Protein Family IF10164
Metagenome
Isolate
287
Members
105
Samples
251
Scaffolds
253.19
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_201130|Ga0466727_201130_1195_2049
- Length
- 284 aa
- Sequence
- MRIRELCSGEPSGNRNKKIHTFGRKKSKTMETACITGATSGIGKAVAFRLAKENMNLIITGRRKERLCLLKNEIETAFGVKVHVLSFDVRNYDEVCTAFDGLPDEWKVVDVLVNNAGLAVGLDPLHRGNVDDWERMIDTNVKGLLYVTRAVSPGMVARKSGHIVNIGSIAGKEVYPNGAVYCATKHAVDALSQGMRMDLLAYGVRVTQICPGAVETEFSLVRFKGDQHRADQVYDGFVPLSAGDIAEAVGYAVTRPAHVNIQDLLVMPAAQAAATRFRKTDDRE
Sample Types
Isolate
12.5%
Metagenome
87.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
33.3%
Unclassified
16.7%
Kalotermitidae
13.7%
Blattidae
9.8%
Rhinotermitidae
4.9%
Termopsidae
3.9%
Elmidae
3.9%
Drosophilidae
2.9%
Hydrophilidae
2.0%
Apidae
2.0%
Passalidae
2.0%
Hodotermitidae
1.0%
Culicidae
1.0%
Armadillidiidae
1.0%
Cambaridae
1.0%
Tenebrionidae
1.0%
Taxonomy
Archaea
0
Bacteria
276
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820750388 | Unclassified Bacteroidetes Nt197P3bin50 | Isolate | Unclassified |
| 2 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 3 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 4 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 5 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 6 | 2904728850 | Flavobacterium sp. xlx-214 | Isolate | |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 9 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 2832343623 | Apibacter adventoris wkB180 | Isolate | Apidae |
| 22 | 2864822740 | Chryseobacterium shigense S00064 | Isolate | Elmidae |
| 23 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 24 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 27 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 28 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 31 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 32 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 33 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 34 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 37 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 38 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 39 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 40 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 41 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 42 | 2820946191 | Unclassified Acidobacteria Nt197P3bin31 | Isolate | Unclassified |
| 43 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 44 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 49 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 50 | 3300007506 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 3 gut | Metagenome | Drosophilidae |
| 51 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 52 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 53 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 54 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 55 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 56 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 57 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 58 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 59 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 60 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 61 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 62 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 63 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 64 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 65 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 66 | 2820947865 | Unclassified Acidobacteria Nt197P3bin133 | Isolate | Unclassified |
| 67 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 68 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 69 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 70 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 71 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 72 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 73 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 74 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 75 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 76 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 77 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 78 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 79 | 2832372155 | Apibacter adventoris wkB301 | Isolate | Apidae |
| 80 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 81 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 82 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 83 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 84 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 85 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 86 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 87 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 88 | 2958471994 | Flavobacterium sp. xlx-221 | Isolate | Cambaridae |
| 89 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 90 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 91 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 92 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 93 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 94 | 2864882932 | Chryseobacterium shingense S00136 | Isolate | Elmidae |
| 95 | 2864891731 | Chryseobacterium defluvii S00151 | Isolate | Elmidae |
| 96 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 97 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 98 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 99 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 100 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 101 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 102 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 103 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 104 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 105 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_165815 | 3300042611 | Bacteria | 1428 |
| 2 | Ga0466705_008942 | 3300042612 | Bacteria | 28063 |
| 3 | Ga0466705_056917 | 3300042612 | Bacteria | 2814 |
| 4 | Ga0466733_184917 | 3300042659 | Bacteria | 3794 |
| 5 | Ga0466711_092647 | 3300042615 | Bacteria | 4513 |
| 6 | Ga0466715_035287 | 3300042616 | Bacteria | 39744 |
| 7 | Ga0466715_351557 | 3300042616 | Bacteria | 1537 |
| 8 | Ga0466715_544735 | 3300042616 | Bacteria | 2371 |
| 9 | Ga0466715_618535 | 3300042616 | Bacteria | 4899 |
| 10 | Ga0466723_194801 | 3300042618 | Bacteria | 6271 |
| 11 | Ga0466726_208565 | 3300042619 | Bacteria | 1388 |
| 12 | Ga0123356_10068551 | 3300010049 | Unclassified | 3323 |
| 13 | Ga0123353_10110423 | 3300010167 | Bacteria | 4431 |
| 14 | Ga0466735_030194 | 3300042624 | Bacteria | 2048 |
| 15 | Ga0466735_222930 | 3300042624 | Bacteria | 1496 |
| 16 | Ga0466730_042109 | 3300042625 | Bacteria | 1038 |
| 17 | Ga0466703_263230 | 3300042636 | Bacteria | 2698 |
| 18 | 2227591272 | 2225789004 | Bacteria | 49846 |
| 19 | IMNBL1DRAFT_c0002023 | 3300000062 | Bacteria | 14529 |
| 20 | IMNBL1DRAFT_c0085849 | 3300000062 | Bacteria | 873 |
| 21 | JGI24702J35022_10008532 | 3300002462 | Bacteria | 5796 |
| 22 | JGI24699J35502_11133533 | 3300002509 | Bacteria | 11597 |
| 23 | JGI24696J40584_12950505 | 3300002834 | Bacteria | 2155 |
| 24 | Ga0072941_1085920 | 3300005201 | Unclassified | 2889 |
| 25 | Ga0466701_036999 | 3300042598 | Bacteria | 203039 |
| 26 | Ga0466706_031713 | 3300042599 | Bacteria | 8247 |
| 27 | Ga0466706_242525 | 3300042599 | Bacteria | 1209 |
| 28 | Ga0466707_102347 | 3300042601 | Bacteria | 20235 |
| 29 | Ga0466713_094496 | 3300042602 | Bacteria | 333875 |
| 30 | Ga0466713_097974 | 3300042602 | Bacteria | 40387 |
| 31 | Ga0466713_141379 | 3300042602 | Bacteria | 226907 |
| 32 | Ga0466716_281830 | 3300042605 | Bacteria | 3030 |
| 33 | Ga0466719_035707 | 3300042606 | Bacteria | 1225 |
| 34 | Ga0466719_290764 | 3300042606 | Bacteria | 1354 |
| 35 | Ga0466722_103833 | 3300042609 | Bacteria | 2157 |
| 36 | Ga0466698_253218 | 3300042610 | Bacteria | 1496 |
| 37 | Ga0160448_101619 | 3300012854 | Unclassified | 7217 |
| 38 | Ga0466656_372801 | 3300042550 | Bacteria | 1361 |
| 39 | Ga0466694_403681 | 3300042594 | Bacteria | 3138 |
| 40 | Ga0466695_240649 | 3300042595 | Bacteria | 1956 |
| 41 | Ga0466696_222221 | 3300042596 | Bacteria | 29066 |
| 42 | Ga0466696_376281 | 3300042596 | Bacteria | 1619 |
| 43 | Ga0466732_124658 | 3300042656 | Bacteria | 1381 |
| 44 | Ga0466732_160752 | 3300042656 | Bacteria | 7677 |
| 45 | Ga0466733_150302 | 3300042659 | Bacteria | 45980 |
| 46 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 47 | Ga0466711_093965 | 3300042615 | Bacteria | 24756 |
| 48 | Ga0466711_107915 | 3300042615 | Bacteria | 4821 |
| 49 | Ga0466715_047096 | 3300042616 | Bacteria | 15770 |
| 50 | Ga0466726_048132 | 3300042619 | Bacteria | 1076 |
| 51 | Ga0123353_10001103 | 3300010167 | Bacteria | 32862 |
| 52 | Ga0123354_10014550 | 3300010882 | Bacteria | 12257 |
| 53 | Ga0466734_164259 | 3300042623 | Bacteria | 6089 |
| 54 | Ga0466703_275691 | 3300042636 | Bacteria | 4182 |
| 55 | Ga0466703_284468 | 3300042636 | Bacteria | 6607 |
| 56 | Ga0466703_389982 | 3300042636 | Bacteria | 1221 |
| 57 | Ga0466703_417830 | 3300042636 | Bacteria | 13066 |
| 58 | Ga0466709_025289 | 3300042648 | Bacteria | 2392 |
| 59 | Ga0466708_004540 | 3300042652 | Bacteria | 33290 |
| 60 | Ga0466708_018399 | 3300042652 | Bacteria | 49081 |
| 61 | Ga0466708_125096 | 3300042652 | Bacteria | 9675 |
| 62 | Ga0466725_089078 | 3300042654 | Bacteria | 11624 |
| 63 | Ga0466725_194480 | 3300042654 | Bacteria | 6695 |
| 64 | Ga0466725_205968 | 3300042654 | Bacteria | 2939 |
| 65 | JGI24702J35022_10061219 | 3300002462 | Bacteria | 2013 |
| 66 | JGI24705J35276_12224784 | 3300002504 | Bacteria | 2648 |
| 67 | Ga0068302_10266163 | 3300005071 | Bacteria | 1449 |
| 68 | Ga0068302_10269826 | 3300005071 | Unclassified | 840 |
| 69 | Ga0068305_10008662 | 3300005083 | Bacteria | 19701 |
| 70 | Ga0068305_10060120 | 3300005083 | Bacteria | 9059 |
| 71 | Ga0105006_1047261 | 3300007506 | Unclassified | 26576 |
| 72 | Ga0466720_067607 | 3300042607 | Bacteria | 5593 |
| 73 | Ga0466722_177586 | 3300042609 | Bacteria | 1807 |
| 74 | Ga0466690_170288 | 3300042590 | Bacteria | 25098 |
| 75 | Ga0466693_269671 | 3300042592 | Bacteria | 1407 |
| 76 | Ga0466733_188245 | 3300042659 | Unclassified | 4430 |
| 77 | Ga0466710_244897 | 3300042613 | Bacteria | 1054 |
| 78 | Ga0466711_174793 | 3300042615 | Bacteria | 9218 |
| 79 | Ga0466715_523511 | 3300042616 | Bacteria | 5552 |
| 80 | Ga0466723_096809 | 3300042618 | Bacteria | 1055 |
| 81 | Ga0123353_10044792 | 3300010167 | Bacteria | 7016 |
| 82 | Ga0123353_10845272 | 3300010167 | Bacteria | 1256 |
| 83 | Ga0466731_271640 | 3300042622 | Bacteria | 4989 |
| 84 | Ga0466731_428468 | 3300042622 | Bacteria | 1203 |
| 85 | Ga0466702_348931 | 3300042635 | Bacteria | 2234 |
| 86 | Ga0466704_456099 | 3300042643 | Bacteria | 19701 |
| 87 | Ga0466704_612519 | 3300042643 | Bacteria | 2126 |
| 88 | Ga0466708_294627 | 3300042652 | Bacteria | 11575 |
| 89 | JGI24702J35022_10002590 | 3300002462 | Bacteria | 10992 |
| 90 | Ga0466706_288890 | 3300042599 | Bacteria | 2870 |
| 91 | Ga0466700_136330 | 3300042600 | Bacteria | 2641 |
| 92 | Ga0466719_260891 | 3300042606 | Bacteria | 8059 |
| 93 | Ga0466698_373949 | 3300042610 | Bacteria | 1646 |
| 94 | Ga0466694_382164 | 3300042594 | Bacteria | 2311 |
| 95 | Ga0466695_103373 | 3300042595 | Bacteria | 3521 |
| 96 | Ga0466695_152303 | 3300042595 | Bacteria | 14347 |
| 97 | Ga0466696_125800 | 3300042596 | Bacteria | 19941 |
| 98 | Ga0466697_200358 | 3300042611 | Bacteria | 7852 |
| 99 | Ga0466733_107820 | 3300042659 | Bacteria | 13928 |
| 100 | Ga0466733_173013 | 3300042659 | Bacteria | 3957 |
| 101 | Ga0466712_184637 | 3300042614 | Bacteria | 1947 |
| 102 | Ga0123356_10649280 | 3300010049 | Bacteria | 1222 |
| 103 | Ga0123353_10482084 | 3300010167 | Bacteria | 1814 |
| 104 | Ga0466730_071786 | 3300042625 | Bacteria | 741189 |
| 105 | Ga0466702_125686 | 3300042635 | Bacteria | 1184 |
| 106 | Ga0466703_024385 | 3300042636 | Bacteria | 10391 |
| 107 | 2227197466 | 2225789004 | Bacteria | 7826 |
| 108 | 2227477401 | 2225789004 | Bacteria | 22517 |
| 109 | JGI24696J40584_12959697 | 3300002834 | Bacteria | 5491 |
| 110 | Ga0104048_1004896 | 3300007143 | Bacteria | 4570 |
| 111 | Ga0466701_080453 | 3300042598 | Bacteria | 50311 |
| 112 | Ga0466701_089949 | 3300042598 | Bacteria | 1476 |
| 113 | Ga0466706_019239 | 3300042599 | Bacteria | 7993 |
| 114 | Ga0466706_156931 | 3300042599 | Bacteria | 8948 |
| 115 | Ga0466706_165084 | 3300042599 | Bacteria | 195712 |
| 116 | Ga0466713_022356 | 3300042602 | Bacteria | 45305 |
| 117 | Ga0466716_323311 | 3300042605 | Bacteria | 15345 |
| 118 | Ga0466719_015020 | 3300042606 | Bacteria | 6294 |
| 119 | Ga0466719_142197 | 3300042606 | Bacteria | 2348 |
| 120 | Ga0466720_069115 | 3300042607 | Bacteria | 3724 |
| 121 | Ga0466720_194799 | 3300042607 | Bacteria | 1520 |
| 122 | Ga0466722_042812 | 3300042609 | Bacteria | 110303 |
| 123 | Ga0160457_1005452 | 3300012858 | Bacteria | 1940 |
| 124 | Ga0264413_142884 | 3300024493 | Bacteria | 2838 |
| 125 | Ga0466694_407191 | 3300042594 | Bacteria | 1510 |
| 126 | Ga0466696_176785 | 3300042596 | Bacteria | 19925 |
| 127 | Ga0466705_208960 | 3300042612 | Bacteria | 2964 |
| 128 | Ga0466732_439247 | 3300042656 | Bacteria | 2788 |
| 129 | Ga0466733_008681 | 3300042659 | Bacteria | 65582 |
| 130 | Ga0466711_314979 | 3300042615 | Bacteria | 2867 |
| 131 | Ga0466718_004552 | 3300042617 | Bacteria | 3028 |
| 132 | Ga0466718_008016 | 3300042617 | Bacteria | 2904 |
| 133 | Ga0466718_051448 | 3300042617 | Bacteria | 2407 |
| 134 | Ga0466718_107223 | 3300042617 | Bacteria | 2830 |
| 135 | Ga0466723_111552 | 3300042618 | Bacteria | 31046 |
| 136 | Ga0466728_087347 | 3300042620 | Bacteria | 5073 |
| 137 | Ga0123356_10027594 | 3300010049 | Bacteria | 5320 |
| 138 | Ga0123356_10952199 | 3300010049 | Bacteria | 1029 |
| 139 | Ga0123353_10189023 | 3300010167 | Bacteria | 3253 |
| 140 | Ga0466704_405258 | 3300042643 | Bacteria | 14576 |
| 141 | Ga0466704_541739 | 3300042643 | Bacteria | 8003 |
| 142 | Ga0466709_124130 | 3300042648 | Bacteria | 272718 |
| 143 | Ga0466727_010188 | 3300042655 | Bacteria | 8038 |
| 144 | IMNBL1DRAFT_c0003597 | 3300000062 | Bacteria | 9826 |
| 145 | JGI24696J40584_12959243 | 3300002834 | Bacteria | 4874 |
| 146 | Ga0072940_1207802 | 3300005200 | Bacteria | 1032 |
| 147 | Ga0466701_029124 | 3300042598 | Bacteria | 1171 |
| 148 | Ga0466701_094519 | 3300042598 | Bacteria | 1506 |
| 149 | Ga0466706_140021 | 3300042599 | Bacteria | 25645 |
| 150 | Ga0466706_221149 | 3300042599 | Bacteria | 2143 |
| 151 | Ga0466700_331546 | 3300042600 | Bacteria | 8869 |
| 152 | Ga0466713_104700 | 3300042602 | Bacteria | 45952 |
| 153 | Ga0466714_053131 | 3300042603 | Bacteria | 3853 |
| 154 | Ga0466717_224220 | 3300042604 | Bacteria | 1021 |
| 155 | Ga0466717_282468 | 3300042604 | Bacteria | 1255 |
| 156 | Ga0466722_082515 | 3300042609 | Bacteria | 19321 |
| 157 | Ga0466722_216227 | 3300042609 | Bacteria | 27341 |
| 158 | Ga0466690_295946 | 3300042590 | Bacteria | 10455 |
| 159 | Ga0466692_116208 | 3300042591 | Unclassified | 1396 |
| 160 | Ga0466693_273261 | 3300042592 | Bacteria | 1150 |
| 161 | Ga0466699_064523 | 3300042597 | Bacteria | 2123 |
| 162 | Ga0466699_362178 | 3300042597 | Bacteria | 2276 |
| 163 | Ga0466705_252069 | 3300042612 | Bacteria | 4443 |
| 164 | Ga0466705_323785 | 3300042612 | Bacteria | 10850 |
| 165 | Ga0466715_337260 | 3300042616 | Bacteria | 33337 |
| 166 | Ga0466715_529876 | 3300042616 | Bacteria | 14179 |
| 167 | Ga0466728_324182 | 3300042620 | Bacteria | 12575 |
| 168 | Ga0466729_125288 | 3300042621 | Bacteria | 15046 |
| 169 | Ga0123356_10256571 | 3300010049 | Bacteria | 1829 |
| 170 | Ga0123353_10870428 | 3300010167 | Bacteria | 1232 |
| 171 | Ga0466729_268715 | 3300042621 | Bacteria | 1336 |
| 172 | Ga0466704_270794 | 3300042643 | Bacteria | 3895 |
| 173 | Ga0466704_285742 | 3300042643 | Bacteria | 10079 |
| 174 | Ga0466708_254922 | 3300042652 | Bacteria | 84207 |
| 175 | Ga0466727_110981 | 3300042655 | Bacteria | 13533 |
| 176 | Ga0466727_175583 | 3300042655 | Bacteria | 9330 |
| 177 | 2227517417 | 2225789004 | Bacteria | 3414 |
| 178 | JGI24702J35022_10133134 | 3300002462 | Bacteria | 1381 |
| 179 | JGI24696J40584_12937502 | 3300002834 | Bacteria | 1604 |
| 180 | Ga0072941_1257876 | 3300005201 | Bacteria | 2024 |
| 181 | Ga0104048_1004310 | 3300007143 | Bacteria | 26436 |
| 182 | Ga0466706_199169 | 3300042599 | Bacteria | 2033 |
| 183 | Ga0466700_298764 | 3300042600 | Bacteria | 1603 |
| 184 | Ga0466719_007351 | 3300042606 | Bacteria | 4730 |
| 185 | Ga0466722_180542 | 3300042609 | Bacteria | 3379 |
| 186 | Ga0466699_020510 | 3300042597 | Bacteria | 1463 |
| 187 | Ga0466705_061109 | 3300042612 | Bacteria | 5762 |
| 188 | Ga0466732_074525 | 3300042656 | Bacteria | 3372 |
| 189 | Ga0466712_050713 | 3300042614 | Bacteria | 18789 |
| 190 | Ga0466712_320519 | 3300042614 | Bacteria | 1102 |
| 191 | Ga0466715_191298 | 3300042616 | Bacteria | 13666 |
| 192 | Ga0123357_10197460 | 3300009784 | Unclassified | 2300 |
| 193 | Ga0123353_10018575 | 3300010167 | Bacteria | 10286 |
| 194 | Ga0466730_099794 | 3300042625 | Bacteria | 5228 |
| 195 | Ga0466704_185226 | 3300042643 | Bacteria | 2628 |
| 196 | Ga0466709_105464 | 3300042648 | Bacteria | 22179 |
| 197 | Ga0466709_114487 | 3300042648 | Bacteria | 52942 |
| 198 | Ga0466709_312765 | 3300042648 | Bacteria | 159709 |
| 199 | Ga0466708_410829 | 3300042652 | Bacteria | 6801 |
| 200 | Ga0466727_201130 | 3300042655 | Bacteria | 2973 |
| 201 | 2227566334 | 2225789004 | Bacteria | 2665 |
| 202 | JGI24698J34947_10005397 | 3300002449 | Bacteria | 7012 |
| 203 | JGI24702J35022_10105590 | 3300002462 | Bacteria | 1545 |
| 204 | JGI24705J35276_12235739 | 3300002504 | Bacteria | 6915 |
| 205 | Ga0072941_1085921 | 3300005201 | Bacteria | 6311 |
| 206 | Ga0104048_1024903 | 3300007143 | Bacteria | 3119 |
| 207 | Ga0105553_1001296 | 3300007767 | Unclassified | 5795 |
| 208 | Ga0466706_157184 | 3300042599 | Bacteria | 11339 |
| 209 | Ga0466713_146465 | 3300042602 | Bacteria | 20927 |
| 210 | Ga0466714_126488 | 3300042603 | Bacteria | 3379 |
| 211 | Ga0466716_477735 | 3300042605 | Bacteria | 4061 |
| 212 | Ga0466698_020118 | 3300042610 | Bacteria | 2338 |
| 213 | Ga0466657_244615 | 3300042582 | Bacteria | 77081 |
| 214 | Ga0466690_364720 | 3300042590 | Bacteria | 1343 |
| 215 | Ga0466691_109620 | 3300042593 | Bacteria | 15230 |
| 216 | Ga0466697_121233 | 3300042611 | Bacteria | 1116 |
| 217 | Ga0466705_065314 | 3300042612 | Bacteria | 9161 |
| 218 | Ga0466705_432608 | 3300042612 | Bacteria | 1889 |
| 219 | Ga0466710_147835 | 3300042613 | Bacteria | 1272 |
| 220 | Ga0466723_039464 | 3300042618 | Bacteria | 3055 |
| 221 | Ga0466723_167946 | 3300042618 | Unclassified | 3463 |
| 222 | Ga0466726_060107 | 3300042619 | Bacteria | 1721 |
| 223 | Ga0466726_321610 | 3300042619 | Bacteria | 7482 |
| 224 | Ga0466728_384531 | 3300042620 | Bacteria | 1480 |
| 225 | Ga0123355_10120426 | 3300009826 | Bacteria | 4073 |
| 226 | Ga0123353_10058102 | 3300010167 | Bacteria | 6197 |
| 227 | Ga0466702_119213 | 3300042635 | Bacteria | 1163 |
| 228 | Ga0466704_139986 | 3300042643 | Bacteria | 2341 |
| 229 | Ga0466709_357287 | 3300042648 | Bacteria | 3006 |
| 230 | Ga0466709_381563 | 3300042648 | Bacteria | 1317 |
| 231 | JGI24702J35022_10057988 | 3300002462 | Bacteria | 2068 |
| 232 | Ga0072941_1558307 | 3300005201 | Bacteria | 1959 |
| 233 | Ga0104048_1022354 | 3300007143 | Bacteria | 4513 |
| 234 | Ga0105006_1022682 | 3300007506 | Unclassified | 7842 |
| 235 | Ga0466701_062333 | 3300042598 | Bacteria | 75358 |
| 236 | Ga0466701_067087 | 3300042598 | Bacteria | 1738 |
| 237 | Ga0466706_053329 | 3300042599 | Bacteria | 19896 |
| 238 | Ga0466707_262205 | 3300042601 | Bacteria | 6853 |
| 239 | Ga0466713_074381 | 3300042602 | Bacteria | 4005 |
| 240 | Ga0466713_085907 | 3300042602 | Bacteria | 11127 |
| 241 | Ga0466713_103592 | 3300042602 | Bacteria | 138334 |
| 242 | Ga0466717_216263 | 3300042604 | Bacteria | 6467 |
| 243 | Ga0466719_522880 | 3300042606 | Bacteria | 4705 |
| 244 | Ga0466697_020000 | 3300042611 | Bacteria | 1642 |
| 245 | Ga0264413_104140 | 3300024493 | Bacteria | 1513 |
| 246 | Ga0466690_115556 | 3300042590 | Bacteria | 15437 |
| 247 | Ga0466692_043458 | 3300042591 | Bacteria | 1614 |
| 248 | Ga0466692_077395 | 3300042591 | Bacteria | 17046 |
| 249 | Ga0466691_001057 | 3300042593 | Bacteria | 2027 |
| 250 | Ga0466694_115749 | 3300042594 | Bacteria | 2098 |
| 251 | Ga0466694_286929 | 3300042594 | Bacteria | 6464 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.