Protein Family IF10105
Metagenome
Isolate
256
Members
161
Samples
155
Scaffolds
311.6
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_432863|Ga0466725_432863_6875_7969
- Length
- 364 aa
- Sequence
- MATVHKVLTQFFSLNAFGDFSQKPRKFACRFNFCFAKDAQELVRTMLCTVTKYANGGKIMSKIVVALGGNALGDNVTQQLANAKLAAASXXDLAAAGHSVVVAHGNGPQVGAIKMALDAGGFVVPMPECTAMSQGYIGFHLQQSLGNELAARGVKRQVATVLTQVVVDKNDPAFANPTKPIGAYYDETAAKELMAQTGKTYVEDAGRGWRWVVPSPLPVDIREAASIKFLSDNDFMVIACGGGGMPVVAEDGGFAGIDAVIDKDFASAKMAELIDADVLVILTAVDRVKINFNKPDEKSLDTLTVAQAQKYADEGHFAKGSMLPKVQAAIKFARGGGGRKAIIGSLEQAAAAIAGQSGTTIVKE
Sample Types
Isolate
39.5%
Metagenome
60.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
36.0%
Termitidae
15.3%
Formicidae
10.0%
Kalotermitidae
7.3%
Tenebrionidae
5.3%
Apidae
4.7%
Blattidae
4.0%
Argasidae
2.7%
Rhinotermitidae
2.0%
Scarabaeidae
1.3%
Hydrophilidae
1.3%
Termopsidae
1.3%
Ixodidae
1.3%
Passalidae
1.3%
Ceratopogonidae
0.7%
Gomphidae
0.7%
Elmidae
0.7%
Vespidae
0.7%
Stratiomyidae
0.7%
Hodotermitidae
0.7%
Rhaphidophoridae
0.7%
Culicidae
0.7%
Drosophilidae
0.7%
Taxonomy
Archaea
1
Bacteria
239
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820838073 | Unclassified Actinobacteria Lab288P4bin27 | Isolate | Unclassified |
| 2 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 3 | 2856960404 | Pseudonocardia sp. Ae706_Ps2 | Isolate | Formicidae |
| 4 | 2856973192 | Pseudonocardia sp. Ae331_Ps2 | Isolate | Formicidae |
| 5 | 2859970369 | Pseudonocardia sp. Ae717_Ps2 | Isolate | Formicidae |
| 6 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 7 | 2931425734 | Nocardioides sp. J2M5 | Isolate | |
| 8 | 2547132042 | Pseudonocardia sp. P2 | Isolate | Formicidae |
| 9 | 2565956565 | Borrelia coriaceae Co53 | Isolate | Argasidae |
| 10 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 11 | 2820411483 | Unclassified Firmicutes Lab288P4bin76 | Isolate | Unclassified |
| 12 | 2820499546 | Unclassified Firmicutes Lab288P1bin54 | Isolate | Unclassified |
| 13 | 2820596822 | Unclassified Firmicutes Emb289P1bin58 | Isolate | Unclassified |
| 14 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 20 | 2820866620 | Unclassified Actinobacteria Lab288P3bin139 | Isolate | Unclassified |
| 21 | 2820906387 | Unclassified Actinobacteria Emb289P4bin41 | Isolate | Unclassified |
| 22 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 23 | 2914375287 | Culicoidibacter larvae CS-1 | Isolate | Ceratopogonidae |
| 24 | 2758568505 | Lactobacillus bombicola ESL0225 | Isolate | Unclassified |
| 25 | 2820479655 | Unclassified Firmicutes Lab288P1bin77 | Isolate | Unclassified |
| 26 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 29 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 30 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 34 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 35 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 36 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 37 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 38 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 39 | 2856882415 | Pseudonocardia sp. Ae406_Ps2 | Isolate | Formicidae |
| 40 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 41 | 2873589062 | Phycicoccus sp. HDW14 | Isolate | Hydrophilidae |
| 42 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 43 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 44 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 45 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 46 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 47 | 2758568501 | Lactobacillus bombicola ESL0228 | Isolate | Unclassified |
| 48 | 2758568502 | Lactobacillus bombicola ESL0247 | Isolate | Unclassified |
| 49 | 2758568503 | Lactobacillus bombicola ESL0246 | Isolate | Unclassified |
| 50 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 51 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 52 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 53 | 2775507261 | Borrelia turicatae 91E135 | Isolate | Argasidae |
| 54 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 55 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 56 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 57 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 58 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 59 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 60 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 61 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 62 | 8004832522 | Lactobacillus sp. ESL0236 | Isolate | Apidae |
| 63 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 64 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 65 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 66 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 67 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 68 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 69 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 70 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 71 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 72 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 73 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 74 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 75 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 76 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 77 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 78 | 2820823448 | Unclassified Actinobacteria Nt197P3bin113 | Isolate | Unclassified |
| 79 | 2545555866 | Borrelia coriaceae ATCC 43381 | Isolate | Argasidae |
| 80 | 2758568506 | Lactobacillus bombicola ESL0230 | Isolate | Unclassified |
| 81 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 82 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 83 | 2820598593 | Unclassified Firmicutes Emb289P1bin53 | Isolate | Unclassified |
| 84 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 85 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 86 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 87 | 8012935351 | Brevibacterium epidermidis UD i117 | Isolate | Unclassified |
| 88 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 89 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 90 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 91 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 92 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 93 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 94 | 2958885890 | Lactobacillus sp. ESL0234 | Isolate | Apidae |
| 95 | 2961465228 | Lactobacillus sp. ESL0233 | Isolate | Apidae |
| 96 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 97 | 2758568507 | Lactobacillus bombicola ESL0237 | Isolate | Unclassified |
| 98 | 2758568508 | Lactobacillus bombicola ESL0236 | Isolate | Unclassified |
| 99 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 100 | 2820389254 | Unclassified Firmicutes Nc150P4bin19 | Isolate | Unclassified |
| 101 | 2820537337 | Unclassified Firmicutes Lab288P1bin137 | Isolate | Unclassified |
| 102 | 8114010755 | Borrelia coriaceae Co53 | Isolate | Argasidae |
| 103 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 104 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 105 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 106 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 107 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 108 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 109 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 110 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 111 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 112 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 113 | 2968368220 | Lactobacillus bombicola OCC3 | Isolate | Apidae |
| 114 | 2971062614 | Lactobacillus bombicola BI-4G | Isolate | Apidae |
| 115 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 116 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 117 | 2896402965 | Weissella diestrammenae KACC 16890 | Isolate | Rhaphidophoridae |
| 118 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 119 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 120 | 2758568509 | Lactobacillus bombicola ESL0234 | Isolate | Unclassified |
| 121 | 2758568510 | Lactobacillus bombicola ESL0233 | Isolate | Unclassified |
| 122 | 2820369699 | Unclassified Firmicutes Nt197P3bin103 | Isolate | Unclassified |
| 123 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 124 | 2820724199 | Unclassified Cloacimonetes Th196P3bin22 | Isolate | Unclassified |
| 125 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 126 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 127 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 128 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 129 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 130 | 3300026175 | Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 | Metagenome | Formicidae |
| 131 | 2856954254 | Pseudonocardia sp. Ae505_Ps2 | Isolate | Formicidae |
| 132 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 133 | 2758568504 | Lactobacillus bombicola ESL0245 | Isolate | Unclassified |
| 134 | 2820459456 | Unclassified Firmicutes Lab288P3bin148 | Isolate | Unclassified |
| 135 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 136 | 2820647881 | Unclassified Firmicutes Cu122P5bin16 | Isolate | Unclassified |
| 137 | 2820681712 | Unclassified Firmicutes Co191P1bin84 | Isolate | Unclassified |
| 138 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 139 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 140 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 141 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 142 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 143 | 2848878685 | Borrelia miyamotoi CA17-2241 | Isolate | Ixodidae |
| 144 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 145 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 146 | 2820619171 | Unclassified Firmicutes Emb289P1bin130 | Isolate | Unclassified |
| 147 | 2718218422 | Borrelia miyamotoi CT13-2396 | Isolate | Ixodidae |
| 148 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 149 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 150 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 151 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 152 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 153 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 154 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 155 | 8017440191 | Lactobacillus bombicola L5-31 | Isolate | Apidae |
| 156 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 157 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 158 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 159 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 160 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 161 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_087809 | 3300042659 | Bacteria | 3244 |
| 2 | Ga0562379_0092 | 3300056790 | Bacteria | 317609 |
| 3 | Ga0562379_1345 | 3300056790 | Bacteria | 29065 |
| 4 | Ga0562377_0040 | 3300056842 | Bacteria | 613468 |
| 5 | Ga0562374_0022 | 3300057007 | Bacteria | 1083986 |
| 6 | Ga0562374_3302 | 3300057007 | Unclassified | 9687 |
| 7 | Ga0123355_10550161 | 3300009826 | Bacteria | 1396 |
| 8 | Ga0123356_10002098 | 3300010049 | Bacteria | 21502 |
| 9 | Ga0123356_10752006 | 3300010049 | Bacteria | 1145 |
| 10 | Ga0123353_10042794 | 3300010167 | Unclassified | 7168 |
| 11 | Ga0466700_470039 | 3300042600 | Bacteria | 7471 |
| 12 | Ga0466707_277810 | 3300042601 | Bacteria | 20537 |
| 13 | Ga0466713_107250 | 3300042602 | Bacteria | 117772 |
| 14 | Ga0466714_052888 | 3300042603 | Unclassified | 1748 |
| 15 | Ga0466715_395694 | 3300042616 | Bacteria | 34108 |
| 16 | Ga0466708_301966 | 3300042652 | Bacteria | 4736 |
| 17 | Ga0466696_493622 | 3300042596 | Bacteria | 5002 |
| 18 | Ga0530661_000784 | 3300056564 | Unclassified | 20266 |
| 19 | Ga0562378_0427 | 3300056814 | Unclassified | 75062 |
| 20 | Ga0562377_0237 | 3300056842 | Bacteria | 130479 |
| 21 | Ga0562374_0196 | 3300057007 | Unclassified | 130686 |
| 22 | Ga0123357_10070001 | 3300009784 | Bacteria | 4662 |
| 23 | Ga0123355_10000238 | 3300009826 | Bacteria | 70491 |
| 24 | Ga0123355_10100101 | 3300009826 | Bacteria | 4566 |
| 25 | Ga0123354_10073455 | 3300010882 | Unclassified | 4911 |
| 26 | JGI24702J35022_10007200 | 3300002462 | Bacteria | 6396 |
| 27 | Meta3P_1000869 | 3300002464 | Bacteria | 44072 |
| 28 | Ga0103264_1000026 | 3300007188 | Bacteria | 92644 |
| 29 | Ga0466717_026851 | 3300042604 | Bacteria | 1392 |
| 30 | Ga0466725_432863 | 3300042654 | Bacteria | 12232 |
| 31 | Ga0415639_072992 | 3300038395 | Unclassified | 1784 |
| 32 | Ga0466656_080481 | 3300042550 | Bacteria | 1218 |
| 33 | Ga0562377_0078 | 3300056842 | Bacteria | 380003 |
| 34 | Ga0562377_2383 | 3300056842 | Unclassified | 14301 |
| 35 | Ga0562374_0014 | 3300057007 | Bacteria | 1241908 |
| 36 | Ga0123356_10046008 | 3300010049 | Bacteria | 4060 |
| 37 | Ga0123356_10423529 | 3300010049 | Bacteria | 1474 |
| 38 | Ga0123356_10436075 | 3300010049 | Bacteria | 1455 |
| 39 | Ga0123353_10032510 | 3300010167 | Bacteria | 8102 |
| 40 | Ga0102735_1000253 | 3300007080 | Bacteria | 23452 |
| 41 | Ga0466700_396789 | 3300042600 | Archaea | 1572 |
| 42 | Ga0466707_155385 | 3300042601 | Bacteria | 5079 |
| 43 | Ga0466707_226981 | 3300042601 | Bacteria | 3113 |
| 44 | Ga0466714_128448 | 3300042603 | Bacteria | 3169 |
| 45 | Ga0466719_208724 | 3300042606 | Bacteria | 4073 |
| 46 | Ga0466711_063441 | 3300042615 | Bacteria | 2012 |
| 47 | Ga0466711_196720 | 3300042615 | Unclassified | 3352 |
| 48 | Ga0466726_125067 | 3300042619 | Bacteria | 44907 |
| 49 | Ga0466730_057632 | 3300042625 | Bacteria | 43996 |
| 50 | Ga0466708_109046 | 3300042652 | Bacteria | 1468 |
| 51 | Ga0415639_000550 | 3300038395 | Bacteria | 24503 |
| 52 | Ga0415639_062336 | 3300038395 | Bacteria | 2539 |
| 53 | Ga0466705_254122 | 3300042612 | Bacteria | 5912 |
| 54 | Ga0562378_0019 | 3300056814 | Bacteria | 857275 |
| 55 | Ga0123357_10293246 | 3300009784 | Bacteria | 1657 |
| 56 | Ga0123355_10001266 | 3300009826 | Bacteria | 35305 |
| 57 | Ga0123355_10165360 | 3300009826 | Bacteria | 3322 |
| 58 | Ga0123355_10279377 | 3300009826 | Bacteria | 2308 |
| 59 | Ga0123356_10122173 | 3300010049 | Bacteria | 2535 |
| 60 | Ga0123353_10163117 | 3300010167 | Bacteria | 3546 |
| 61 | Ga0466714_110229 | 3300042603 | Bacteria | 2273 |
| 62 | Ga0466714_118098 | 3300042603 | Bacteria | 2324 |
| 63 | Ga0466716_332318 | 3300042605 | Bacteria | 4185 |
| 64 | Ga0466711_049732 | 3300042615 | Bacteria | 3213 |
| 65 | Ga0466734_105059 | 3300042623 | Bacteria | 1566 |
| 66 | Ga0466704_213179 | 3300042643 | Unclassified | 1375 |
| 67 | Ga0466708_343765 | 3300042652 | Unclassified | 15676 |
| 68 | Ga0264413_116615 | 3300024493 | Bacteria | 8717 |
| 69 | Ga0415639_075121 | 3300038395 | Bacteria | 7046 |
| 70 | Ga0466693_163883 | 3300042592 | Bacteria | 1212 |
| 71 | Ga0466705_306364 | 3300042612 | Bacteria | 36565 |
| 72 | Ga0562379_0560 | 3300056790 | Bacteria | 69212 |
| 73 | Ga0562379_4608 | 3300056790 | Bacteria | 6614 |
| 74 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 75 | Ga0562374_0519 | 3300057007 | Bacteria | 62999 |
| 76 | Ga0123355_10059866 | 3300009826 | Bacteria | 6150 |
| 77 | Ga0123355_10202518 | 3300009826 | Bacteria | 2896 |
| 78 | Ga0123356_10010367 | 3300010049 | Bacteria | 9147 |
| 79 | Ga0123356_10060380 | 3300010049 | Bacteria | 3538 |
| 80 | Ga0123353_10041755 | 3300010167 | Bacteria | 7250 |
| 81 | Ga0123354_10066153 | 3300010882 | Bacteria | 5282 |
| 82 | JGI24695J34938_10038923 | 3300002450 | Bacteria | 2151 |
| 83 | CVPL010L_1000321 | 3300002932 | Bacteria | 11855 |
| 84 | Ga0068305_10287311 | 3300005083 | Bacteria | 8475 |
| 85 | Ga0123357_10000327 | 3300009784 | Bacteria | 45136 |
| 86 | Ga0466706_208127 | 3300042599 | Bacteria | 7179 |
| 87 | Ga0466707_251168 | 3300042601 | Bacteria | 17407 |
| 88 | Ga0466714_129882 | 3300042603 | Bacteria | 1125 |
| 89 | Ga0466715_181865 | 3300042616 | Bacteria | 5988 |
| 90 | Ga0466718_153000 | 3300042617 | Unclassified | 51850 |
| 91 | Ga0466728_076506 | 3300042620 | Bacteria | 1537 |
| 92 | Ga0466735_101764 | 3300042624 | Bacteria | 14847 |
| 93 | Ga0415639_093781 | 3300038395 | Bacteria | 3843 |
| 94 | Ga0466656_310114 | 3300042550 | Bacteria | 1534 |
| 95 | Ga0466693_147310 | 3300042592 | Bacteria | 3277 |
| 96 | Ga0466695_107371 | 3300042595 | Bacteria | 3154 |
| 97 | Ga0466696_464787 | 3300042596 | Bacteria | 3312 |
| 98 | Ga0466699_424928 | 3300042597 | Bacteria | 1951 |
| 99 | Ga0562379_0102 | 3300056790 | Bacteria | 287611 |
| 100 | Ga0562379_1386 | 3300056790 | Bacteria | 28271 |
| 101 | Ga0123356_10168768 | 3300010049 | Bacteria | 2196 |
| 102 | Ga0123353_10029881 | 3300010167 | Unclassified | 8409 |
| 103 | Ga0123353_10150988 | 3300010167 | Bacteria | 3709 |
| 104 | Ga0123353_10222023 | 3300010167 | Bacteria | 2953 |
| 105 | JGI24702J35022_10007430 | 3300002462 | Bacteria | 6284 |
| 106 | Ga0072941_1022085 | 3300005201 | Bacteria | 12064 |
| 107 | Ga0072941_1034873 | 3300005201 | Bacteria | 7319 |
| 108 | Ga0466713_037610 | 3300042602 | Bacteria | 9597 |
| 109 | Ga0466714_000341 | 3300042603 | Bacteria | 4527 |
| 110 | Ga0466717_213602 | 3300042604 | Bacteria | 11864 |
| 111 | Ga0466722_126302 | 3300042609 | Bacteria | 1004 |
| 112 | Ga0466703_124313 | 3300042636 | Bacteria | 6509 |
| 113 | Ga0466708_456516 | 3300042652 | Unclassified | 1301 |
| 114 | Ga0466694_055152 | 3300042594 | Bacteria | 6714 |
| 115 | Ga0466697_142896 | 3300042611 | Bacteria | 2659 |
| 116 | Ga0562375_0013 | 3300056856 | Bacteria | 1229523 |
| 117 | Ga0562375_0025 | 3300056856 | Bacteria | 749171 |
| 118 | Ga0562375_0326 | 3300056856 | Bacteria | 113604 |
| 119 | Ga0123355_10008290 | 3300009826 | Bacteria | 15701 |
| 120 | Ga0123355_10302785 | 3300009826 | Bacteria | 2177 |
| 121 | Ga0123356_10072782 | 3300010049 | Bacteria | 3230 |
| 122 | IMNBL1DRAFT_c0000020 | 3300000062 | Bacteria | 157199 |
| 123 | JGI24695J34938_10000106 | 3300002450 | Bacteria | 73679 |
| 124 | JGI24702J35022_10003238 | 3300002462 | Bacteria | 9850 |
| 125 | Ga0072941_1223254 | 3300005201 | Bacteria | 6886 |
| 126 | Ga0102734_1003853 | 3300007129 | Bacteria | 3389 |
| 127 | Ga0103267_1000150 | 3300007190 | Bacteria | 27389 |
| 128 | Ga0466713_027650 | 3300042602 | Bacteria | 2022 |
| 129 | Ga0466713_138385 | 3300042602 | Bacteria | 336961 |
| 130 | Ga0466714_064008 | 3300042603 | Bacteria | 5142 |
| 131 | Ga0466731_057572 | 3300042622 | Bacteria | 1770 |
| 132 | Ga0466730_000615 | 3300042625 | Bacteria | 2907 |
| 133 | Ga0466730_088179 | 3300042625 | Bacteria | 3070 |
| 134 | Ga0255572_1000024 | 3300026175 | Bacteria | 128087 |
| 135 | Ga0415639_070025 | 3300038395 | Bacteria | 11171 |
| 136 | Ga0415639_121359 | 3300038395 | Bacteria | 3754 |
| 137 | Ga0466696_419013 | 3300042596 | Bacteria | 1295 |
| 138 | Ga0562378_0008 | 3300056814 | Bacteria | 1370151 |
| 139 | Ga0562378_2893 | 3300056814 | Bacteria | 12258 |
| 140 | Ga0562376_0650 | 3300056857 | Bacteria | 58388 |
| 141 | Ga0123357_10033746 | 3300009784 | Bacteria | 6956 |
| 142 | Ga0123355_10366371 | 3300009826 | Bacteria | 1893 |
| 143 | Ga0123356_10105820 | 3300010049 | Unclassified | 2707 |
| 144 | 2226980395 | 2225789003 | Bacteria | 9188 |
| 145 | JGI24695J34938_10000214 | 3300002450 | Bacteria | 55263 |
| 146 | Ga0072941_1000968 | 3300005201 | Bacteria | 33336 |
| 147 | Ga0072941_1024023 | 3300005201 | Bacteria | 23668 |
| 148 | Ga0072941_1644704 | 3300005201 | Bacteria | 1119 |
| 149 | Ga0103268_1000007 | 3300007192 | Bacteria | 70891 |
| 150 | Ga0466700_051752 | 3300042600 | Bacteria | 4290 |
| 151 | Ga0466716_144776 | 3300042605 | Bacteria | 68361 |
| 152 | Ga0466722_229508 | 3300042609 | Bacteria | 1181 |
| 153 | Ga0466729_184814 | 3300042621 | Bacteria | 7054 |
| 154 | Ga0466725_367631 | 3300042654 | Bacteria | 3218 |
| 155 | Ga0466692_066220 | 3300042591 | Bacteria | 18291 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00696 | AA_kinase | Amino acid kinase family | 62 | 344 | 0.8 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.