Protein Family IF10085
Metagenome
Isolate
235
Members
181
Samples
121
Scaffolds
335.41
Avg Length
Representative Sequence
- ID
- 3300042654|Ga0466725_328244|Ga0466725_328244_319_1419
- Length
- 366 aa
- Sequence
- MTKEKLRASHNPAPGRKSAAAGTQALWKADMEAAQTALWVVILLVVLALAFDFMNGFHDAANSIATVVSTGVLRPSQAVVFAAFFNLMALFVFHLSVAATVGKGIVEPGVVDTHVVFGALAGAITWNLITWYYGIPSSSSHALIGGIVGAVMAKSGASVLVAGGIIKTVAFIFISPLLGFLLGSLMMVAVAWICRRARPSRIDRWFRRLQLLSAGAYSLGHGGNDAQKTIGIIWMLLIATGHRAAADSAPPLWVIVSCYTAIGLGTMFGGWRIVKTMGQKITKLKPVGGFCAETGGALTLFFATVLGIPVSTTHTITGAIVGVGSTQRASAVRWGVAGNIVWAWVLTIPAAAFVAALAFWISFYLY
Sample Types
Isolate
48.5%
Metagenome
51.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
45.2%
Termitidae
10.2%
Unclassified
8.5%
Kalotermitidae
7.9%
Formicidae
6.2%
Culicidae
5.6%
Elmidae
5.1%
Curculionidae
1.7%
Termopsidae
1.7%
Largidae
1.1%
Hydrophilidae
1.1%
Rhinotermitidae
1.1%
Berytidae
1.1%
Alydidae
1.1%
Passalidae
0.6%
Armadillidiidae
0.6%
Hodotermitidae
0.6%
Tenebrionidae
0.6%
Taxonomy
Archaea
0
Bacteria
212
Eukaryota
0
Viruses
0
Unclassified
23
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2864755708 | Massilia timonae S00006 | Isolate | Elmidae |
| 2 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 3 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 4 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 13 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 14 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 15 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 16 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 17 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 18 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 19 | 8100455565 | Delftia sp. S67 | Isolate | Curculionidae |
| 20 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 21 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 22 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 23 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 24 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 25 | 2820134530 | Unclassified Proteobacteria Emb289P3bin65 | Isolate | Unclassified |
| 26 | 2864968865 | Paucibacter oligotrophus S00239 | Isolate | Elmidae |
| 27 | 2873565274 | Diaphorobacter sp. HDW4A | Isolate | Hydrophilidae |
| 28 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 29 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 30 | 3300012798 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG | Metagenome | |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 37 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 38 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 39 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 40 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 41 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 42 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 43 | 2820103659 | Unclassified Proteobacteria Emb289P4bin67 | Isolate | Unclassified |
| 44 | 2820123897 | Unclassified Proteobacteria Emb289P4bin18 | Isolate | Unclassified |
| 45 | 2820166269 | Unclassified Proteobacteria Co191P4bin16 | Isolate | Unclassified |
| 46 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 47 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 48 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 49 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 50 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 51 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 52 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 53 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 54 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 55 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 56 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 57 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 58 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 59 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 60 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 61 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 62 | 8102041249 | Caballeronia sp. GACF4 | Isolate | Coreidae |
| 63 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 64 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 65 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 66 | 2820168331 | Unclassified Proteobacteria Co191P3bin57 | Isolate | Unclassified |
| 67 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 68 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 69 | 3300012813 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG | Metagenome | Culicidae |
| 70 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 71 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 72 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 73 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 74 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 75 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 76 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 77 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 78 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 79 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 80 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 81 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 82 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 83 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 84 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 85 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 86 | 2820071837 | Unclassified Proteobacteria Nt197P3bin132 | Isolate | Unclassified |
| 87 | 2820152154 | Unclassified Proteobacteria Cu122P5bin47 | Isolate | Unclassified |
| 88 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 89 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 90 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 91 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 92 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 93 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 94 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 95 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 96 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 97 | 8024031916 | Cupriavidus pauculus BHJ32i | Isolate | Alydidae |
| 98 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 99 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 100 | 8100449422 | Delftia sp. S66 | Isolate | Curculionidae |
| 101 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 102 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 103 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 104 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 105 | 2820132692 | Unclassified Proteobacteria Emb289P3bin76 | Isolate | Unclassified |
| 106 | 2864870719 | Comamonas odontotermitis S00124 | Isolate | Elmidae |
| 107 | 2864937364 | Acidovorax soli S00198 | Isolate | Elmidae |
| 108 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 109 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 110 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 111 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 112 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 113 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 114 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 115 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 116 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 117 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 118 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 119 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 120 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 121 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 122 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 123 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 124 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 125 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 126 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 127 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 128 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 129 | 2820111668 | Unclassified Proteobacteria Emb289P4bin34 | Isolate | Unclassified |
| 130 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 131 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 132 | 2864960361 | Comamonas odontotermitis S00229 | Isolate | Elmidae |
| 133 | 2868169047 | Comamonas aquatica S00077 | Isolate | Elmidae |
| 134 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 135 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 136 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 137 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 138 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 139 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 140 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 141 | 8023764196 | Caballeronia peredens LZ001 | Isolate | Coreidae |
| 142 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 143 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 144 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 145 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 146 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 147 | 8100461708 | Delftia sp. S65 | Isolate | Curculionidae |
| 148 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 149 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 150 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 151 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 152 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 153 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 154 | 2820059968 | Unclassified Proteobacteria Nt197P4bin23 | Isolate | Unclassified |
| 155 | 2820170025 | Unclassified Proteobacteria Co191P1bin43 | Isolate | Unclassified |
| 156 | 2864826666 | Acidovorax konjaci S00067 | Isolate | Elmidae |
| 157 | 2873571580 | Diaphorobacter sp. HDW4B | Isolate | Hydrophilidae |
| 158 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 159 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 160 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 161 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 162 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 163 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 164 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 165 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 166 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 167 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 168 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 169 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 170 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 171 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 172 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 173 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 174 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 175 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 176 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 177 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 178 | 8102152052 | Caballeronia sp. LZ001 | Isolate | Coreidae |
| 179 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 180 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 181 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123357_10197409 | 3300009784 | Bacteria | 2300 |
| 2 | Ga0466710_361536 | 3300042613 | Bacteria | 65742 |
| 3 | Ga0466726_001250 | 3300042619 | Bacteria | 5250 |
| 4 | Ga0466728_210745 | 3300042620 | Bacteria | 5799 |
| 5 | Ga0466701_044926 | 3300042598 | Bacteria | 108752 |
| 6 | Ga0466713_070202 | 3300042602 | Bacteria | 33229 |
| 7 | Ga0466717_243495 | 3300042604 | Unclassified | 10085 |
| 8 | Ga0466716_154458 | 3300042605 | Bacteria | 4092 |
| 9 | Ga0466716_494308 | 3300042605 | Bacteria | 4150 |
| 10 | Ga0466731_124687 | 3300042622 | Bacteria | 1552 |
| 11 | Ga0466704_187304 | 3300042643 | Bacteria | 32344 |
| 12 | Ga0466725_285254 | 3300042654 | Bacteria | 86814 |
| 13 | Ga0466727_335426 | 3300042655 | Unclassified | 4233 |
| 14 | Ga0160468_101242 | 3300012819 | Bacteria | 6806 |
| 15 | Ga0466657_385965 | 3300042582 | Bacteria | 1975 |
| 16 | Ga0466705_113034 | 3300042612 | Unclassified | 11887 |
| 17 | Ga0123356_10029175 | 3300010049 | Bacteria | 5169 |
| 18 | Ga0160466_100007 | 3300012809 | Bacteria | 474135 |
| 19 | Ga0466711_043222 | 3300042615 | Bacteria | 5250 |
| 20 | Ga0466715_140653 | 3300042616 | Bacteria | 2197 |
| 21 | Ga0466701_060740 | 3300042598 | Bacteria | 107748 |
| 22 | Ga0466706_093682 | 3300042599 | Bacteria | 8644 |
| 23 | Ga0466721_045198 | 3300042608 | Bacteria | 2484 |
| 24 | Ga0466722_017244 | 3300042609 | Bacteria | 14275 |
| 25 | IMNBL1DRAFT_c0001041 | 3300000062 | Bacteria | 21490 |
| 26 | Ga0160447_101161 | 3300012849 | Unclassified | 10545 |
| 27 | Ga0466692_049502 | 3300042591 | Bacteria | 26947 |
| 28 | Ga0123354_10208673 | 3300010882 | Bacteria | 2119 |
| 29 | Ga0160471_100410 | 3300012812 | Unclassified | 12636 |
| 30 | Ga0466715_199167 | 3300042616 | Bacteria | 2176 |
| 31 | Ga0466701_058339 | 3300042598 | Bacteria | 35267 |
| 32 | Ga0466717_088379 | 3300042604 | Unclassified | 9432 |
| 33 | Ga0466722_002343 | 3300042609 | Bacteria | 14494 |
| 34 | CVPL010W_10000798 | 3300002931 | Bacteria | 35439 |
| 35 | Ga0103263_100176 | 3300007042 | Unclassified | 10534 |
| 36 | Ga0102738_1007775 | 3300007141 | Bacteria | 1477 |
| 37 | Ga0123357_10000005 | 3300009784 | Bacteria | 295874 |
| 38 | Ga0466734_010466 | 3300042623 | Bacteria | 2402 |
| 39 | Ga0466734_060661 | 3300042623 | Bacteria | 37945 |
| 40 | Ga0466734_107537 | 3300042623 | Bacteria | 6001 |
| 41 | Ga0466730_009867 | 3300042625 | Bacteria | 12667 |
| 42 | Ga0466730_078413 | 3300042625 | Unclassified | 3564 |
| 43 | Ga0466704_526217 | 3300042643 | Bacteria | 23009 |
| 44 | Ga0466725_096048 | 3300042654 | Bacteria | 4605 |
| 45 | Ga0466725_179777 | 3300042654 | Bacteria | 1402 |
| 46 | Ga0466725_292043 | 3300042654 | Bacteria | 3203 |
| 47 | Ga0466725_335827 | 3300042654 | Bacteria | 8573 |
| 48 | Ga0160452_100268 | 3300012834 | Bacteria | 49951 |
| 49 | Ga0160436_1003016 | 3300012861 | Bacteria | 4180 |
| 50 | Ga0466657_351241 | 3300042582 | Bacteria | 2254 |
| 51 | Ga0466691_047970 | 3300042593 | Bacteria | 6985 |
| 52 | Ga0123354_10257532 | 3300010882 | Bacteria | 1751 |
| 53 | Ga0466705_499862 | 3300042612 | Bacteria | 3970 |
| 54 | Ga0466707_149542 | 3300042601 | Bacteria | 11249 |
| 55 | Ga0466713_052888 | 3300042602 | Bacteria | 2320 |
| 56 | JGI24695J34938_10000649 | 3300002450 | Bacteria | 33230 |
| 57 | JGI24705J35276_12237438 | 3300002504 | Unclassified | 11141 |
| 58 | CVPL005L_10004666 | 3300002938 | Bacteria | 14569 |
| 59 | Ga0102737_1006165 | 3300007142 | Unclassified | 2313 |
| 60 | Ga0123357_10001417 | 3300009784 | Unclassified | 25394 |
| 61 | Ga0466703_371953 | 3300042636 | Bacteria | 6543 |
| 62 | Ga0466709_395224 | 3300042648 | Bacteria | 3492 |
| 63 | Ga0160470_101637 | 3300012813 | Bacteria | 5150 |
| 64 | Ga0160458_102286 | 3300012832 | Bacteria | 2668 |
| 65 | Ga0160446_101487 | 3300012835 | Bacteria | 4983 |
| 66 | Ga0160460_101745 | 3300012845 | Bacteria | 6351 |
| 67 | Ga0160435_1002070 | 3300012857 | Unclassified | 4927 |
| 68 | Ga0466690_149836 | 3300042590 | Bacteria | 1437 |
| 69 | Ga0466696_179603 | 3300042596 | Bacteria | 2942 |
| 70 | Ga0466696_429262 | 3300042596 | Bacteria | 13084 |
| 71 | Ga0123356_10058246 | 3300010049 | Bacteria | 3602 |
| 72 | Ga0123353_10211829 | 3300010167 | Bacteria | 3039 |
| 73 | Ga0466726_089611 | 3300042619 | Bacteria | 3039 |
| 74 | Ga0466697_041003 | 3300042611 | Unclassified | 4311 |
| 75 | Ga0102735_1000077 | 3300007080 | Bacteria | 25727 |
| 76 | Ga0102734_1000611 | 3300007129 | Bacteria | 10323 |
| 77 | Ga0103267_1000094 | 3300007190 | Unclassified | 45572 |
| 78 | Ga0466734_009964 | 3300042623 | Bacteria | 4156 |
| 79 | Ga0466734_029276 | 3300042623 | Bacteria | 8193 |
| 80 | Ga0466734_170622 | 3300042623 | Bacteria | 1780 |
| 81 | Ga0466735_004190 | 3300042624 | Bacteria | 7635 |
| 82 | Ga0466724_23079 | 3300042649 | Bacteria | 108720 |
| 83 | Ga0466725_193463 | 3300042654 | Bacteria | 19885 |
| 84 | Ga0160447_114608 | 3300012849 | Bacteria | 1490 |
| 85 | Ga0466697_229685 | 3300042611 | Bacteria | 3954 |
| 86 | Ga0123354_10022287 | 3300010882 | Unclassified | 9985 |
| 87 | Ga0466710_104398 | 3300042613 | Bacteria | 2488 |
| 88 | Ga0466710_176070 | 3300042613 | Bacteria | 17789 |
| 89 | Ga0466697_012415 | 3300042611 | Bacteria | 5331 |
| 90 | Ga0102734_1010973 | 3300007129 | Unclassified | 3447 |
| 91 | Ga0102740_1001744 | 3300007140 | Bacteria | 5320 |
| 92 | Ga0466657_053073 | 3300042582 | Bacteria | 114727 |
| 93 | Ga0466701_004419 | 3300042598 | Bacteria | 102474 |
| 94 | Ga0466733_098838 | 3300042659 | Bacteria | 4304 |
| 95 | Ga0466715_212143 | 3300042616 | Bacteria | 1398 |
| 96 | Ga0466719_262077 | 3300042606 | Bacteria | 2285 |
| 97 | Ga0103268_1000097 | 3300007192 | Bacteria | 27557 |
| 98 | Ga0466704_569178 | 3300042643 | Unclassified | 2218 |
| 99 | Ga0466708_051044 | 3300042652 | Bacteria | 7590 |
| 100 | Ga0160448_115446 | 3300012854 | Bacteria | 1380 |
| 101 | Ga0466691_199153 | 3300042593 | Bacteria | 2656 |
| 102 | Ga0530661_001273 | 3300056564 | Bacteria | 13450 |
| 103 | Ga0123356_10000941 | 3300010049 | Bacteria | 32233 |
| 104 | Ga0160454_101414 | 3300012798 | Unclassified | 3548 |
| 105 | Ga0466723_113926 | 3300042618 | Bacteria | 26979 |
| 106 | Ga0466701_077295 | 3300042598 | Bacteria | 4028 |
| 107 | Ga0466717_151928 | 3300042604 | Bacteria | 3458 |
| 108 | Ga0103266_1000029 | 3300007067 | Bacteria | 65942 |
| 109 | Ga0102734_1000342 | 3300007129 | Unclassified | 17206 |
| 110 | Ga0123357_10000467 | 3300009784 | Bacteria | 39326 |
| 111 | Ga0466730_096004 | 3300042625 | Bacteria | 122670 |
| 112 | Ga0466709_055681 | 3300042648 | Unclassified | 2157 |
| 113 | Ga0466724_03562 | 3300042649 | Bacteria | 118958 |
| 114 | Ga0466724_24594 | 3300042649 | Bacteria | 16397 |
| 115 | Ga0466724_29472 | 3300042649 | Bacteria | 417400 |
| 116 | Ga0466708_100452 | 3300042652 | Bacteria | 3175 |
| 117 | Ga0466725_328244 | 3300042654 | Bacteria | 2114 |
| 118 | Ga0160434_108707 | 3300012850 | Unclassified | 1665 |
| 119 | Ga0160430_102221 | 3300012852 | Unclassified | 6309 |
| 120 | Ga0466692_026327 | 3300042591 | Bacteria | 2229 |
| 121 | Ga0466696_182462 | 3300042596 | Unclassified | 2568 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01384 | PHO4 | Phosphate transporter family | 55 | 355 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.