Protein Family IF10105

Metagenome Isolate
256 Members
161 Samples
155 Scaffolds
311.6 Avg Length

🧬 Representative Sequence

ID
3300042654|Ga0466725_432863|Ga0466725_432863_6875_7969
Length
364 aa
Sequence
MATVHKVLTQFFSLNAFGDFSQKPRKFACRFNFCFAKDAQELVRTMLCTVTKYANGGKIMSKIVVALGGNALGDNVTQQLANAKLAAASXXDLAAAGHSVVVAHGNGPQVGAIKMALDAGGFVVPMPECTAMSQGYIGFHLQQSLGNELAARGVKRQVATVLTQVVVDKNDPAFANPTKPIGAYYDETAAKELMAQTGKTYVEDAGRGWRWVVPSPLPVDIREAASIKFLSDNDFMVIACGGGGMPVVAEDGGFAGIDAVIDKDFASAKMAELIDADVLVILTAVDRVKINFNKPDEKSLDTLTVAQAQKYADEGHFAKGSMLPKVQAAIKFARGGGGRKAIIGSLEQAAAAIAGQSGTTIVKE

πŸ“Š Sample Types

Isolate 39.5%
Metagenome 60.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 36.0%
Termitidae 15.3%
Formicidae 10.0%
Kalotermitidae 7.3%
Tenebrionidae 5.3%
Apidae 4.7%
Blattidae 4.0%
Argasidae 2.7%
Rhinotermitidae 2.0%
Scarabaeidae 1.3%
Hydrophilidae 1.3%
Termopsidae 1.3%
Ixodidae 1.3%
Passalidae 1.3%
Ceratopogonidae 0.7%
Gomphidae 0.7%
Elmidae 0.7%
Vespidae 0.7%
Stratiomyidae 0.7%
Hodotermitidae 0.7%
Rhaphidophoridae 0.7%
Culicidae 0.7%
Drosophilidae 0.7%

🌳 Taxonomy

Archaea 1
Bacteria 239
Eukaryota 0
Viruses 0
Unclassified 16

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820838073 Unclassified Actinobacteria Lab288P4bin27 Isolate Unclassified
2 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
3 2856960404 Pseudonocardia sp. Ae706_Ps2 Isolate Formicidae
4 2856973192 Pseudonocardia sp. Ae331_Ps2 Isolate Formicidae
5 2859970369 Pseudonocardia sp. Ae717_Ps2 Isolate Formicidae
6 2916858470 Heyndrickxia oleronia Isolate Unclassified
7 2931425734 Nocardioides sp. J2M5 Isolate
8 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
9 2565956565 Borrelia coriaceae Co53 Isolate Argasidae
10 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
11 2820411483 Unclassified Firmicutes Lab288P4bin76 Isolate Unclassified
12 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
13 2820596822 Unclassified Firmicutes Emb289P1bin58 Isolate Unclassified
14 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
15 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
16 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
17 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
18 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
19 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
20 2820866620 Unclassified Actinobacteria Lab288P3bin139 Isolate Unclassified
21 2820906387 Unclassified Actinobacteria Emb289P4bin41 Isolate Unclassified
22 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
23 2914375287 Culicoidibacter larvae CS-1 Isolate Ceratopogonidae
24 2758568505 Lactobacillus bombicola ESL0225 Isolate Unclassified
25 2820479655 Unclassified Firmicutes Lab288P1bin77 Isolate Unclassified
26 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
27 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
28 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
29 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
30 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
31 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
32 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
33 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
34 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
35 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
36 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
39 2856882415 Pseudonocardia sp. Ae406_Ps2 Isolate Formicidae
40 2864985977 Staphylococcus hominis S00278 Isolate Elmidae
41 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
42 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
43 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
44 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
45 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
46 2531839602 Shimwellia blattae NBRC 105725 Isolate Unclassified
47 2758568501 Lactobacillus bombicola ESL0228 Isolate Unclassified
48 2758568502 Lactobacillus bombicola ESL0247 Isolate Unclassified
49 2758568503 Lactobacillus bombicola ESL0246 Isolate Unclassified
50 2781125653 Treponema sp. Emb289P1bin107 Isolate Unclassified
51 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
52 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
53 2775507261 Borrelia turicatae 91E135 Isolate Argasidae
54 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
55 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
56 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
57 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
58 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
59 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
60 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
61 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
62 8004832522 Lactobacillus sp. ESL0236 Isolate Apidae
63 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
64 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
65 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
66 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
67 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
68 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
69 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
70 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
71 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
72 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
73 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
74 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
75 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
76 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
77 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
78 2820823448 Unclassified Actinobacteria Nt197P3bin113 Isolate Unclassified
79 2545555866 Borrelia coriaceae ATCC 43381 Isolate Argasidae
80 2758568506 Lactobacillus bombicola ESL0230 Isolate Unclassified
81 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
82 2820547636 Unclassified Firmicutes Lab288P1bin10 Isolate Unclassified
83 2820598593 Unclassified Firmicutes Emb289P1bin53 Isolate Unclassified
84 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
85 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
86 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
87 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
88 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
89 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
90 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
91 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
92 2881902429 Companilactobacillus metriopterae JCM 31635 Isolate Unclassified
93 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
94 2958885890 Lactobacillus sp. ESL0234 Isolate Apidae
95 2961465228 Lactobacillus sp. ESL0233 Isolate Apidae
96 2565956518 Vibrio pacinii DSM 19139 Isolate Unclassified
97 2758568507 Lactobacillus bombicola ESL0237 Isolate Unclassified
98 2758568508 Lactobacillus bombicola ESL0236 Isolate Unclassified
99 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
100 2820389254 Unclassified Firmicutes Nc150P4bin19 Isolate Unclassified
101 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
102 8114010755 Borrelia coriaceae Co53 Isolate Argasidae
103 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
104 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
105 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
106 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
107 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
108 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
109 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
110 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
111 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
112 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
113 2968368220 Lactobacillus bombicola OCC3 Isolate Apidae
114 2971062614 Lactobacillus bombicola BI-4G Isolate Apidae
115 2836714267 Shimwellia blattae NCTC10965 Isolate
116 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
117 2896402965 Weissella diestrammenae KACC 16890 Isolate Rhaphidophoridae
118 2513020017 Shimwellia blattae DSM 4481 Isolate Unclassified
119 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
120 2758568509 Lactobacillus bombicola ESL0234 Isolate Unclassified
121 2758568510 Lactobacillus bombicola ESL0233 Isolate Unclassified
122 2820369699 Unclassified Firmicutes Nt197P3bin103 Isolate Unclassified
123 2820427814 Unclassified Firmicutes Lab288P3bin44 Isolate Unclassified
124 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
125 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
126 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
127 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
128 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
129 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
130 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
131 2856954254 Pseudonocardia sp. Ae505_Ps2 Isolate Formicidae
132 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
133 2758568504 Lactobacillus bombicola ESL0245 Isolate Unclassified
134 2820459456 Unclassified Firmicutes Lab288P3bin148 Isolate Unclassified
135 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
136 2820647881 Unclassified Firmicutes Cu122P5bin16 Isolate Unclassified
137 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
138 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
139 8064008355 Heyndrickxia oleronia Isolate Unclassified
140 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
141 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
142 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
143 2848878685 Borrelia miyamotoi CA17-2241 Isolate Ixodidae
144 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
145 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
146 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
147 2718218422 Borrelia miyamotoi CT13-2396 Isolate Ixodidae
148 2785510748 Lactobacillus sp. ESL0409 Isolate Apidae
149 2799112230 Lactobacillus sp. ESL0416 Isolate Unclassified
150 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
151 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
152 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
153 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
154 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
155 8017440191 Lactobacillus bombicola L5-31 Isolate Apidae
156 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
157 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
158 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
159 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
160 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
161 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_087809 3300042659 Bacteria 3244
2 Ga0562379_0092 3300056790 Bacteria 317609
3 Ga0562379_1345 3300056790 Bacteria 29065
4 Ga0562377_0040 3300056842 Bacteria 613468
5 Ga0562374_0022 3300057007 Bacteria 1083986
6 Ga0562374_3302 3300057007 Unclassified 9687
7 Ga0123355_10550161 3300009826 Bacteria 1396
8 Ga0123356_10002098 3300010049 Bacteria 21502
9 Ga0123356_10752006 3300010049 Bacteria 1145
10 Ga0123353_10042794 3300010167 Unclassified 7168
11 Ga0466700_470039 3300042600 Bacteria 7471
12 Ga0466707_277810 3300042601 Bacteria 20537
13 Ga0466713_107250 3300042602 Bacteria 117772
14 Ga0466714_052888 3300042603 Unclassified 1748
15 Ga0466715_395694 3300042616 Bacteria 34108
16 Ga0466708_301966 3300042652 Bacteria 4736
17 Ga0466696_493622 3300042596 Bacteria 5002
18 Ga0530661_000784 3300056564 Unclassified 20266
19 Ga0562378_0427 3300056814 Unclassified 75062
20 Ga0562377_0237 3300056842 Bacteria 130479
21 Ga0562374_0196 3300057007 Unclassified 130686
22 Ga0123357_10070001 3300009784 Bacteria 4662
23 Ga0123355_10000238 3300009826 Bacteria 70491
24 Ga0123355_10100101 3300009826 Bacteria 4566
25 Ga0123354_10073455 3300010882 Unclassified 4911
26 JGI24702J35022_10007200 3300002462 Bacteria 6396
27 Meta3P_1000869 3300002464 Bacteria 44072
28 Ga0103264_1000026 3300007188 Bacteria 92644
29 Ga0466717_026851 3300042604 Bacteria 1392
30 Ga0466725_432863 3300042654 Bacteria 12232
31 Ga0415639_072992 3300038395 Unclassified 1784
32 Ga0466656_080481 3300042550 Bacteria 1218
33 Ga0562377_0078 3300056842 Bacteria 380003
34 Ga0562377_2383 3300056842 Unclassified 14301
35 Ga0562374_0014 3300057007 Bacteria 1241908
36 Ga0123356_10046008 3300010049 Bacteria 4060
37 Ga0123356_10423529 3300010049 Bacteria 1474
38 Ga0123356_10436075 3300010049 Bacteria 1455
39 Ga0123353_10032510 3300010167 Bacteria 8102
40 Ga0102735_1000253 3300007080 Bacteria 23452
41 Ga0466700_396789 3300042600 Archaea 1572
42 Ga0466707_155385 3300042601 Bacteria 5079
43 Ga0466707_226981 3300042601 Bacteria 3113
44 Ga0466714_128448 3300042603 Bacteria 3169
45 Ga0466719_208724 3300042606 Bacteria 4073
46 Ga0466711_063441 3300042615 Bacteria 2012
47 Ga0466711_196720 3300042615 Unclassified 3352
48 Ga0466726_125067 3300042619 Bacteria 44907
49 Ga0466730_057632 3300042625 Bacteria 43996
50 Ga0466708_109046 3300042652 Bacteria 1468
51 Ga0415639_000550 3300038395 Bacteria 24503
52 Ga0415639_062336 3300038395 Bacteria 2539
53 Ga0466705_254122 3300042612 Bacteria 5912
54 Ga0562378_0019 3300056814 Bacteria 857275
55 Ga0123357_10293246 3300009784 Bacteria 1657
56 Ga0123355_10001266 3300009826 Bacteria 35305
57 Ga0123355_10165360 3300009826 Bacteria 3322
58 Ga0123355_10279377 3300009826 Bacteria 2308
59 Ga0123356_10122173 3300010049 Bacteria 2535
60 Ga0123353_10163117 3300010167 Bacteria 3546
61 Ga0466714_110229 3300042603 Bacteria 2273
62 Ga0466714_118098 3300042603 Bacteria 2324
63 Ga0466716_332318 3300042605 Bacteria 4185
64 Ga0466711_049732 3300042615 Bacteria 3213
65 Ga0466734_105059 3300042623 Bacteria 1566
66 Ga0466704_213179 3300042643 Unclassified 1375
67 Ga0466708_343765 3300042652 Unclassified 15676
68 Ga0264413_116615 3300024493 Bacteria 8717
69 Ga0415639_075121 3300038395 Bacteria 7046
70 Ga0466693_163883 3300042592 Bacteria 1212
71 Ga0466705_306364 3300042612 Bacteria 36565
72 Ga0562379_0560 3300056790 Bacteria 69212
73 Ga0562379_4608 3300056790 Bacteria 6614
74 Ga0562377_0006 3300056842 Bacteria 3350072
75 Ga0562374_0519 3300057007 Bacteria 62999
76 Ga0123355_10059866 3300009826 Bacteria 6150
77 Ga0123355_10202518 3300009826 Bacteria 2896
78 Ga0123356_10010367 3300010049 Bacteria 9147
79 Ga0123356_10060380 3300010049 Bacteria 3538
80 Ga0123353_10041755 3300010167 Bacteria 7250
81 Ga0123354_10066153 3300010882 Bacteria 5282
82 JGI24695J34938_10038923 3300002450 Bacteria 2151
83 CVPL010L_1000321 3300002932 Bacteria 11855
84 Ga0068305_10287311 3300005083 Bacteria 8475
85 Ga0123357_10000327 3300009784 Bacteria 45136
86 Ga0466706_208127 3300042599 Bacteria 7179
87 Ga0466707_251168 3300042601 Bacteria 17407
88 Ga0466714_129882 3300042603 Bacteria 1125
89 Ga0466715_181865 3300042616 Bacteria 5988
90 Ga0466718_153000 3300042617 Unclassified 51850
91 Ga0466728_076506 3300042620 Bacteria 1537
92 Ga0466735_101764 3300042624 Bacteria 14847
93 Ga0415639_093781 3300038395 Bacteria 3843
94 Ga0466656_310114 3300042550 Bacteria 1534
95 Ga0466693_147310 3300042592 Bacteria 3277
96 Ga0466695_107371 3300042595 Bacteria 3154
97 Ga0466696_464787 3300042596 Bacteria 3312
98 Ga0466699_424928 3300042597 Bacteria 1951
99 Ga0562379_0102 3300056790 Bacteria 287611
100 Ga0562379_1386 3300056790 Bacteria 28271
101 Ga0123356_10168768 3300010049 Bacteria 2196
102 Ga0123353_10029881 3300010167 Unclassified 8409
103 Ga0123353_10150988 3300010167 Bacteria 3709
104 Ga0123353_10222023 3300010167 Bacteria 2953
105 JGI24702J35022_10007430 3300002462 Bacteria 6284
106 Ga0072941_1022085 3300005201 Bacteria 12064
107 Ga0072941_1034873 3300005201 Bacteria 7319
108 Ga0466713_037610 3300042602 Bacteria 9597
109 Ga0466714_000341 3300042603 Bacteria 4527
110 Ga0466717_213602 3300042604 Bacteria 11864
111 Ga0466722_126302 3300042609 Bacteria 1004
112 Ga0466703_124313 3300042636 Bacteria 6509
113 Ga0466708_456516 3300042652 Unclassified 1301
114 Ga0466694_055152 3300042594 Bacteria 6714
115 Ga0466697_142896 3300042611 Bacteria 2659
116 Ga0562375_0013 3300056856 Bacteria 1229523
117 Ga0562375_0025 3300056856 Bacteria 749171
118 Ga0562375_0326 3300056856 Bacteria 113604
119 Ga0123355_10008290 3300009826 Bacteria 15701
120 Ga0123355_10302785 3300009826 Bacteria 2177
121 Ga0123356_10072782 3300010049 Bacteria 3230
122 IMNBL1DRAFT_c0000020 3300000062 Bacteria 157199
123 JGI24695J34938_10000106 3300002450 Bacteria 73679
124 JGI24702J35022_10003238 3300002462 Bacteria 9850
125 Ga0072941_1223254 3300005201 Bacteria 6886
126 Ga0102734_1003853 3300007129 Bacteria 3389
127 Ga0103267_1000150 3300007190 Bacteria 27389
128 Ga0466713_027650 3300042602 Bacteria 2022
129 Ga0466713_138385 3300042602 Bacteria 336961
130 Ga0466714_064008 3300042603 Bacteria 5142
131 Ga0466731_057572 3300042622 Bacteria 1770
132 Ga0466730_000615 3300042625 Bacteria 2907
133 Ga0466730_088179 3300042625 Bacteria 3070
134 Ga0255572_1000024 3300026175 Bacteria 128087
135 Ga0415639_070025 3300038395 Bacteria 11171
136 Ga0415639_121359 3300038395 Bacteria 3754
137 Ga0466696_419013 3300042596 Bacteria 1295
138 Ga0562378_0008 3300056814 Bacteria 1370151
139 Ga0562378_2893 3300056814 Bacteria 12258
140 Ga0562376_0650 3300056857 Bacteria 58388
141 Ga0123357_10033746 3300009784 Bacteria 6956
142 Ga0123355_10366371 3300009826 Bacteria 1893
143 Ga0123356_10105820 3300010049 Unclassified 2707
144 2226980395 2225789003 Bacteria 9188
145 JGI24695J34938_10000214 3300002450 Bacteria 55263
146 Ga0072941_1000968 3300005201 Bacteria 33336
147 Ga0072941_1024023 3300005201 Bacteria 23668
148 Ga0072941_1644704 3300005201 Bacteria 1119
149 Ga0103268_1000007 3300007192 Bacteria 70891
150 Ga0466700_051752 3300042600 Bacteria 4290
151 Ga0466716_144776 3300042605 Bacteria 68361
152 Ga0466722_229508 3300042609 Bacteria 1181
153 Ga0466729_184814 3300042621 Bacteria 7054
154 Ga0466725_367631 3300042654 Bacteria 3218
155 Ga0466692_066220 3300042591 Bacteria 18291

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00696 AA_kinase Amino acid kinase family 62 344 0.8

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.