Protein Family IF10149
Metagenome
Isolate
267
Members
66
Samples
246
Scaffolds
281.38
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_150110|Ga0466727_150110_9846_10877
- Length
- 343 aa
- Sequence
- MKHIVTAAYKNFFLHIYAFLDTFSAQMYVKQEINHHFFSIFVIMYCFFSYLYRLKLDTININYMNTRIEERWGTHPNDVKHYDTTQLRKEFLVEKLFETDEVIMVYTHNDRLIIGGAFPVAESLKLETVDLVRSEYFCERREVGVICIENEGIVTVDGQDFEMSYKDALYVARGSKEVVFKSRDAAKPAKFYFASSPAHKAFSTAAITKDMRRTRELGIKKLSNERTLNQLILNEIVPCCQLQMGLTEIKEGSVWNTMPPHTHSRRMEAYFYFKVPEQQAVCHFMGQPQETRHLFLANEQAVISPSWSIHSAAGTSNYTFIWAMCGENLDYDDMDTFTADKLR
Sample Types
Isolate
7.9%
Metagenome
92.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
21.9%
Termitidae
17.2%
Unclassified
15.6%
Blattidae
14.1%
Rhinotermitidae
7.8%
Termopsidae
6.2%
Hydrophilidae
3.1%
Passalidae
3.1%
Armadillidiidae
3.1%
Drosophilidae
3.1%
Elmidae
1.6%
Hodotermitidae
1.6%
Tenebrionidae
1.6%
Taxonomy
Archaea
0
Bacteria
258
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864831662 | Chryseobacterium sediminis S00068 | Isolate | Elmidae |
| 2 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 3 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 4 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 5 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 14 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 18 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 21 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 29 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 30 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 33 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 34 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 35 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 36 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 37 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 38 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 39 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 40 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 42 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 43 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 44 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 45 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 46 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 47 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 48 | 3300005307 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 1 gut | Metagenome | Drosophilidae |
| 49 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 50 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 51 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 52 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 53 | 2820768849 | Unclassified Bacteroidetes Lab288P3bin194 | Isolate | Unclassified |
| 54 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 55 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 56 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 57 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 58 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 59 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 60 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 61 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 62 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 63 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 64 | 3300007136 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 4 gut | Metagenome | Drosophilidae |
| 65 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 66 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466656_234389 | 3300042550 | Bacteria | 1465 |
| 2 | Ga0466690_171555 | 3300042590 | Bacteria | 7592 |
| 3 | Ga0466692_063632 | 3300042591 | Bacteria | 3039 |
| 4 | Ga0466692_176069 | 3300042591 | Bacteria | 1363 |
| 5 | Ga0466696_036786 | 3300042596 | Bacteria | 23414 |
| 6 | Ga0466696_087173 | 3300042596 | Bacteria | 8323 |
| 7 | Ga0466696_361792 | 3300042596 | Bacteria | 9269 |
| 8 | Ga0466711_324425 | 3300042615 | Bacteria | 4384 |
| 9 | Ga0466726_153404 | 3300042619 | Bacteria | 17099 |
| 10 | Ga0466728_425802 | 3300042620 | Bacteria | 19622 |
| 11 | IMNBL1DRAFT_c0013193 | 3300000062 | Bacteria | 3726 |
| 12 | JGI24702J35022_10010735 | 3300002462 | Bacteria | 5113 |
| 13 | Ga0068302_10131510 | 3300005071 | Unclassified | 1965 |
| 14 | Ga0104044_1004970 | 3300007136 | Bacteria | 1263 |
| 15 | Ga0466707_033164 | 3300042601 | Unclassified | 1764 |
| 16 | Ga0466707_064929 | 3300042601 | Bacteria | 6603 |
| 17 | Ga0466707_375879 | 3300042601 | Bacteria | 2437 |
| 18 | Ga0466713_071103 | 3300042602 | Bacteria | 5130 |
| 19 | Ga0466713_100528 | 3300042602 | Bacteria | 510720 |
| 20 | Ga0466714_057554 | 3300042603 | Bacteria | 76415 |
| 21 | Ga0466714_148270 | 3300042603 | Bacteria | 1889 |
| 22 | Ga0466714_159895 | 3300042603 | Bacteria | 5217 |
| 23 | Ga0466716_355256 | 3300042605 | Bacteria | 6361 |
| 24 | Ga0466719_091156 | 3300042606 | Bacteria | 9182 |
| 25 | Ga0466719_210155 | 3300042606 | Bacteria | 9481 |
| 26 | Ga0466722_041356 | 3300042609 | Bacteria | 1537 |
| 27 | Ga0466722_120468 | 3300042609 | Bacteria | 9521 |
| 28 | Ga0466722_141283 | 3300042609 | Bacteria | 13906 |
| 29 | Ga0466722_234565 | 3300042609 | Bacteria | 2230 |
| 30 | Ga0466729_261672 | 3300042621 | Bacteria | 11519 |
| 31 | Ga0466735_203242 | 3300042624 | Bacteria | 13594 |
| 32 | Ga0466704_062392 | 3300042643 | Bacteria | 22291 |
| 33 | Ga0466704_143483 | 3300042643 | Bacteria | 8895 |
| 34 | Ga0466708_146402 | 3300042652 | Bacteria | 13887 |
| 35 | Ga0466727_034358 | 3300042655 | Bacteria | 33712 |
| 36 | Ga0466727_107621 | 3300042655 | Bacteria | 9293 |
| 37 | Ga0466705_232007 | 3300042612 | Bacteria | 3788 |
| 38 | Ga0466705_287364 | 3300042612 | Bacteria | 9853 |
| 39 | Ga0466733_061998 | 3300042659 | Bacteria | 12301 |
| 40 | Ga0466733_115294 | 3300042659 | Bacteria | 114356 |
| 41 | Ga0123354_10218269 | 3300010882 | Bacteria | 2035 |
| 42 | Ga0265387_1003346 | 3300024582 | Bacteria | 2219 |
| 43 | Ga0466690_033991 | 3300042590 | Bacteria | 11426 |
| 44 | Ga0466691_082783 | 3300042593 | Bacteria | 28065 |
| 45 | Ga0466696_098138 | 3300042596 | Bacteria | 4086 |
| 46 | Ga0466711_227825 | 3300042615 | Bacteria | 191336 |
| 47 | Ga0466715_056569 | 3300042616 | Bacteria | 35867 |
| 48 | Ga0466715_190989 | 3300042616 | Bacteria | 5915 |
| 49 | Ga0466715_360885 | 3300042616 | Bacteria | 59521 |
| 50 | Ga0466728_229448 | 3300042620 | Bacteria | 12851 |
| 51 | JGI24705J35276_12208513 | 3300002504 | Bacteria | 1774 |
| 52 | Ga0068302_10024988 | 3300005071 | Unclassified | 1211 |
| 53 | Ga0068305_10075335 | 3300005083 | Bacteria | 4302 |
| 54 | Ga0466706_096030 | 3300042599 | Bacteria | 5184 |
| 55 | Ga0466700_032281 | 3300042600 | Bacteria | 2175 |
| 56 | Ga0466707_306154 | 3300042601 | Bacteria | 2976 |
| 57 | Ga0466716_001967 | 3300042605 | Bacteria | 7332 |
| 58 | Ga0466719_136602 | 3300042606 | Bacteria | 2222 |
| 59 | Ga0466722_207055 | 3300042609 | Bacteria | 10529 |
| 60 | Ga0466703_064825 | 3300042636 | Bacteria | 42026 |
| 61 | Ga0466703_126526 | 3300042636 | Bacteria | 24961 |
| 62 | Ga0466703_211551 | 3300042636 | Bacteria | 10631 |
| 63 | Ga0466704_182939 | 3300042643 | Bacteria | 26244 |
| 64 | Ga0466704_366330 | 3300042643 | Unclassified | 2109 |
| 65 | Ga0466709_080488 | 3300042648 | Bacteria | 7623 |
| 66 | Ga0466708_020693 | 3300042652 | Bacteria | 7985 |
| 67 | Ga0466727_022572 | 3300042655 | Bacteria | 1279 |
| 68 | Ga0466705_039947 | 3300042612 | Bacteria | 5133 |
| 69 | Ga0466705_101303 | 3300042612 | Bacteria | 9204 |
| 70 | Ga0466705_146158 | 3300042612 | Bacteria | 1799 |
| 71 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 72 | Ga0466690_041465 | 3300042590 | Bacteria | 11673 |
| 73 | Ga0466690_216395 | 3300042590 | Bacteria | 25564 |
| 74 | Ga0466691_105358 | 3300042593 | Bacteria | 6064 |
| 75 | Ga0466696_287535 | 3300042596 | Bacteria | 43348 |
| 76 | Ga0466711_291759 | 3300042615 | Bacteria | 6222 |
| 77 | Ga0466715_194185 | 3300042616 | Bacteria | 1134 |
| 78 | Ga0466715_268476 | 3300042616 | Bacteria | 54264 |
| 79 | Ga0466723_011688 | 3300042618 | Bacteria | 7416 |
| 80 | Ga0466723_125880 | 3300042618 | Bacteria | 16503 |
| 81 | Ga0466723_374588 | 3300042618 | Bacteria | 41739 |
| 82 | JGI24702J35022_10001125 | 3300002462 | Bacteria | 16621 |
| 83 | JGI24702J35022_10018532 | 3300002462 | Bacteria | 3794 |
| 84 | Ga0074308_1113509 | 3300005307 | Bacteria | 3841 |
| 85 | Ga0466707_009633 | 3300042601 | Bacteria | 35190 |
| 86 | Ga0466713_045340 | 3300042602 | Bacteria | 1733 |
| 87 | Ga0466713_079678 | 3300042602 | Bacteria | 62372 |
| 88 | Ga0466714_018210 | 3300042603 | Bacteria | 10928 |
| 89 | Ga0466714_125121 | 3300042603 | Bacteria | 6005 |
| 90 | Ga0466714_125574 | 3300042603 | Bacteria | 4912 |
| 91 | Ga0466722_052923 | 3300042609 | Bacteria | 1506 |
| 92 | Ga0466722_063695 | 3300042609 | Bacteria | 1441 |
| 93 | Ga0466729_262127 | 3300042621 | Bacteria | 2976 |
| 94 | Ga0466703_260318 | 3300042636 | Bacteria | 17907 |
| 95 | Ga0466708_246063 | 3300042652 | Bacteria | 25365 |
| 96 | Ga0466708_287476 | 3300042652 | Bacteria | 4567 |
| 97 | Ga0466727_015041 | 3300042655 | Bacteria | 3711 |
| 98 | Ga0466727_150110 | 3300042655 | Bacteria | 20444 |
| 99 | Ga0466727_220175 | 3300042655 | Bacteria | 2783 |
| 100 | Ga0466705_093655 | 3300042612 | Bacteria | 5923 |
| 101 | Ga0466733_073931 | 3300042659 | Bacteria | 6821 |
| 102 | Ga0160468_100074 | 3300012819 | Bacteria | 131764 |
| 103 | Ga0466711_112273 | 3300042615 | Bacteria | 1353 |
| 104 | Ga0466711_125608 | 3300042615 | Bacteria | 3552 |
| 105 | Ga0466711_163307 | 3300042615 | Bacteria | 57894 |
| 106 | Ga0466715_062862 | 3300042616 | Bacteria | 14793 |
| 107 | Ga0466715_268986 | 3300042616 | Bacteria | 3345 |
| 108 | Ga0466715_592687 | 3300042616 | Bacteria | 16089 |
| 109 | Ga0466723_034331 | 3300042618 | Bacteria | 16866 |
| 110 | Ga0466723_213617 | 3300042618 | Bacteria | 1012 |
| 111 | Ga0466726_479594 | 3300042619 | Bacteria | 6175 |
| 112 | Ga0466728_275699 | 3300042620 | Bacteria | 1738 |
| 113 | IMNBL1DRAFT_c0000136 | 3300000062 | Bacteria | 65757 |
| 114 | Ga0466713_064405 | 3300042602 | Bacteria | 152501 |
| 115 | Ga0466713_085321 | 3300042602 | Bacteria | 16713 |
| 116 | Ga0466713_104700 | 3300042602 | Bacteria | 45952 |
| 117 | Ga0466716_349737 | 3300042605 | Bacteria | 18598 |
| 118 | Ga0466719_415035 | 3300042606 | Bacteria | 1338 |
| 119 | Ga0466735_135573 | 3300042624 | Bacteria | 2343 |
| 120 | Ga0466704_236841 | 3300042643 | Bacteria | 15017 |
| 121 | Ga0466704_250285 | 3300042643 | Bacteria | 39361 |
| 122 | Ga0466709_120416 | 3300042648 | Bacteria | 3492 |
| 123 | Ga0466708_302402 | 3300042652 | Bacteria | 34492 |
| 124 | Ga0466727_047170 | 3300042655 | Bacteria | 83253 |
| 125 | Ga0466727_305025 | 3300042655 | Bacteria | 13454 |
| 126 | Ga0466705_016747 | 3300042612 | Bacteria | 3640 |
| 127 | Ga0466733_120796 | 3300042659 | Bacteria | 6227 |
| 128 | Ga0160452_102713 | 3300012834 | Bacteria | 3546 |
| 129 | Ga0466690_198924 | 3300042590 | Bacteria | 34985 |
| 130 | Ga0466693_451647 | 3300042592 | Bacteria | 17310 |
| 131 | Ga0466696_189901 | 3300042596 | Bacteria | 10950 |
| 132 | Ga0466711_178553 | 3300042615 | Bacteria | 5412 |
| 133 | Ga0466715_005856 | 3300042616 | Bacteria | 5612 |
| 134 | Ga0466723_347480 | 3300042618 | Unclassified | 4716 |
| 135 | Ga0466726_295244 | 3300042619 | Bacteria | 7632 |
| 136 | Ga0466726_440823 | 3300042619 | Bacteria | 1713 |
| 137 | Ga0466728_174142 | 3300042620 | Bacteria | 18498 |
| 138 | 2227239116 | 2225789004 | Bacteria | 7264 |
| 139 | IMNBL1DRAFT_c0019795 | 3300000062 | Bacteria | 2746 |
| 140 | Ga0068305_10031331 | 3300005083 | Bacteria | 12573 |
| 141 | Ga0068305_10049092 | 3300005083 | Bacteria | 12491 |
| 142 | Ga0068305_10227768 | 3300005083 | Bacteria | 2993 |
| 143 | Ga0466707_226984 | 3300042601 | Bacteria | 4311 |
| 144 | Ga0466713_052635 | 3300042602 | Bacteria | 1952 |
| 145 | Ga0466713_073291 | 3300042602 | Bacteria | 42324 |
| 146 | Ga0466713_144823 | 3300042602 | Bacteria | 7695 |
| 147 | Ga0466714_001380 | 3300042603 | Bacteria | 12413 |
| 148 | Ga0466722_200394 | 3300042609 | Bacteria | 8382 |
| 149 | Ga0466704_527880 | 3300042643 | Bacteria | 2011 |
| 150 | Ga0466690_007765 | 3300042590 | Bacteria | 18549 |
| 151 | Ga0466690_248454 | 3300042590 | Bacteria | 1890 |
| 152 | Ga0466693_343597 | 3300042592 | Bacteria | 1035 |
| 153 | Ga0466691_073130 | 3300042593 | Bacteria | 4948 |
| 154 | Ga0466695_146851 | 3300042595 | Bacteria | 2933 |
| 155 | Ga0466711_320643 | 3300042615 | Bacteria | 9589 |
| 156 | Ga0466715_210783 | 3300042616 | Bacteria | 1731 |
| 157 | Ga0466723_082290 | 3300042618 | Bacteria | 16638 |
| 158 | Ga0466723_224156 | 3300042618 | Bacteria | 7701 |
| 159 | Ga0466723_245046 | 3300042618 | Bacteria | 23052 |
| 160 | Ga0466726_345088 | 3300042619 | Bacteria | 7018 |
| 161 | 2227494084 | 2225789004 | Unclassified | 20102 |
| 162 | Ga0068305_10444313 | 3300005083 | Bacteria | 1985 |
| 163 | Ga0466701_059539 | 3300042598 | Bacteria | 71898 |
| 164 | Ga0466713_075457 | 3300042602 | Bacteria | 24128 |
| 165 | Ga0466713_081773 | 3300042602 | Bacteria | 94516 |
| 166 | Ga0466713_129444 | 3300042602 | Bacteria | 20978 |
| 167 | Ga0466719_072148 | 3300042606 | Bacteria | 13566 |
| 168 | Ga0466719_268725 | 3300042606 | Bacteria | 2174 |
| 169 | Ga0466722_190419 | 3300042609 | Bacteria | 4542 |
| 170 | Ga0466722_265008 | 3300042609 | Bacteria | 1342 |
| 171 | Ga0466735_058600 | 3300042624 | Bacteria | 1804 |
| 172 | Ga0466703_180199 | 3300042636 | Bacteria | 1836 |
| 173 | Ga0466704_157598 | 3300042643 | Bacteria | 2512 |
| 174 | Ga0466704_200953 | 3300042643 | Bacteria | 4997 |
| 175 | Ga0466704_258026 | 3300042643 | Bacteria | 4075 |
| 176 | Ga0466727_255939 | 3300042655 | Bacteria | 1589 |
| 177 | Ga0466727_324052 | 3300042655 | Bacteria | 1139 |
| 178 | Ga0466697_075986 | 3300042611 | Bacteria | 1249 |
| 179 | Ga0466705_249902 | 3300042612 | Bacteria | 9089 |
| 180 | Ga0466705_288759 | 3300042612 | Bacteria | 2632 |
| 181 | Ga0466733_122498 | 3300042659 | Bacteria | 43456 |
| 182 | Ga0466733_221157 | 3300042659 | Unclassified | 1346 |
| 183 | Ga0466656_197807 | 3300042550 | Bacteria | 3179 |
| 184 | Ga0466711_012792 | 3300042615 | Bacteria | 3846 |
| 185 | Ga0466715_034348 | 3300042616 | Bacteria | 8033 |
| 186 | Ga0466715_167290 | 3300042616 | Bacteria | 18119 |
| 187 | Ga0466715_279777 | 3300042616 | Bacteria | 2053 |
| 188 | Ga0466715_432401 | 3300042616 | Bacteria | 5863 |
| 189 | Ga0466726_283925 | 3300042619 | Bacteria | 2106 |
| 190 | Ga0466729_188839 | 3300042621 | Bacteria | 15352 |
| 191 | Ga0466707_238767 | 3300042601 | Bacteria | 7067 |
| 192 | Ga0466713_099472 | 3300042602 | Bacteria | 53957 |
| 193 | Ga0466714_014203 | 3300042603 | Bacteria | 2911 |
| 194 | Ga0466714_119973 | 3300042603 | Unclassified | 2073 |
| 195 | Ga0466714_134215 | 3300042603 | Bacteria | 6656 |
| 196 | Ga0466716_117305 | 3300042605 | Bacteria | 9620 |
| 197 | Ga0466719_190206 | 3300042606 | Bacteria | 3454 |
| 198 | Ga0466722_177463 | 3300042609 | Bacteria | 4592 |
| 199 | Ga0466729_200065 | 3300042621 | Bacteria | 1788 |
| 200 | Ga0466729_246079 | 3300042621 | Bacteria | 4856 |
| 201 | Ga0466703_021854 | 3300042636 | Bacteria | 27270 |
| 202 | Ga0466703_122833 | 3300042636 | Bacteria | 5687 |
| 203 | Ga0466703_221500 | 3300042636 | Bacteria | 4323 |
| 204 | Ga0466703_239733 | 3300042636 | Bacteria | 28849 |
| 205 | Ga0466703_363460 | 3300042636 | Bacteria | 6662 |
| 206 | Ga0466703_395026 | 3300042636 | Bacteria | 14604 |
| 207 | Ga0466704_189038 | 3300042643 | Bacteria | 10977 |
| 208 | Ga0466704_588482 | 3300042643 | Bacteria | 11572 |
| 209 | Ga0466708_056254 | 3300042652 | Bacteria | 11846 |
| 210 | Ga0466708_153426 | 3300042652 | Bacteria | 2477 |
| 211 | Ga0466727_282284 | 3300042655 | Bacteria | 4147 |
| 212 | Ga0466705_305532 | 3300042612 | Bacteria | 10631 |
| 213 | Ga0466733_182643 | 3300042659 | Unclassified | 5662 |
| 214 | Ga0160445_107706 | 3300012847 | Bacteria | 1689 |
| 215 | Ga0466690_107941 | 3300042590 | Bacteria | 9527 |
| 216 | Ga0466690_259934 | 3300042590 | Bacteria | 3123 |
| 217 | Ga0466691_058169 | 3300042593 | Bacteria | 2565 |
| 218 | Ga0466691_127807 | 3300042593 | Bacteria | 7974 |
| 219 | Ga0466711_135365 | 3300042615 | Bacteria | 14177 |
| 220 | Ga0466711_343215 | 3300042615 | Bacteria | 7862 |
| 221 | Ga0466715_433984 | 3300042616 | Bacteria | 20767 |
| 222 | Ga0466715_498121 | 3300042616 | Bacteria | 9304 |
| 223 | Ga0466723_304894 | 3300042618 | Bacteria | 2557 |
| 224 | Ga0466726_301209 | 3300042619 | Bacteria | 3085 |
| 225 | Ga0466726_331489 | 3300042619 | Bacteria | 2369 |
| 226 | 2227175255 | 2225789004 | Bacteria | 8139 |
| 227 | IMNBL1DRAFT_c0026593 | 3300000062 | Bacteria | 2193 |
| 228 | JGI24702J35022_10003415 | 3300002462 | Bacteria | 9572 |
| 229 | Ga0068302_10062975 | 3300005071 | Bacteria | 6676 |
| 230 | Ga0068302_10120557 | 3300005071 | Bacteria | 4552 |
| 231 | Ga0466707_144426 | 3300042601 | Bacteria | 7010 |
| 232 | Ga0466713_012647 | 3300042602 | Bacteria | 5255 |
| 233 | Ga0466714_139790 | 3300042603 | Bacteria | 3576 |
| 234 | Ga0466719_079794 | 3300042606 | Bacteria | 11280 |
| 235 | Ga0466719_451744 | 3300042606 | Bacteria | 5915 |
| 236 | Ga0466722_018486 | 3300042609 | Bacteria | 15436 |
| 237 | Ga0466722_033576 | 3300042609 | Bacteria | 25013 |
| 238 | Ga0466722_072523 | 3300042609 | Bacteria | 11555 |
| 239 | Ga0466735_171436 | 3300042624 | Bacteria | 5691 |
| 240 | Ga0466703_071422 | 3300042636 | Bacteria | 20891 |
| 241 | Ga0466703_175205 | 3300042636 | Bacteria | 25111 |
| 242 | Ga0466703_213712 | 3300042636 | Bacteria | 10909 |
| 243 | Ga0466703_241669 | 3300042636 | Bacteria | 2460 |
| 244 | Ga0466709_146490 | 3300042648 | Bacteria | 11034 |
| 245 | Ga0466709_169723 | 3300042648 | Bacteria | 216757 |
| 246 | Ga0466709_332920 | 3300042648 | Bacteria | 5088 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04962 | KduI | KduI/IolB family | 98 | 328 | 0.84 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF04962 | GO:0016861 | intramolecular oxidoreductase activity, interconverting aldoses and ketoses | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.