Protein Family IF10107
Metagenome
Isolate
213
Members
137
Samples
152
Scaffolds
215.76
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_441256|Ga0466725_441256_3915_4679
- Length
- 254 aa
- Sequence
- MRIGMVCRARLVRFSSFLCPFCTAPFLFGTESRILRRFPASPSVVKKADIAQFYSRLQAANPAPTTELGYATPFQLLVAVILSAQATDISVNKATKKLFAVAPTPETLLALGVEGLTEYIRAIGLYRTKAKNLIATCQLLLERHGGAVPATRAALEALPGVGRKTANVVLNTAFGQPTIAVDTHIFRVSNRTGLAPGKTVGEVEAKLLRVTPGEFRQNAHHWLILHGRYICKARQPECPRCPVADLCAWPDKTA
Sample Types
Isolate
28.6%
Metagenome
71.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Formicidae
12.6%
Apidae
11.8%
Culicidae
10.2%
Kalotermitidae
10.2%
Elmidae
9.4%
Termitidae
8.7%
Unclassified
7.9%
Coreidae
7.1%
Armadillidiidae
5.5%
Curculionidae
4.7%
Rhinotermitidae
2.4%
Largidae
1.6%
Trigoniulidae
0.8%
Drosophilidae
0.8%
Sarcophagidae
0.8%
Hydrophilidae
0.8%
Passalidae
0.8%
Hodotermitidae
0.8%
Cixiidae
0.8%
Termopsidae
0.8%
Siricidae
0.8%
Crambidae
0.8%
Taxonomy
Archaea
0
Bacteria
187
Eukaryota
0
Viruses
0
Unclassified
26
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 2 | 2820084079 | Unclassified Proteobacteria Lab288P4bin103 | Isolate | Unclassified |
| 3 | 2837560943 | Snodgrassella alvi HK3 | Isolate | Apidae |
| 4 | 2846370940 | Snodgrassella alvi Nev3CBA3 | Isolate | Apidae |
| 5 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 6 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 7 | 3300000460 | Honey bee gut microbial communities from West Haven, Conneticut, USA - Snodgrassella SCG AB-598-O02 | Metagenome | Apidae |
| 8 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 13 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 14 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 15 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 20 | 2846359427 | Snodgrassella alvi wkB273 | Isolate | Apidae |
| 21 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 22 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 23 | 2864914039 | Chromobacterium alkanivorans S00172 | Isolate | Elmidae |
| 24 | 2864988360 | Chromobacterium alkanivorans S00296 | Isolate | Elmidae |
| 25 | 2868464004 | Snodgrassella alvi Pens2-2-5 | Isolate | Apidae |
| 26 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 27 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 28 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 29 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 30 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 31 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 32 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 35 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 36 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 37 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 38 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 39 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 40 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 41 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 42 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 43 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 46 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 47 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 48 | 2820086750 | Unclassified Proteobacteria Lab288P3bin98 | Isolate | Unclassified |
| 49 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 50 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 51 | 2963630348 | Burkholderiales bacterium 3487_49 | Isolate | Formicidae |
| 52 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 53 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 54 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 55 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 56 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 57 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 58 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 59 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 60 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 61 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 62 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 63 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 64 | 2857827427 | Snodgrassella alvi App6-4 | Isolate | Apidae |
| 65 | 2857832487 | Snodgrassella alvi HK9x | Isolate | Apidae |
| 66 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 67 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 68 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 69 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 70 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 71 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 72 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 73 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 74 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 75 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 76 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 77 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 78 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 79 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 80 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 81 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 82 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 83 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 84 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 85 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 86 | 2603880165 | Burkholderiales A1 | Isolate | Unclassified |
| 87 | 2603880170 | Burkholderiales A2 | Isolate | Unclassified |
| 88 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 89 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 90 | 2843301220 | Snodgrassella alvi Nev4-2 | Isolate | Apidae |
| 91 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 92 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 93 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 94 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 95 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 96 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 97 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 98 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 99 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 100 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 101 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 102 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 103 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 104 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 105 | 2846376288 | Snodgrassella alvi Fer4-2 | Isolate | Apidae |
| 106 | 2846379220 | Snodgrassella alvi wkB237 | Isolate | Apidae |
| 107 | 2849409164 | Snodgrassella alvi wkB298 | Isolate | Apidae |
| 108 | 2857837414 | Snodgrassella alvi App4-8 | Isolate | Apidae |
| 109 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 110 | 2864859030 | Chromobacterium alkanivorans S00115 | Isolate | Elmidae |
| 111 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 112 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 113 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 114 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 115 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 116 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 117 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 118 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 119 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 120 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 121 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 122 | 2848751009 | Snodgrassella alvi App2-2 | Isolate | Apidae |
| 123 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 124 | 2857845033 | Snodgrassella alvi WF3-3 | Isolate | Apidae |
| 125 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 126 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 127 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 128 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 129 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 130 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 131 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 132 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 133 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 134 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 135 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 136 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 137 | 8035422605 | Pseudomonas monteilii CY06 | Isolate |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466701_051965 | 3300042598 | Bacteria | 80920 |
| 2 | Ga0466716_154689 | 3300042605 | Bacteria | 9071 |
| 3 | Ga0160468_100926 | 3300012819 | Bacteria | 8993 |
| 4 | Ga0160460_101452 | 3300012845 | Bacteria | 7894 |
| 5 | Ga0160436_1000341 | 3300012861 | Bacteria | 19837 |
| 6 | Ga0160470_100004 | 3300012813 | Bacteria | 774596 |
| 7 | DPO_contig07475 | 2032320009 | Unclassified | 2433 |
| 8 | SPBB_contig11574 | 2044078006 | Bacteria | 32299 |
| 9 | FGTW_contig30576 | 2065487013 | Bacteria | 10685 |
| 10 | CVPL005L_10002562 | 3300002938 | Bacteria | 20711 |
| 11 | Ga0103265_1013677 | 3300007068 | Bacteria | 1059 |
| 12 | Ga0102739_1001697 | 3300007095 | Bacteria | 3575 |
| 13 | Ga0102740_1000282 | 3300007140 | Bacteria | 14469 |
| 14 | Ga0103264_1000051 | 3300007188 | Bacteria | 66591 |
| 15 | Ga0103264_1003272 | 3300007188 | Bacteria | 7450 |
| 16 | Ga0103267_1000609 | 3300007190 | Bacteria | 10289 |
| 17 | Ga0466724_14987 | 3300042649 | Unclassified | 2908 |
| 18 | Ga0466715_539183 | 3300042616 | Bacteria | 8328 |
| 19 | Ga0466706_266474 | 3300042599 | Bacteria | 7780 |
| 20 | Ga0466707_031203 | 3300042601 | Bacteria | 2041 |
| 21 | Ga0466719_156587 | 3300042606 | Bacteria | 2547 |
| 22 | Ga0160431_100835 | 3300012828 | Unclassified | 10155 |
| 23 | Ga0160467_105942 | 3300012829 | Bacteria | 1466 |
| 24 | Ga0160472_111549 | 3300012839 | Bacteria | 1051 |
| 25 | Ga0160433_100029 | 3300012846 | Bacteria | 174368 |
| 26 | Ga0160447_100518 | 3300012849 | Bacteria | 17949 |
| 27 | Ga0160448_102635 | 3300012854 | Unclassified | 5460 |
| 28 | Ga0160435_1000559 | 3300012857 | Bacteria | 11500 |
| 29 | Ga0466690_420604 | 3300042590 | Bacteria | 2140 |
| 30 | Ga0466691_177819 | 3300042593 | Bacteria | 6439 |
| 31 | SWWA_contig20413__length_8443___numreads_569 | 2100351016 | Bacteria | 8443 |
| 32 | SCG598O02_12421 | 3300000460 | Bacteria | 39571 |
| 33 | Meta3P_1000976 | 3300002464 | Unclassified | 31445 |
| 34 | CVPL010W_10016854 | 3300002931 | Bacteria | 4857 |
| 35 | Ga0466730_058467 | 3300042625 | Unclassified | 3394 |
| 36 | Ga0466704_089065 | 3300042643 | Bacteria | 7196 |
| 37 | Ga0466709_341489 | 3300042648 | Bacteria | 1030 |
| 38 | Ga0466724_57189 | 3300042649 | Unclassified | 9554 |
| 39 | Ga0466710_079746 | 3300042613 | Bacteria | 12152 |
| 40 | Ga0466710_376006 | 3300042613 | Bacteria | 1217 |
| 41 | Ga0160470_102627 | 3300012813 | Bacteria | 3276 |
| 42 | Ga0160458_100168 | 3300012832 | Bacteria | 52712 |
| 43 | Ga0160452_100076 | 3300012834 | Bacteria | 131624 |
| 44 | Ga0160472_111074 | 3300012839 | Unclassified | 1091 |
| 45 | Ga0160445_100042 | 3300012847 | Bacteria | 161501 |
| 46 | Ga0160447_101988 | 3300012849 | Bacteria | 7510 |
| 47 | Ga0160448_125089 | 3300012854 | Unclassified | 915 |
| 48 | Ga0160435_1000249 | 3300012857 | Bacteria | 24871 |
| 49 | Ga0160435_1014230 | 3300012857 | Unclassified | 1552 |
| 50 | Ga0466696_124398 | 3300042596 | Bacteria | 4904 |
| 51 | Ga0466696_235032 | 3300042596 | Bacteria | 4275 |
| 52 | Ga0123356_10089736 | 3300010049 | Bacteria | 2925 |
| 53 | CVPL005W_1000973 | 3300002934 | Bacteria | 8868 |
| 54 | CVPL005L_10004720 | 3300002938 | Bacteria | 20576 |
| 55 | Ga0103261_1000885 | 3300007083 | Bacteria | 4645 |
| 56 | Ga0102734_1000352 | 3300007129 | Bacteria | 24070 |
| 57 | Ga0102737_1000610 | 3300007142 | Bacteria | 11596 |
| 58 | Ga0466704_432354 | 3300042643 | Bacteria | 12264 |
| 59 | Ga0466704_618752 | 3300042643 | Bacteria | 1121 |
| 60 | Ga0466724_58229 | 3300042649 | Unclassified | 2906 |
| 61 | Ga0466708_405070 | 3300042652 | Bacteria | 11366 |
| 62 | Ga0466705_136926 | 3300042612 | Bacteria | 1633 |
| 63 | Ga0466710_348801 | 3300042613 | Bacteria | 54409 |
| 64 | Ga0466711_166087 | 3300042615 | Bacteria | 7298 |
| 65 | Ga0466729_099475 | 3300042621 | Unclassified | 4395 |
| 66 | Ga0466701_032744 | 3300042598 | Bacteria | 1219 |
| 67 | Ga0160456_100005 | 3300012820 | Bacteria | 551832 |
| 68 | Ga0160446_105062 | 3300012835 | Bacteria | 1916 |
| 69 | Ga0160460_100034 | 3300012845 | Bacteria | 302992 |
| 70 | Ga0160447_100825 | 3300012849 | Bacteria | 13357 |
| 71 | Ga0160448_111082 | 3300012854 | Bacteria | 1862 |
| 72 | Ga0466701_004861 | 3300042598 | Bacteria | 162026 |
| 73 | Ga0074278_140205 | 3300005721 | Unclassified | 4847 |
| 74 | Ga0102740_1000683 | 3300007140 | Bacteria | 9174 |
| 75 | Ga0103267_1000331 | 3300007190 | Bacteria | 20533 |
| 76 | Ga0466708_067205 | 3300042652 | Bacteria | 1852 |
| 77 | Ga0466708_091077 | 3300042652 | Bacteria | 2367 |
| 78 | Ga0466725_441256 | 3300042654 | Bacteria | 12497 |
| 79 | Ga0466715_231608 | 3300042616 | Bacteria | 59291 |
| 80 | Ga0466715_290929 | 3300042616 | Bacteria | 1184 |
| 81 | Ga0466718_098443 | 3300042617 | Bacteria | 3250 |
| 82 | Ga0160440_100990 | 3300012815 | Unclassified | 4750 |
| 83 | Ga0160452_100303 | 3300012834 | Unclassified | 44705 |
| 84 | Ga0160446_100179 | 3300012835 | Bacteria | 46458 |
| 85 | Ga0160472_100930 | 3300012839 | Bacteria | 11210 |
| 86 | Ga0160433_100097 | 3300012846 | Bacteria | 88061 |
| 87 | Ga0160443_100379 | 3300012848 | Bacteria | 37247 |
| 88 | Ga0160434_103847 | 3300012850 | Bacteria | 2523 |
| 89 | Ga0123354_10000573 | 3300010882 | Bacteria | 38028 |
| 90 | IMNBGM34_c000110 | 3300000036 | Bacteria | 23154 |
| 91 | CVPL010W_10004767 | 3300002931 | Bacteria | 14889 |
| 92 | Ga0102735_1002199 | 3300007080 | Bacteria | 3055 |
| 93 | Ga0103261_1000503 | 3300007083 | Bacteria | 6010 |
| 94 | Ga0104042_1001086 | 3300007130 | Bacteria | 4971 |
| 95 | Ga0103264_1001817 | 3300007188 | Bacteria | 9825 |
| 96 | Ga0466725_046692 | 3300042654 | Bacteria | 1377 |
| 97 | Ga0466725_337112 | 3300042654 | Bacteria | 15156 |
| 98 | Ga0466701_042194 | 3300042598 | Bacteria | 63325 |
| 99 | Ga0466719_323500 | 3300042606 | Bacteria | 2091 |
| 100 | Ga0160467_100774 | 3300012829 | Bacteria | 22196 |
| 101 | Ga0160445_100640 | 3300012847 | Bacteria | 14656 |
| 102 | Ga0160434_100013 | 3300012850 | Bacteria | 242456 |
| 103 | Ga0160436_1009581 | 3300012861 | Bacteria | 2138 |
| 104 | Ga0466691_046464 | 3300042593 | Bacteria | 6731 |
| 105 | Ga0123356_10016558 | 3300010049 | Bacteria | 7029 |
| 106 | Ga0160454_100367 | 3300012798 | Unclassified | 27072 |
| 107 | DPOL_contig19986 | 2035918003 | Unclassified | 43091 |
| 108 | Ga0102736_1000963 | 3300007052 | Bacteria | 7166 |
| 109 | Ga0466734_037350 | 3300042623 | Bacteria | 3799 |
| 110 | Ga0466723_201300 | 3300042618 | Bacteria | 6048 |
| 111 | Ga0466726_457819 | 3300042619 | Bacteria | 5002 |
| 112 | Ga0466706_041353 | 3300042599 | Bacteria | 5011 |
| 113 | Ga0466707_256275 | 3300042601 | Bacteria | 4873 |
| 114 | Ga0160456_100106 | 3300012820 | Bacteria | 94170 |
| 115 | Ga0160441_100480 | 3300012825 | Unclassified | 29219 |
| 116 | Ga0160467_103339 | 3300012829 | Unclassified | 2785 |
| 117 | Ga0160457_1020722 | 3300012858 | Bacteria | 922 |
| 118 | Ga0160436_1007512 | 3300012861 | Bacteria | 2482 |
| 119 | Ga0466657_033989 | 3300042582 | Bacteria | 5286 |
| 120 | Ga0466657_036034 | 3300042582 | Bacteria | 3014 |
| 121 | Ga0466692_146691 | 3300042591 | Bacteria | 10903 |
| 122 | Ga0466692_199390 | 3300042591 | Bacteria | 3693 |
| 123 | CVPL010W_10004120 | 3300002931 | Bacteria | 16303 |
| 124 | CVPL005W_1000030 | 3300002934 | Bacteria | 54553 |
| 125 | Ga0103266_1000211 | 3300007067 | Bacteria | 16285 |
| 126 | Ga0102735_1000011 | 3300007080 | Bacteria | 55074 |
| 127 | Ga0103268_1000369 | 3300007192 | Bacteria | 14276 |
| 128 | Ga0466734_006805 | 3300042623 | Bacteria | 19202 |
| 129 | Ga0466704_278379 | 3300042643 | Bacteria | 1136 |
| 130 | Ga0466724_59653 | 3300042649 | Unclassified | 10015 |
| 131 | Ga0466708_225063 | 3300042652 | Bacteria | 27011 |
| 132 | Ga0466715_464459 | 3300042616 | Bacteria | 1878 |
| 133 | Ga0466728_429669 | 3300042620 | Bacteria | 3868 |
| 134 | Ga0466701_079388 | 3300042598 | Bacteria | 130298 |
| 135 | Ga0466701_097634 | 3300042598 | Bacteria | 1046 |
| 136 | Ga0160441_101162 | 3300012825 | Bacteria | 10011 |
| 137 | Ga0466657_269454 | 3300042582 | Bacteria | 38504 |
| 138 | Ga0466692_144837 | 3300042591 | Bacteria | 22950 |
| 139 | Ga0160442_100079 | 3300012806 | Unclassified | 121922 |
| 140 | Ga0160471_101927 | 3300012812 | Unclassified | 3714 |
| 141 | DPO_contig06082 | 2032320009 | Unclassified | 13880 |
| 142 | SPBB_contig00841 | 2044078006 | Bacteria | 1362 |
| 143 | SPBB_contig11623 | 2044078006 | Bacteria | 14190 |
| 144 | JGI24699J35502_10961769 | 3300002509 | Bacteria | 1206 |
| 145 | CVPL005W_1000517 | 3300002934 | Unclassified | 14802 |
| 146 | Ga0103266_1000413 | 3300007067 | Bacteria | 23160 |
| 147 | Ga0102739_1002366 | 3300007095 | Unclassified | 2918 |
| 148 | Ga0102734_1006783 | 3300007129 | Bacteria | 2575 |
| 149 | Ga0102740_1004843 | 3300007140 | Bacteria | 2614 |
| 150 | Ga0102737_1000409 | 3300007142 | Unclassified | 14335 |
| 151 | Ga0103264_1000675 | 3300007188 | Bacteria | 16152 |
| 152 | Ga0466724_05035 | 3300042649 | Bacteria | 102670 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00730 | GO:0006284 | base-excision repair | BP |
| PF00633 | GO:0003677 | DNA binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.