466706_039889 | 3300042599 | Bacteria | 7583 |
| 74 | Ga0466706_243039 | 3300042599 | Bacteria | 118582 |
| 75 | Ga0466707_224573 | 3300042601 | Bacteria | 4834 |
| 76 | Ga0466707_295295 | 3300042601 | Bacteria | 4713 |
| 77 | Ga0466714_141473 | 3300042603 | Bacteria | 59209 |
| 78 | Ga0466714_168824 | 3300042603 | Bacteria | 7704 |
| 79 | Ga0466722_076022 | 3300042609 | Bacteria | 1302 |
| 80 | Ga0466735_049089 | 3300042624 | Bacteria | 3099 |
| 81 | Ga0466735_177006 | 3300042624 | Bacteria | 1703 |
| 82 | Ga0466703_115142 | 3300042636 | Bacteria | 17418 |
| 83 | Ga0466703_267681 | 3300042636 | Bacteria | 6963 |
| 84 | Ga0466724_16935 | 3300042649 | Bacteria | 3297 |
| 85 | Ga0466727_202853 | 3300042655 | Bacteria | 2332 |
| 86 | Ga0466729_026875 | 3300042621 | Bacteria | 1672 |
| 87 | Ga0123357_10087568 | 3300009784 | Bacteria | 4073 |
| 88 | Ga0123355_10016175 | 3300009826 | Unclassified | 11744 |
| 89 | Ga0123353_10227895 | 3300010167 | Bacteria | 2908 |
| 90 | Ga0123354_10009055 | 3300010882 | Bacteria | 15196 |
| 91 | 2227288842 | 2225789004 | Bacteria | 1245 |
| 92 | IMNBL1DRAFT_c0030165 | 3300000062 | Bacteria | 1993 |
| 93 | HBC_ctgsDRAFT_1037616 | 3300000333 | Bacteria | 1187 |
| 94 | JGI24699J35502_11134202 | 3300002509 | Bacteria | 55258 |
| 95 | Ga0068305_10017531 | 3300005083 | Bacteria | 3124 |
| 96 | Ga0466733_074247 | 3300042659 | Bacteria | 8839 |
| 97 | Ga0466690_042881 | 3300042590 | Bacteria | 19609 |
| 98 | Ga0466690_148225 | 3300042590 | Bacteria | 15696 |
| 99 | Ga0466690_297222 | 3300042590 | Bacteria | 4918 |
| 100 | Ga0466696_294514 | 3300042596 | Bacteria | 3368 |
| 101 | Ga0466706_186892 | 3300042599 | Bacteria | 3104 |
| 102 | Ga0466706_200225 | 3300042599 | Bacteria | 3301 |
| 103 | Ga0466707_099185 | 3300042601 | Bacteria | 3170 |
| 104 | Ga0466707_170139 | 3300042601 | Bacteria | 10884 |
| 105 | Ga0466707_296028 | 3300042601 | Bacteria | 30626 |
| 106 | Ga0466707_314785 | 3300042601 | Bacteria | 26551 |
| 107 | Ga0466707_325092 | 3300042601 | Bacteria | 9872 |
| 108 | Ga0466714_134258 | 3300042603 | Bacteria | 4633 |
| 109 | Ga0466717_092780 | 3300042604 | Bacteria | 1692 |
| 110 | Ga0466719_192995 | 3300042606 | Bacteria | 2116 |
| 111 | Ga0466722_166742 | 3300042609 | Bacteria | 1791 |
| 112 | Ga0466722_268146 | 3300042609 | Bacteria | 2365 |
| 113 | Ga0466734_121789 | 3300042623 | Bacteria | 2726 |
| 114 | Ga0466702_290511 | 3300042635 | Bacteria | 17039 |
| 115 | Ga0466703_048882 | 3300042636 | Bacteria | 42148 |
| 116 | Ga0466703_171692 | 3300042636 | Bacteria | 7048 |
| 117 | Ga0466704_261934 | 3300042643 | Bacteria | 8771 |
| 118 | Ga0466704_512887 | 3300042643 | Bacteria | 32913 |
| 119 | Ga0466726_381148 | 3300042619 | Bacteria | 1824 |
| 120 | Ga0466728_210749 | 3300042620 | Bacteria | 25611 |
| 121 | Ga0466729_013418 | 3300042621 | Bacteria | 1113 |
| 122 | Ga0123353_10336321 | 3300010167 | Bacteria | 2283 |
| 123 | Ga0123354_10024186 | 3300010882 | Bacteria | 9582 |
| 124 | IMNBL1DRAFT_c0005027 | 3300000062 | Bacteria | 7717 |
| 125 | HBC_ctgsDRAFT_1000052 | 3300000333 | Bacteria | 29191 |
| 126 | HBC_ctgsDRAFT_1000497 | 3300000333 | Bacteria | 8870 |
| 127 | JGI24702J35022_10129665 | 3300002462 | Bacteria | 1399 |
| 128 | JGI24696J40584_12961535 | 3300002834 | Bacteria | 20105 |
| 129 | Ga0123357_10000525 | 3300009784 | Bacteria | 37542 |
| 130 | Ga0466692_023162 | 3300042591 | Bacteria | 38737 |
| 131 | Ga0466692_038599 | 3300042591 | Bacteria | 4558 |
| 132 | Ga0466706_218860 | 3300042599 | Bacteria | 7971 |
| 133 | Ga0466707_000718 | 3300042601 | Bacteria | 17810 |
| 134 | Ga0466707_022876 | 3300042601 | Bacteria | 8602 |
| 135 | Ga0466713_124336 | 3300042602 | Bacteria | 24023 |
| 136 | Ga0466716_166137 | 3300042605 | Bacteria | 4873 |
| 137 | Ga0466735_064301 | 3300042624 | Bacteria | 1459 |
| 138 | Ga0466735_072997 | 3300042624 | Bacteria | 1723 |
| 139 | Ga0466703_303579 | 3300042636 | Bacteria | 1429 |
| 140 | Ga0466704_177008 | 3300042643 | Bacteria | 11080 |
| 141 | Ga0466709_087533 | 3300042648 | Bacteria | 39048 |
| 142 | Ga0466715_249063 | 3300042616 | Bacteria | 1340 |
| 143 | Ga0466715_503891 | 3300042616 | Bacteria | 5097 |
| 144 | Ga0466728_126285 | 3300042620 | Bacteria | 2172 |
| 145 | Ga0466728_263289 | 3300042620 | Bacteria | 1740 |
| 146 | Ga0466728_480296 | 3300042620 | Bacteria | 9723 |
| 147 | Ga0466729_167742 | 3300042621 | Bacteria | 1073 |
| 148 | Ga0123357_10183722 | 3300009784 | Bacteria | 2432 |
| 149 | Ga0123356_10032777 | 3300010049 | Bacteria | 4858 |
| 150 | Ga0123353_10841878 | 3300010167 | Bacteria | 1259 |
| 151 | Ga0123354_10001926 | 3300010882 | Bacteria | 26438 |
| 152 | Ga0123354_10324685 | 3300010882 | Bacteria | 1414 |
| 153 | IMNBL1DRAFT_c0003267 | 3300000062 | Bacteria | 10567 |
| 154 | IMNBL1DRAFT_c0014035 | 3300000062 | Bacteria | 3560 |
| 155 | HBC_ctgsDRAFT_1002268 | 3300000333 | Bacteria | 4361 |
| 156 | JGI24705J35276_11947002 | 3300002504 | Bacteria | 791 |
| 157 | Ga0466705_358714 | 3300042612 | Bacteria | 12247 |
| 158 | Ga0466733_102294 | 3300042659 | Bacteria | 17348 |
| 159 | Ga0415639_001483 | 3300038395 | Bacteria | 39507 |
| 160 | Ga0415639_027086 | 3300038395 | Bacteria | 4894 |
| 161 | Ga0466690_347379 | 3300042590 | Bacteria | 9190 |
| 162 | Ga0466691_061074 | 3300042593 | Bacteria | 26409 |
| 163 | Ga0466691_202092 | 3300042593 | Bacteria | 13525 |
| 164 | Ga0466699_396085 | 3300042597 | Bacteria | 1165 |
| 165 | Ga0466701_045246 | 3300042598 | Bacteria | 23760 |
| 166 | Ga0466706_064231 | 3300042599 | Bacteria | 49852 |
| 167 | Ga0466706_185520 | 3300042599 | Bacteria | 28937 |
| 168 | Ga0466700_204875 | 3300042600 | Bacteria | 4932 |
| 169 | Ga0466713_088520 | 3300042602 | Bacteria | 50636 |
| 170 | Ga0466713_101013 | 3300042602 | Bacteria | 25395 |
| 171 | Ga0466713_110667 | 3300042602 | Bacteria | 2619 |
| 172 | Ga0466714_081778 | 3300042603 | Bacteria | 32952 |
| 173 | Ga0466719_092717 | 3300042606 | Bacteria | 10096 |
| 174 | Ga0466722_031200 | 3300042609 | Bacteria | 18859 |
| 175 | Ga0466722_146619 | 3300042609 | Bacteria | 12363 |
| 176 | Ga0466703_015315 | 3300042636 | Bacteria | 2993 |
| 177 | Ga0466703_029176 | 3300042636 | Bacteria | 3874 |
| 178 | Ga0466703_210162 | 3300042636 | Bacteria | 7193 |
| 179 | Ga0466708_390556 | 3300042652 | Bacteria | 17223 |
| 180 | Ga0466725_427742 | 3300042654 | Bacteria | 6844 |
| 181 | Ga0466727_319615 | 3300042655 | Bacteria | 3957 |
| 182 | Ga0466723_012842 | 3300042618 | Bacteria | 35572 |
| 183 | Ga0466728_092773 | 3300042620 | Bacteria | 12032 |
| 184 | Ga0466729_149963 | 3300042621 | Bacteria | 7952 |
| 185 | Ga0466729_194423 | 3300042621 | Bacteria | 1158 |
| 186 | Ga0123356_10158812 | 3300010049 | Bacteria | 2255 |
| 187 | Ga0123353_10000331 | 3300010167 | Bacteria | 58268 |
| 188 | Ga0123354_10148418 | 3300010882 | Unclassified | 2856 |
| 189 | Ga0123354_10492109 | 3300010882 | Bacteria | 962 |
| 190 | IMNBL1DRAFT_c0001963 | 3300000062 | Bacteria | 14817 |
| 191 | JGI24699J35502_10921261 | 3300002509 | Bacteria | 1095 |
| 192 | JGI24699J35502_11133354 | 3300002509 | Bacteria | 10038 |
| 193 | JGI24699J35502_11134193 | 3300002509 | Bacteria | 50742 |
| 194 | JGI24696J40584_12940882 | 3300002834 | Bacteria | 1691 |
| 195 | Ga0068302_10106023 | 3300005071 | Bacteria | 1377 |
| 196 | Ga0072941_1343154 | 3300005201 | Bacteria | 2039 |
| 197 | Ga0072941_1408816 | 3300005201 | Bacteria | 2249 |
| 198 | Ga0466697_186481 | 3300042611 | Bacteria | 27325 |
| 199 | Ga0466732_124237 | 3300042656 | Bacteria | 16136 |
| 200 | Ga0466656_143916 | 3300042550 | Bacteria | 1023 |
| 201 | Ga0466690_371428 | 3300042590 | Bacteria | 9156 |
| 202 | Ga0466692_065218 | 3300042591 | Bacteria | 8120 |
| 203 | Ga0466696_458094 | 3300042596 | Bacteria | 2275 |
| 204 | Ga0466706_073932 | 3300042599 | Bacteria | 2256 |
| 205 | Ga0466706_198089 | 3300042599 | Bacteria | 2270 |
| 206 | Ga0466707_056939 | 3300042601 | Bacteria | 7871 |
| 207 | Ga0466713_106228 | 3300042602 | Bacteria | 1200 |
| 208 | Ga0466714_007617 | 3300042603 | Bacteria | 1549 |
| 209 | Ga0466714_021393 | 3300042603 | Bacteria | 9886 |
| 210 | Ga0466714_086279 | 3300042603 | Bacteria | 9880 |
| 211 | Ga0466734_006034 | 3300042623 | Bacteria | 1621 |
| 212 | Ga0466735_085029 | 3300042624 | Bacteria | 1335 |
| 213 | Ga0466735_125520 | 3300042624 | Bacteria | 8989 |
| 214 | Ga0466735_194464 | 3300042624 | Unclassified | 1131 |
| 215 | Ga0466703_379435 | 3300042636 | Bacteria | 1215 |
| 216 | Ga0466703_397125 | 3300042636 | Bacteria | 23459 |
| 217 | Ga0466708_016786 | 3300042652 | Bacteria | 8829 |
| 218 | Ga0466710_285710 | 3300042613 | Bacteria | 1936 |
| 219 | Ga0466711_107139 | 3300042615 | Bacteria | 2914 |
| 220 | Ga0466715_007731 | 3300042616 | Bacteria | 19165 |
| 221 | Ga0466715_032997 | 3300042616 | Bacteria | 17847 |
| 222 | Ga0466715_558255 | 3300042616 | Bacteria | 3516 |
| 223 | Ga0466728_236626 | 3300042620 | Bacteria | 13401 |
| 224 | Ga0123356_10008827 | 3300010049 | Bacteria | 9985 |
| 225 | Ga0123353_10130726 | 3300010167 | Bacteria | 4029 |
| 226 | Ga0123354_10001328 | 3300010882 | Bacteria | 29560 |
| 227 | Ga0123354_10283095 | 3300010882 | Bacteria | 1606 |
| 228 | Ga0123354_10512419 | 3300010882 | Bacteria | 927 |
| 229 | IMNBL1DRAFT_c0003857 | 3300000062 | Bacteria | 9326 |
| 230 | JGI24705J35276_12149584 | 3300002504 | Bacteria | 1177 |
| 231 | Ga0072940_1179317 | 3300005200 | Bacteria | 1629 |
| 232 | Ga0415639_039761 | 3300038395 | Bacteria | 5196 |
| 233 | Ga0466690_391763 | 3300042590 | Bacteria | 9862 |
| 234 | Ga0466692_013314 | 3300042591 | Bacteria | 1402 |
| 235 | Ga0466700_131815 | 3300042600 | Bacteria | 50718 |
| 236 | Ga0466700_310300 | 3300042600 | Bacteria | 3140 |
| 237 | Ga0466713_026509 | 3300042602 | Bacteria | 2805 |
| 238 | Ga0466722_173947 | 3300042609 | Bacteria | 1525 |
| 239 | Ga0466734_085428 | 3300042623 | Bacteria | 1714 |
| 240 | Ga0466735_124622 | 3300042624 | Bacteria | 11374 |
| 241 | Ga0466703_313354 | 3300042636 | Bacteria | 1491 |
| 242 | Ga0466704_003932 | 3300042643 | Bacteria | 1002 |
| 243 | Ga0466709_230237 | 3300042648 | Bacteria | 5819 |
| 244 | Ga0466708_145584 | 3300042652 | Bacteria | 5027 |
| 245 | Ga0466727_040615 | 3300042655 | Bacteria | 6277 |
| 246 | Ga0466710_341861 | 3300042613 | Unclassified | 1422 |
| 247 | Ga0466711_175299 | 3300042615 | Bacteria | 29148 |
| 248 | Ga0466711_213557 | 3300042615 | Bacteria | 2283 |
| 249 | Ga0466715_070682 | 3300042616 | Bacteria | 16312 |
| 250 | Ga0466715_131379 | 3300042616 | Bacteria | 18414 |
| 251 | Ga0466723_337531 | 3300042618 | Bacteria | 11297 |
| 252 | Ga0466726_192642 | 3300042619 | Bacteria | 13549 |
| 253 | Ga0466726_440266 | 3300042619 | Bacteria | 1069 |
| 254 | Ga0123357_10019688 | 3300009784 | Bacteria | 9002 |
| 255 | Ga0123357_10444270 | 3300009784 | Bacteria | 1132 |
| 256 | Ga0123353_10086249 | 3300010167 | Bacteria | 5056 |
| 257 | Ga0123353_11242102 | 3300010167 | Bacteria | 973 |
| 258 | Ga0123354_10001798 | 3300010882 | Bacteria | 27042 |
| 259 | Ga0123354_10007405 | 3300010882 | Bacteria | 16517 |
| 260 | Ga0123354_10057851 | 3300010882 | Bacteria | 5770 |
| 261 | 2227460249 | 2225789004 | Bacteria | 1003 |
| 262 | 2227654634 | 2225789004 | Unclassified | 1981 |
| 263 | IMNBL1DRAFT_c0013706 | 3300000062 | Bacteria | 3615 |
| 264 | AustNasuHG_c1000007 | 3300000089 | Bacteria | 56616 |
| 265 | JGI24702J35022_10084529 | 3300002462 | Bacteria | 1722 |
| 266 | JGI24699J35502_11134030 | 3300002509 | Bacteria | 25274 |
| 267 | Ga0068305_10012806 | 3300005083 | Bacteria | 11631 |
| 268 | Ga0072940_1141347 | 3300005200 | Bacteria | 1936 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03167 | UDG | Uracil DNA glycosylase superfamily | 105 | 259 | 0.8 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.