Protein Family IF10121
Metagenome
Isolate
380
Members
100
Samples
335
Scaffolds
272.01
Avg Length
Representative Sequence
- ID
- 3300042655|Ga0466727_031912|Ga0466727_031912_389_1171
- Length
- 247 aa
- Sequence
- MTPYLPETDVARLCRNLPQGIQEKGREIRTFLPRYGHVNERRNQLHEVIRLSGMNLIINDTDHPLIIKVASIQSARMQIYFIDNEDFEFEDNDERAIFYVRGVFETIKKLRWIPDIVHCHGWLSALAPIYLKRFYDDEPCFNKTKVVYSIYDDAFKNTLNKEIIAKLKHDSISERDLKLIKESADYDAISSLAVQFSDGVIQGSPLISEKVTDFLETTNKPFLPYQNEETYIDAYNDFYDVILKTKK
Sample Types
Isolate
11.8%
Metagenome
88.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
35.4%
Termitidae
26.3%
Kalotermitidae
14.1%
Unclassified
10.1%
Rhinotermitidae
5.1%
Termopsidae
4.0%
Passalidae
3.0%
Hydrophilidae
1.0%
Hodotermitidae
1.0%
Taxonomy
Archaea
0
Bacteria
362
Eukaryota
0
Viruses
0
Unclassified
18
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 2 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 3 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 4 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 15 | 2940193328 | Dysgonomonas sp. PH5-45 | Isolate | Blattidae |
| 16 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 17 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 18 | 3004677695 | Bacteroides sp. 214 | Isolate | Blattidae |
| 19 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 20 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 21 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 22 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 23 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 24 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 25 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 26 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 27 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 28 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 35 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 36 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 39 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 40 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 41 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 42 | 2922326829 | Bacteroides sp. 224 | Isolate | Blattidae |
| 43 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 44 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 45 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 46 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 47 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 48 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 49 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 50 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 51 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 52 | 2830041218 | Bacteroides reticulotermitis DSM 105720 | Isolate | Unclassified |
| 53 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 54 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 55 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 56 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 57 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 58 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 59 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 60 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 61 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 62 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 63 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 64 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 65 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 66 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 67 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 68 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 69 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 70 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 71 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 72 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 73 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 74 | 2940336608 | Dysgonomonas sp. PH5-37 | Isolate | Blattidae |
| 75 | 3004667792 | Bacteroides sp. 519 | Isolate | Blattidae |
| 76 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 77 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 78 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 79 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 80 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 81 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 82 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 83 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 84 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 85 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 86 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 87 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 88 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 89 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 90 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 91 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 92 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 93 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 94 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 95 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 96 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 97 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 98 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 99 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 100 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_274917 | 3300042611 | Bacteria | 203310 |
| 2 | Ga0466733_031638 | 3300042659 | Bacteria | 7205 |
| 3 | Ga0466733_121822 | 3300042659 | Bacteria | 48145 |
| 4 | Ga0466733_212254 | 3300042659 | Bacteria | 7141 |
| 5 | Ga0466690_024508 | 3300042590 | Bacteria | 13532 |
| 6 | Ga0466706_096691 | 3300042599 | Bacteria | 9260 |
| 7 | Ga0466707_191749 | 3300042601 | Bacteria | 9576 |
| 8 | Ga0466707_311460 | 3300042601 | Bacteria | 2136 |
| 9 | Ga0466713_073333 | 3300042602 | Bacteria | 2989 |
| 10 | Ga0466714_062181 | 3300042603 | Bacteria | 13130 |
| 11 | Ga0466719_134791 | 3300042606 | Bacteria | 7475 |
| 12 | Ga0466722_085854 | 3300042609 | Bacteria | 11562 |
| 13 | Ga0123357_10006966 | 3300009784 | Bacteria | 13896 |
| 14 | Ga0123355_10171157 | 3300009826 | Bacteria | 3246 |
| 15 | Ga0123356_10163863 | 3300010049 | Bacteria | 2225 |
| 16 | Ga0123354_10266902 | 3300010882 | Unclassified | 1694 |
| 17 | Ga0466735_008564 | 3300042624 | Bacteria | 6768 |
| 18 | Ga0466735_124140 | 3300042624 | Bacteria | 1932 |
| 19 | Ga0466735_193862 | 3300042624 | Bacteria | 14893 |
| 20 | Ga0466703_145049 | 3300042636 | Bacteria | 8913 |
| 21 | Ga0466703_272350 | 3300042636 | Bacteria | 9162 |
| 22 | Ga0466709_006629 | 3300042648 | Bacteria | 6458 |
| 23 | Ga0466708_040725 | 3300042652 | Bacteria | 8602 |
| 24 | Ga0466705_526893 | 3300042612 | Bacteria | 13073 |
| 25 | Ga0466711_167456 | 3300042615 | Bacteria | 1661 |
| 26 | Ga0466711_502695 | 3300042615 | Bacteria | 19830 |
| 27 | Ga0466715_250172 | 3300042616 | Bacteria | 45297 |
| 28 | Ga0466715_369121 | 3300042616 | Bacteria | 4114 |
| 29 | Ga0466728_187576 | 3300042620 | Bacteria | 41986 |
| 30 | Ga0466728_319385 | 3300042620 | Bacteria | 7399 |
| 31 | 2227139156 | 2225789004 | Bacteria | 8750 |
| 32 | 2227278034 | 2225789004 | Bacteria | 6831 |
| 33 | 2227527114 | 2225789004 | Bacteria | 3226 |
| 34 | IMNBL1DRAFT_c0003018 | 3300000062 | Bacteria | 11146 |
| 35 | JGI24702J35022_10002877 | 3300002462 | Bacteria | 10418 |
| 36 | JGI24705J35276_12207599 | 3300002504 | Bacteria | 1750 |
| 37 | Ga0466697_158180 | 3300042611 | Bacteria | 1698 |
| 38 | Ga0466705_068603 | 3300042612 | Bacteria | 9276 |
| 39 | Ga0466733_221141 | 3300042659 | Bacteria | 323281 |
| 40 | Ga0466656_064295 | 3300042550 | Bacteria | 21933 |
| 41 | Ga0466657_090290 | 3300042582 | Bacteria | 1991 |
| 42 | Ga0466690_002802 | 3300042590 | Bacteria | 5954 |
| 43 | Ga0466690_009119 | 3300042590 | Bacteria | 57867 |
| 44 | Ga0466692_071441 | 3300042591 | Bacteria | 25339 |
| 45 | Ga0466692_202144 | 3300042591 | Bacteria | 41419 |
| 46 | Ga0466693_204060 | 3300042592 | Bacteria | 1266 |
| 47 | Ga0466706_011215 | 3300042599 | Bacteria | 27480 |
| 48 | Ga0466706_137082 | 3300042599 | Bacteria | 8858 |
| 49 | Ga0466700_391349 | 3300042600 | Bacteria | 41227 |
| 50 | Ga0466707_163066 | 3300042601 | Bacteria | 7257 |
| 51 | Ga0466716_021809 | 3300042605 | Bacteria | 14137 |
| 52 | Ga0123357_10071997 | 3300009784 | Unclassified | 4582 |
| 53 | Ga0123353_10066159 | 3300010167 | Bacteria | 5801 |
| 54 | Ga0123354_10108791 | 3300010882 | Unclassified | 3678 |
| 55 | Ga0123354_10159349 | 3300010882 | Bacteria | 2688 |
| 56 | Ga0466734_097939 | 3300042623 | Bacteria | 1890 |
| 57 | Ga0466734_102193 | 3300042623 | Bacteria | 1764 |
| 58 | Ga0466735_154300 | 3300042624 | Bacteria | 1053 |
| 59 | Ga0466704_058422 | 3300042643 | Bacteria | 11898 |
| 60 | Ga0466704_110311 | 3300042643 | Bacteria | 6068 |
| 61 | Ga0466704_383608 | 3300042643 | Bacteria | 3885 |
| 62 | Ga0466708_247211 | 3300042652 | Bacteria | 7042 |
| 63 | Ga0466727_031912 | 3300042655 | Bacteria | 4287 |
| 64 | Ga0466711_001769 | 3300042615 | Bacteria | 11778 |
| 65 | Ga0466715_053948 | 3300042616 | Bacteria | 40558 |
| 66 | Ga0466726_450212 | 3300042619 | Bacteria | 2716 |
| 67 | IMNBL1DRAFT_c0036915 | 3300000062 | Bacteria | 1700 |
| 68 | JGI24705J35276_12229581 | 3300002504 | Bacteria | 3418 |
| 69 | JGI24696J40584_12939631 | 3300002834 | Bacteria | 1658 |
| 70 | JGI24696J40584_12959790 | 3300002834 | Bacteria | 5649 |
| 71 | Ga0466733_054577 | 3300042659 | Bacteria | 1987 |
| 72 | Ga0466733_203606 | 3300042659 | Bacteria | 45615 |
| 73 | Ga0466692_172080 | 3300042591 | Bacteria | 48787 |
| 74 | Ga0466693_423487 | 3300042592 | Unclassified | 2004 |
| 75 | Ga0466691_022308 | 3300042593 | Bacteria | 17018 |
| 76 | Ga0466691_038820 | 3300042593 | Bacteria | 14697 |
| 77 | Ga0466691_092528 | 3300042593 | Bacteria | 24266 |
| 78 | Ga0466695_362886 | 3300042595 | Bacteria | 4401 |
| 79 | Ga0466696_022433 | 3300042596 | Bacteria | 1754 |
| 80 | Ga0466696_160278 | 3300042596 | Bacteria | 1976 |
| 81 | Ga0466706_152258 | 3300042599 | Bacteria | 32723 |
| 82 | Ga0466700_005623 | 3300042600 | Unclassified | 4790 |
| 83 | Ga0466700_044713 | 3300042600 | Bacteria | 11766 |
| 84 | Ga0466713_028910 | 3300042602 | Bacteria | 114900 |
| 85 | Ga0466713_123723 | 3300042602 | Bacteria | 198668 |
| 86 | Ga0466716_011447 | 3300042605 | Bacteria | 8477 |
| 87 | Ga0466722_155398 | 3300042609 | Bacteria | 2624 |
| 88 | Ga0123357_10007204 | 3300009784 | Bacteria | 13703 |
| 89 | Ga0123357_10007678 | 3300009784 | Bacteria | 13381 |
| 90 | Ga0123357_10087630 | 3300009784 | Bacteria | 4071 |
| 91 | Ga0123354_10134083 | 3300010882 | Bacteria | 3108 |
| 92 | Ga0466735_010932 | 3300042624 | Bacteria | 3258 |
| 93 | Ga0466735_021515 | 3300042624 | Bacteria | 1395 |
| 94 | Ga0466735_203939 | 3300042624 | Bacteria | 2443 |
| 95 | Ga0466704_009339 | 3300042643 | Bacteria | 5378 |
| 96 | Ga0466704_033887 | 3300042643 | Bacteria | 25154 |
| 97 | Ga0466704_207298 | 3300042643 | Bacteria | 9662 |
| 98 | Ga0466727_329353 | 3300042655 | Bacteria | 6969 |
| 99 | Ga0466727_341513 | 3300042655 | Bacteria | 6930 |
| 100 | Ga0466705_417481 | 3300042612 | Bacteria | 15438 |
| 101 | Ga0466710_407421 | 3300042613 | Bacteria | 1055 |
| 102 | Ga0466715_198397 | 3300042616 | Bacteria | 21988 |
| 103 | Ga0466726_092517 | 3300042619 | Bacteria | 3032 |
| 104 | Ga0466726_307096 | 3300042619 | Bacteria | 1377 |
| 105 | JGI24702J35022_10004848 | 3300002462 | Bacteria | 7943 |
| 106 | JGI24705J35276_12238474 | 3300002504 | Bacteria | 23401 |
| 107 | Ga0068302_10381202 | 3300005071 | Bacteria | 1660 |
| 108 | Ga0068305_10243088 | 3300005083 | Unclassified | 5213 |
| 109 | Ga0072941_1064694 | 3300005201 | Bacteria | 3658 |
| 110 | Ga0466705_101490 | 3300042612 | Bacteria | 9965 |
| 111 | Ga0466733_030265 | 3300042659 | Bacteria | 9464 |
| 112 | Ga0466733_080482 | 3300042659 | Bacteria | 13561 |
| 113 | Ga0466657_285035 | 3300042582 | Bacteria | 1624 |
| 114 | Ga0466692_181478 | 3300042591 | Bacteria | 49938 |
| 115 | Ga0466706_259371 | 3300042599 | Bacteria | 3201 |
| 116 | Ga0466707_045763 | 3300042601 | Bacteria | 11456 |
| 117 | Ga0466707_130395 | 3300042601 | Bacteria | 8519 |
| 118 | Ga0466714_018302 | 3300042603 | Bacteria | 4071 |
| 119 | Ga0466717_080057 | 3300042604 | Bacteria | 1660 |
| 120 | Ga0466722_097668 | 3300042609 | Bacteria | 4604 |
| 121 | Ga0466722_116546 | 3300042609 | Bacteria | 12995 |
| 122 | Ga0123357_10098231 | 3300009784 | Bacteria | 3785 |
| 123 | Ga0123354_10000186 | 3300010882 | Bacteria | 52457 |
| 124 | Ga0123354_10067476 | 3300010882 | Bacteria | 5210 |
| 125 | Ga0466735_005424 | 3300042624 | Bacteria | 1332 |
| 126 | Ga0466735_043369 | 3300042624 | Bacteria | 2490 |
| 127 | Ga0466735_066141 | 3300042624 | Bacteria | 4125 |
| 128 | Ga0466735_076661 | 3300042624 | Bacteria | 3505 |
| 129 | Ga0466735_169326 | 3300042624 | Bacteria | 2981 |
| 130 | Ga0466703_290532 | 3300042636 | Bacteria | 3116 |
| 131 | Ga0466703_326927 | 3300042636 | Bacteria | 7353 |
| 132 | Ga0466703_360866 | 3300042636 | Bacteria | 3843 |
| 133 | Ga0466727_153444 | 3300042655 | Unclassified | 3127 |
| 134 | Ga0466711_087279 | 3300042615 | Bacteria | 5958 |
| 135 | Ga0466711_209689 | 3300042615 | Bacteria | 4941 |
| 136 | Ga0466711_237585 | 3300042615 | Bacteria | 14562 |
| 137 | Ga0466715_026950 | 3300042616 | Bacteria | 31899 |
| 138 | Ga0466723_182876 | 3300042618 | Bacteria | 1336 |
| 139 | Ga0466726_029527 | 3300042619 | Bacteria | 10448 |
| 140 | Ga0466726_325235 | 3300042619 | Bacteria | 10823 |
| 141 | IMNBL1DRAFT_c0013552 | 3300000062 | Bacteria | 3648 |
| 142 | JGI24702J35022_10001004 | 3300002462 | Bacteria | 17660 |
| 143 | JGI24702J35022_10002533 | 3300002462 | Bacteria | 11121 |
| 144 | JGI24702J35022_10061761 | 3300002462 | Unclassified | 2005 |
| 145 | JGI24702J35022_10157315 | 3300002462 | Bacteria | 1278 |
| 146 | JGI24699J35502_11134172 | 3300002509 | Bacteria | 43867 |
| 147 | Ga0123357_10002567 | 3300009784 | Bacteria | 20362 |
| 148 | Ga0466705_266342 | 3300042612 | Bacteria | 6379 |
| 149 | Ga0466733_180794 | 3300042659 | Bacteria | 1247 |
| 150 | Ga0466733_195509 | 3300042659 | Bacteria | 83582 |
| 151 | Ga0466656_305986 | 3300042550 | Bacteria | 1335 |
| 152 | Ga0466690_055087 | 3300042590 | Bacteria | 12574 |
| 153 | Ga0466690_356823 | 3300042590 | Bacteria | 32247 |
| 154 | Ga0466692_085153 | 3300042591 | Bacteria | 18445 |
| 155 | Ga0466694_228809 | 3300042594 | Bacteria | 1300 |
| 156 | Ga0466696_015989 | 3300042596 | Bacteria | 2240 |
| 157 | Ga0466696_190042 | 3300042596 | Bacteria | 1990 |
| 158 | Ga0466696_364382 | 3300042596 | Bacteria | 3132 |
| 159 | Ga0466706_011362 | 3300042599 | Bacteria | 1086 |
| 160 | Ga0466706_019589 | 3300042599 | Bacteria | 6178 |
| 161 | Ga0466707_409365 | 3300042601 | Bacteria | 15817 |
| 162 | Ga0466713_022445 | 3300042602 | Bacteria | 20407 |
| 163 | Ga0466713_025896 | 3300042602 | Bacteria | 7016 |
| 164 | Ga0466713_029149 | 3300042602 | Bacteria | 36043 |
| 165 | Ga0466713_104639 | 3300042602 | Bacteria | 5178 |
| 166 | Ga0466713_133746 | 3300042602 | Bacteria | 3569 |
| 167 | Ga0466714_169031 | 3300042603 | Bacteria | 152952 |
| 168 | Ga0466716_197646 | 3300042605 | Unclassified | 8249 |
| 169 | Ga0466716_203370 | 3300042605 | Bacteria | 6139 |
| 170 | Ga0466716_520805 | 3300042605 | Bacteria | 2382 |
| 171 | Ga0466719_109361 | 3300042606 | Bacteria | 2116 |
| 172 | Ga0466722_035106 | 3300042609 | Bacteria | 44619 |
| 173 | Ga0466722_147707 | 3300042609 | Bacteria | 3302 |
| 174 | Ga0466722_163171 | 3300042609 | Bacteria | 17818 |
| 175 | Ga0123356_10104603 | 3300010049 | Bacteria | 2722 |
| 176 | Ga0466734_117673 | 3300042623 | Bacteria | 1314 |
| 177 | Ga0466735_001578 | 3300042624 | Bacteria | 2349 |
| 178 | Ga0466735_129950 | 3300042624 | Bacteria | 1262 |
| 179 | Ga0466735_144369 | 3300042624 | Bacteria | 1100 |
| 180 | Ga0466735_230461 | 3300042624 | Bacteria | 2674 |
| 181 | Ga0466703_050101 | 3300042636 | Bacteria | 5056 |
| 182 | Ga0466703_377885 | 3300042636 | Bacteria | 10189 |
| 183 | Ga0466704_095977 | 3300042643 | Bacteria | 7095 |
| 184 | Ga0466709_127753 | 3300042648 | Bacteria | 16389 |
| 185 | Ga0466709_199267 | 3300042648 | Bacteria | 5092 |
| 186 | Ga0466708_435851 | 3300042652 | Bacteria | 53327 |
| 187 | Ga0466725_317005 | 3300042654 | Bacteria | 23315 |
| 188 | Ga0466727_258113 | 3300042655 | Unclassified | 4746 |
| 189 | Ga0466710_240087 | 3300042613 | Bacteria | 2893 |
| 190 | Ga0466710_334126 | 3300042613 | Bacteria | 1569 |
| 191 | Ga0466711_017796 | 3300042615 | Bacteria | 31471 |
| 192 | Ga0466711_171180 | 3300042615 | Bacteria | 3777 |
| 193 | Ga0466711_516285 | 3300042615 | Bacteria | 2122 |
| 194 | Ga0466715_011625 | 3300042616 | Bacteria | 28911 |
| 195 | Ga0466715_318998 | 3300042616 | Bacteria | 47898 |
| 196 | Ga0466715_635823 | 3300042616 | Bacteria | 16106 |
| 197 | Ga0466728_227338 | 3300042620 | Bacteria | 4213 |
| 198 | IMNBL1DRAFT_c0009543 | 3300000062 | Bacteria | 4778 |
| 199 | JGI24702J35022_10001518 | 3300002462 | Bacteria | 14416 |
| 200 | JGI24705J35276_12228456 | 3300002504 | Bacteria | 3189 |
| 201 | JGI24699J35502_11133322 | 3300002509 | Bacteria | 9842 |
| 202 | JGI24699J35502_11134138 | 3300002509 | Bacteria | 36202 |
| 203 | Ga0068305_10009014 | 3300005083 | Bacteria | 53295 |
| 204 | Ga0068305_10031163 | 3300005083 | Bacteria | 1541 |
| 205 | Ga0072941_1110541 | 3300005201 | Bacteria | 2345 |
| 206 | Ga0466697_148699 | 3300042611 | Bacteria | 3724 |
| 207 | Ga0466705_160541 | 3300042612 | Bacteria | 2869 |
| 208 | Ga0466705_311067 | 3300042612 | Unclassified | 1010 |
| 209 | Ga0466733_008840 | 3300042659 | Bacteria | 8408 |
| 210 | Ga0466733_149265 | 3300042659 | Bacteria | 2170 |
| 211 | Ga0466690_111029 | 3300042590 | Bacteria | 12468 |
| 212 | Ga0466690_176920 | 3300042590 | Bacteria | 1562 |
| 213 | Ga0466692_074764 | 3300042591 | Bacteria | 2748 |
| 214 | Ga0466696_013648 | 3300042596 | Bacteria | 29440 |
| 215 | Ga0466696_454197 | 3300042596 | Bacteria | 7974 |
| 216 | Ga0466701_087752 | 3300042598 | Bacteria | 29125 |
| 217 | Ga0466706_091582 | 3300042599 | Bacteria | 9901 |
| 218 | Ga0466706_126477 | 3300042599 | Unclassified | 1817 |
| 219 | Ga0466713_008277 | 3300042602 | Unclassified | 1835 |
| 220 | Ga0466713_020955 | 3300042602 | Bacteria | 68417 |
| 221 | Ga0466713_055966 | 3300042602 | Bacteria | 71857 |
| 222 | Ga0466713_067808 | 3300042602 | Bacteria | 3744 |
| 223 | Ga0466716_015302 | 3300042605 | Bacteria | 2050 |
| 224 | Ga0466719_399586 | 3300042606 | Bacteria | 2077 |
| 225 | Ga0466722_174599 | 3300042609 | Bacteria | 13797 |
| 226 | Ga0123357_10018522 | 3300009784 | Bacteria | 9259 |
| 227 | Ga0123357_10019640 | 3300009784 | Bacteria | 9011 |
| 228 | Ga0123353_10182458 | 3300010167 | Bacteria | 3321 |
| 229 | Ga0466729_257131 | 3300042621 | Bacteria | 17642 |
| 230 | Ga0466731_180613 | 3300042622 | Bacteria | 1042 |
| 231 | Ga0466735_028922 | 3300042624 | Bacteria | 2462 |
| 232 | Ga0466735_037895 | 3300042624 | Bacteria | 4346 |
| 233 | Ga0466735_042678 | 3300042624 | Bacteria | 1118 |
| 234 | Ga0466703_034859 | 3300042636 | Bacteria | 7872 |
| 235 | Ga0466704_194281 | 3300042643 | Bacteria | 10551 |
| 236 | Ga0466709_169139 | 3300042648 | Bacteria | 148698 |
| 237 | Ga0466709_371630 | 3300042648 | Bacteria | 7426 |
| 238 | Ga0466709_375175 | 3300042648 | Bacteria | 3974 |
| 239 | Ga0466727_194876 | 3300042655 | Bacteria | 9204 |
| 240 | Ga0466711_028440 | 3300042615 | Bacteria | 19103 |
| 241 | Ga0466711_083476 | 3300042615 | Bacteria | 22236 |
| 242 | Ga0466715_079574 | 3300042616 | Bacteria | 30299 |
| 243 | Ga0466723_037971 | 3300042618 | Bacteria | 22013 |
| 244 | Ga0466723_057794 | 3300042618 | Bacteria | 23560 |
| 245 | Ga0466726_360841 | 3300042619 | Bacteria | 1445 |
| 246 | Ga0466726_447238 | 3300042619 | Bacteria | 15230 |
| 247 | Ga0466728_346664 | 3300042620 | Bacteria | 1845 |
| 248 | 2227516311 | 2225789004 | Bacteria | 17617 |
| 249 | IMNBL1DRAFT_c0000361 | 3300000062 | Bacteria | 38553 |
| 250 | JGI24702J35022_10037384 | 3300002462 | Bacteria | 2593 |
| 251 | Ga0068302_10155052 | 3300005071 | Bacteria | 3343 |
| 252 | Ga0466705_000936 | 3300042612 | Bacteria | 1281 |
| 253 | Ga0466657_110237 | 3300042582 | Unclassified | 11446 |
| 254 | Ga0466696_278626 | 3300042596 | Bacteria | 1072 |
| 255 | Ga0466696_337794 | 3300042596 | Bacteria | 26646 |
| 256 | Ga0466696_451694 | 3300042596 | Bacteria | 3381 |
| 257 | Ga0466706_188124 | 3300042599 | Bacteria | 3353 |
| 258 | Ga0466707_107489 | 3300042601 | Bacteria | 3046 |
| 259 | Ga0466707_140937 | 3300042601 | Bacteria | 5205 |
| 260 | Ga0466707_214213 | 3300042601 | Bacteria | 9172 |
| 261 | Ga0466707_229461 | 3300042601 | Bacteria | 26081 |
| 262 | Ga0466707_292344 | 3300042601 | Bacteria | 5684 |
| 263 | Ga0466707_359284 | 3300042601 | Bacteria | 2372 |
| 264 | Ga0466707_399219 | 3300042601 | Bacteria | 6187 |
| 265 | Ga0466713_070103 | 3300042602 | Bacteria | 5581 |
| 266 | Ga0466716_098245 | 3300042605 | Bacteria | 7899 |
| 267 | Ga0466716_280844 | 3300042605 | Bacteria | 11537 |
| 268 | Ga0466716_356925 | 3300042605 | Bacteria | 2821 |
| 269 | Ga0466719_236854 | 3300042606 | Bacteria | 8981 |
| 270 | Ga0466719_411089 | 3300042606 | Bacteria | 2330 |
| 271 | Ga0466721_017861 | 3300042608 | Bacteria | 1089 |
| 272 | Ga0466698_247841 | 3300042610 | Bacteria | 3518 |
| 273 | Ga0123357_10012391 | 3300009784 | Bacteria | 10998 |
| 274 | Ga0123353_10294956 | 3300010167 | Bacteria | 2480 |
| 275 | Ga0123353_10568610 | 3300010167 | Bacteria | 1630 |
| 276 | Ga0466729_203998 | 3300042621 | Bacteria | 7608 |
| 277 | Ga0466735_099486 | 3300042624 | Bacteria | 2396 |
| 278 | Ga0466703_245328 | 3300042636 | Bacteria | 15904 |
| 279 | Ga0466704_013858 | 3300042643 | Bacteria | 11133 |
| 280 | Ga0466704_040810 | 3300042643 | Bacteria | 25809 |
| 281 | Ga0466704_083039 | 3300042643 | Bacteria | 3616 |
| 282 | Ga0466727_325423 | 3300042655 | Bacteria | 3170 |
| 283 | Ga0466705_474744 | 3300042612 | Unclassified | 4925 |
| 284 | Ga0466710_268655 | 3300042613 | Bacteria | 6853 |
| 285 | Ga0466710_386999 | 3300042613 | Bacteria | 1423 |
| 286 | Ga0466711_484135 | 3300042615 | Bacteria | 6514 |
| 287 | Ga0466715_257264 | 3300042616 | Bacteria | 11253 |
| 288 | Ga0466715_514362 | 3300042616 | Bacteria | 34842 |
| 289 | Ga0466723_252544 | 3300042618 | Bacteria | 3124 |
| 290 | 2227008133 | 2225789003 | Bacteria | 27701 |
| 291 | 2227219701 | 2225789004 | Bacteria | 7501 |
| 292 | IMNBL1DRAFT_c0000568 | 3300000062 | Bacteria | 29871 |
| 293 | IMNBL1DRAFT_c0014325 | 3300000062 | Bacteria | 3506 |
| 294 | JGI24702J35022_10039969 | 3300002462 | Bacteria | 2502 |
| 295 | Ga0068305_10044024 | 3300005083 | Bacteria | 5850 |
| 296 | Ga0068305_10068054 | 3300005083 | Unclassified | 3952 |
| 297 | Ga0466705_015265 | 3300042612 | Bacteria | 2978 |
| 298 | Ga0466705_123875 | 3300042612 | Bacteria | 23493 |
| 299 | Ga0466690_095218 | 3300042590 | Bacteria | 2578 |
| 300 | Ga0466691_035788 | 3300042593 | Bacteria | 6550 |
| 301 | Ga0466694_321279 | 3300042594 | Bacteria | 4629 |
| 302 | Ga0466696_302479 | 3300042596 | Bacteria | 58494 |
| 303 | Ga0466696_451349 | 3300042596 | Bacteria | 4010 |
| 304 | Ga0466696_502278 | 3300042596 | Bacteria | 10733 |
| 305 | Ga0466701_017207 | 3300042598 | Bacteria | 16192 |
| 306 | Ga0466713_131209 | 3300042602 | Bacteria | 23837 |
| 307 | Ga0466716_010882 | 3300042605 | Bacteria | 10392 |
| 308 | Ga0466719_442711 | 3300042606 | Bacteria | 4014 |
| 309 | Ga0466722_022833 | 3300042609 | Unclassified | 2608 |
| 310 | Ga0123353_10128320 | 3300010167 | Bacteria | 4072 |
| 311 | Ga0123353_10482003 | 3300010167 | Bacteria | 1814 |
| 312 | Ga0123354_10045962 | 3300010882 | Bacteria | 6676 |
| 313 | Ga0466735_137363 | 3300042624 | Bacteria | 3164 |
| 314 | Ga0466735_172341 | 3300042624 | Bacteria | 5074 |
| 315 | Ga0466735_214576 | 3300042624 | Bacteria | 3558 |
| 316 | Ga0466735_235166 | 3300042624 | Bacteria | 8885 |
| 317 | Ga0466703_183341 | 3300042636 | Bacteria | 11206 |
| 318 | Ga0466703_412992 | 3300042636 | Unclassified | 2143 |
| 319 | Ga0466709_159970 | 3300042648 | Bacteria | 21375 |
| 320 | Ga0466708_295001 | 3300042652 | Bacteria | 12213 |
| 321 | Ga0466725_017902 | 3300042654 | Bacteria | 3863 |
| 322 | Ga0466725_084562 | 3300042654 | Bacteria | 24813 |
| 323 | Ga0466727_012578 | 3300042655 | Bacteria | 8903 |
| 324 | Ga0466727_033053 | 3300042655 | Bacteria | 32312 |
| 325 | Ga0466711_240304 | 3300042615 | Bacteria | 25453 |
| 326 | Ga0466715_306222 | 3300042616 | Bacteria | 2707 |
| 327 | Ga0466723_257060 | 3300042618 | Bacteria | 14108 |
| 328 | Ga0466723_283671 | 3300042618 | Bacteria | 34853 |
| 329 | Ga0466729_114275 | 3300042621 | Bacteria | 1159 |
| 330 | 2227172487 | 2225789004 | Bacteria | 8167 |
| 331 | IMNBL1DRAFT_c0002390 | 3300000062 | Bacteria | 13072 |
| 332 | JGI24702J35022_10004703 | 3300002462 | Bacteria | 8086 |
| 333 | Ga0068305_10015452 | 3300005083 | Bacteria | 2932 |
| 334 | Ga0068305_10026508 | 3300005083 | Bacteria | 11263 |
| 335 | Ga0123357_10000612 | 3300009784 | Bacteria | 35430 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08323 | Glyco_transf_5 | Starch synthase catalytic domain | 2 | 211 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.