Protein Family IF10003

Metagenome Isolate
327 Members
105 Samples
284 Scaffolds
451.38 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_385018|Ga0466708_385018_1885_3411
Length
508 aa
Sequence
MRSVKDRIGRERVTMPLSGPEIRVLRAENGKEAERQATTGDEGVHRMAVTDYTTLDRKYSKITPEIRRLADLCVSNGQIEPELYGRYQVNSGLRDLNGNGVLTGLTEISEIKAFEFDGNGAKTPIDGELCFRGYNVEELVSGFIDEERAGFEETTYLLIFGELPNKEELEAFRKLLSKYRTLPTGFVRDIIMKAPSDDMMNTLARSVLTLHAYDGNANDISIPNVLRQSLLLIAVFPMLAVYGYQAYRHYFGGDDLFIHTPKPQLSTAENLLQMLRKNGKYSTLEAKILDLSLVLHAEHGGXXXXTFTTHVVSSSGTDTYSSVAASLGSLKGPKHGGANIRVVQMFDDMKANIKDWADDEQVERYLRDLLNKKAFDKAGLIYGMGHAVYSLSDPRANIFKGFVEKLSAEKGRNDEYALYSSVARLAPKVIGEERRIYKGVSANVDFYSGFVYSMLDLPSELYTPLFAIARISGWSAHRIEELINAGKIIRPAYRSVSDRRAYVPLQRR

πŸ“Š Sample Types

Isolate 13.2%
Metagenome 86.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 27.5%
Unclassified 26.5%
Blattidae 13.7%
Kalotermitidae 13.7%
Rhinotermitidae 4.9%
Tenebrionidae 4.9%
Termopsidae 3.9%
Passalidae 2.0%
Scarabaeidae 1.0%
Hodotermitidae 1.0%
Drosophilidae 1.0%

🌳 Taxonomy

Archaea 2
Bacteria 311
Eukaryota 0
Viruses 0
Unclassified 14

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
2 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
3 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
4 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
5 2820584674 Unclassified Firmicutes Emb289P1bin98 Isolate Unclassified
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
8 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
12 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
13 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
18 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
19 2228664001 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA Metagenome Termitidae
20 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
21 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
22 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
23 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
24 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
25 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
26 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
27 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
28 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
29 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
30 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
31 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
32 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
33 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
34 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
35 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
36 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
37 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
38 2820301196 Unclassified Firmicutes Th196P1bin8 Isolate Unclassified
39 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
41 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
42 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
43 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
44 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
47 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
48 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
49 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
50 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
51 2228664002 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3a from Florida, USA Metagenome Termitidae
52 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
53 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
54 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
55 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
56 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
57 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
58 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
59 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
60 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
61 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
62 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
63 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
64 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
65 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
66 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
67 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
68 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
69 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
70 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
71 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
72 2820657860 Unclassified Firmicutes Co191P4bin15 Isolate Unclassified
73 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
74 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
75 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
76 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
77 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
78 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
79 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
80 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
81 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
82 2820518089 Unclassified Firmicutes Lab288P1bin27 Isolate Unclassified
83 2820705605 Unclassified Firmicutes Co191P1bin34 Isolate Unclassified
84 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
85 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
86 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
87 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
88 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
89 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
90 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
91 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
92 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
93 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
94 2820209022 Unclassified Kiritimatiellaeota Th196P3bin76 Isolate Unclassified
95 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
96 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
97 2820412446 Unclassified Firmicutes Lab288P4bin39 Isolate Unclassified
98 2820474468 Unclassified Firmicutes Lab288P1bin84 Isolate Unclassified
99 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
100 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
101 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
102 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
103 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
104 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
105 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_106820 3300042616 Bacteria 3990
2 Ga0466715_115809 3300042616 Bacteria 8639
3 Ga0466715_463180 3300042616 Bacteria 3233
4 Ga0466726_253312 3300042619 Bacteria 8468
5 Ga0466728_110905 3300042620 Bacteria 5678
6 Ga0466705_293431 3300042612 Bacteria 2174
7 Ga0466705_382978 3300042612 Bacteria 7803
8 Ga0466733_056495 3300042659 Bacteria 6530
9 Ga0562378_0026 3300056814 Bacteria 575477
10 Ga0466703_056037 3300042636 Bacteria 14881
11 Ga0466703_339790 3300042636 Bacteria 11851
12 Ga0466704_228116 3300042643 Bacteria 5498
13 Ga0466708_135817 3300042652 Bacteria 4110
14 Ga0466708_322806 3300042652 Unclassified 3010
15 Ga0466727_258300 3300042655 Unclassified 2203
16 Ga0466706_039838 3300042599 Bacteria 28309
17 Ga0466706_107252 3300042599 Bacteria 1843
18 Ga0466706_280382 3300042599 Bacteria 16803
19 Ga0466707_026849 3300042601 Bacteria 29537
20 Ga0466707_180221 3300042601 Bacteria 5937
21 Ga0466720_025060 3300042607 Bacteria 2908
22 Ga0466720_039585 3300042607 Bacteria 24073
23 Ga0466720_112073 3300042607 Unclassified 5163
24 Ga0415639_019265 3300038395 Bacteria 3207
25 Ga0466691_129034 3300042593 Bacteria 3942
26 Ga0466691_204620 3300042593 Bacteria 26117
27 Ga0466694_064514 3300042594 Bacteria 49364
28 2227108589 2225789004 Bacteria 37551
29 JGI24696J40584_12957055 3300002834 Bacteria 3334
30 Ga0068305_10019061 3300005083 Bacteria 5223
31 Ga0123355_10000129 3300009826 Bacteria 87734
32 Ga0123355_10057067 3300009826 Bacteria 6319
33 Ga0123355_10214256 3300009826 Bacteria 2783
34 Ga0123356_10001861 3300010049 Bacteria 22845
35 Ga0123356_10011236 3300010049 Bacteria 8739
36 Ga0123356_10012905 3300010049 Bacteria 8088
37 Ga0123356_10023353 3300010049 Bacteria 5821
38 Ga0123353_10067402 3300010167 Bacteria 5747
39 Ga0123353_10238374 3300010167 Bacteria 2828
40 Ga0123353_10266199 3300010167 Bacteria 2644
41 Ga0123353_10436830 3300010167 Bacteria 1933
42 Ga0123354_10173720 3300010882 Bacteria 2494
43 Ga0123354_10182961 3300010882 Bacteria 2383
44 Ga0466712_208852 3300042614 Bacteria 6962
45 Ga0466715_077393 3300042616 Bacteria 22122
46 Ga0466715_394730 3300042616 Bacteria 51934
47 Ga0466715_500738 3300042616 Bacteria 10856
48 Ga0466728_245144 3300042620 Bacteria 1842
49 Ga0466728_284873 3300042620 Bacteria 2837
50 Ga0466733_185067 3300042659 Bacteria 39045
51 Ga0466729_233441 3300042621 Bacteria 5162
52 Ga0466703_028188 3300042636 Bacteria 5543
53 Ga0466703_338636 3300042636 Bacteria 3529
54 Ga0466704_045497 3300042643 Bacteria 37022
55 Ga0466708_079466 3300042652 Bacteria 4076
56 Ga0466708_100916 3300042652 Bacteria 2021
57 Ga0466708_385018 3300042652 Bacteria 18187
58 Ga0466706_184605 3300042599 Bacteria 32503
59 Ga0466707_088136 3300042601 Bacteria 71225
60 Ga0466707_207148 3300042601 Bacteria 55703
61 Ga0466713_019517 3300042602 Bacteria 68401
62 Ga0466719_313360 3300042606 Bacteria 15043
63 Ga0466720_155926 3300042607 Bacteria 8087
64 Ga0466722_064843 3300042609 Bacteria 5564
65 Ga0466694_097391 3300042594 Bacteria 28972
66 Ga0466694_184387 3300042594 Bacteria 2354
67 Ga0466696_008318 3300042596 Bacteria 7020
68 Ga0466699_134307 3300042597 Bacteria 1553
69 2227441929 2225789004 Bacteria 5476
70 IMNBL1DRAFT_c0001499 3300000062 Bacteria 17401
71 IMNBL1DRAFT_c0003870 3300000062 Bacteria 9312
72 JGI24702J35022_10009651 3300002462 Bacteria 5412
73 Ga0123355_10068501 3300009826 Bacteria 5708
74 Ga0123356_10061410 3300010049 Bacteria 3510
75 Ga0123356_10199430 3300010049 Bacteria 2039
76 Ga0123353_10039889 3300010167 Bacteria 7400
77 Ga0123353_10495774 3300010167 Bacteria 1781
78 Ga0466711_031338 3300042615 Unclassified 1918
79 Ga0466715_120477 3300042616 Bacteria 5927
80 Ga0466718_022534 3300042617 Bacteria 17892
81 Ga0466718_086476 3300042617 Bacteria 18485
82 Ga0466723_053983 3300042618 Bacteria 2609
83 Ga0466723_319690 3300042618 Bacteria 8383
84 Ga0466726_173251 3300042619 Bacteria 3511
85 Ga0466726_264199 3300042619 Bacteria 3876
86 Ga0466726_306105 3300042619 Bacteria 4270
87 Ga0466728_002159 3300042620 Bacteria 1579
88 Ga0466705_170373 3300042612 Bacteria 2904
89 Ga0466735_023367 3300042624 Bacteria 4700
90 Ga0466735_221438 3300042624 Bacteria 7869
91 Ga0466702_464025 3300042635 Bacteria 8383
92 Ga0466703_380522 3300042636 Bacteria 8440
93 Ga0466727_127156 3300042655 Bacteria 1368
94 Ga0466727_194409 3300042655 Bacteria 2558
95 Ga0466707_096470 3300042601 Unclassified 2810
96 Ga0466707_133081 3300042601 Bacteria 26278
97 Ga0466716_190459 3300042605 Bacteria 2093
98 Ga0415639_013845 3300038395 Bacteria 10185
99 Ga0415639_033856 3300038395 Bacteria 3480
100 Ga0415639_079872 3300038395 Bacteria 4431
101 Ga0466690_024512 3300042590 Bacteria 8742
102 Ga0466693_160387 3300042592 Bacteria 14935
103 Ga0466691_100981 3300042593 Bacteria 7051
104 JGI24695J34938_10000266 3300002450 Bacteria 50844
105 JGI24695J34938_10002609 3300002450 Bacteria 13563
106 Ga0123357_10107083 3300009784 Bacteria 3581
107 Ga0123356_10013999 3300010049 Unclassified 7719
108 Ga0123356_10119250 3300010049 Bacteria 2563
109 Ga0123353_10018307 3300010167 Bacteria 10352
110 Ga0123353_10124904 3300010167 Bacteria 4135
111 Ga0123353_10371481 3300010167 Bacteria 2144
112 Ga0466715_470699 3300042616 Unclassified 34036
113 Ga0466718_018747 3300042617 Bacteria 2331
114 Ga0466718_040373 3300042617 Bacteria 43603
115 Ga0466723_009449 3300042618 Bacteria 15129
116 Ga0466728_368689 3300042620 Bacteria 30011
117 Ga0466704_319473 3300042643 Bacteria 11206
118 Ga0466709_285098 3300042648 Bacteria 15718
119 Ga0466708_256469 3300042652 Bacteria 4430
120 Ga0466708_296209 3300042652 Bacteria 7900
121 Ga0466725_028237 3300042654 Bacteria 3656
122 Ga0466706_063474 3300042599 Bacteria 28859
123 Ga0466707_378319 3300042601 Bacteria 14257
124 Ga0466707_421547 3300042601 Bacteria 3201
125 Ga0466713_115343 3300042602 Bacteria 67413
126 Ga0466714_058855 3300042603 Bacteria 12561
127 Ga0466719_031138 3300042606 Bacteria 23168
128 Ga0466719_094853 3300042606 Archaea 6224
129 Ga0466719_233568 3300042606 Bacteria 2379
130 Ga0466720_022959 3300042607 Bacteria 5242
131 Ga0456237_0000349 3300041968 Bacteria 6862
132 Ga0466690_103610 3300042590 Bacteria 1723
133 Ga0466692_163004 3300042591 Bacteria 30267
134 Ga0466691_044966 3300042593 Bacteria 7387
135 Ga0466691_053970 3300042593 Bacteria 7206
136 Ga0466694_144862 3300042594 Bacteria 1873
137 Ga0466694_146969 3300042594 Bacteria 18139
138 Ga0466696_277862 3300042596 Bacteria 17284
139 Ga0466696_392895 3300042596 Bacteria 1891
140 Ga0466699_152090 3300042597 Bacteria 7786
141 2227222481 2225789004 Bacteria 7459
142 2227462985 2225789004 Bacteria 5341
143 JGI24695J34938_10001702 3300002450 Bacteria 18184
144 JGI24695J34938_10006394 3300002450 Bacteria 7090
145 JGI24695J34938_10022532 3300002450 Bacteria 3056
146 JGI24703J35330_11734986 3300002501 Bacteria 2942
147 Ga0123357_10083375 3300009784 Bacteria 4196
148 Ga0123355_10070373 3300009826 Bacteria 5619
149 Ga0123354_10023756 3300010882 Unclassified 9666
150 Ga0466715_299750 3300042616 Bacteria 22858
151 Ga0466726_370220 3300042619 Bacteria 1855
152 Ga0466728_164251 3300042620 Bacteria 1930
153 Ga0466728_324055 3300042620 Bacteria 4362
154 Ga0466733_053336 3300042659 Bacteria 3578
155 Ga0562376_0132 3300056857 Bacteria 164128
156 Ga0466703_092486 3300042636 Bacteria 10400
157 Ga0466703_153135 3300042636 Bacteria 16646
158 Ga0466709_231290 3300042648 Bacteria 6542
159 Ga0466727_088522 3300042655 Bacteria 3344
160 Ga0466727_236701 3300042655 Bacteria 3747
161 Ga0466727_294122 3300042655 Bacteria 3177
162 Ga0466701_100201 3300042598 Bacteria 2617
163 Ga0466706_255228 3300042599 Bacteria 19969
164 Ga0466707_292522 3300042601 Bacteria 7547
165 Ga0466707_423057 3300042601 Bacteria 2346
166 Ga0466713_001291 3300042602 Bacteria 1651
167 Ga0466716_080590 3300042605 Bacteria 12076
168 Ga0466719_192266 3300042606 Bacteria 6231
169 Ga0466719_273816 3300042606 Bacteria 2439
170 Ga0466720_233106 3300042607 Bacteria 42880
171 Ga0466722_079896 3300042609 Bacteria 3877
172 Ga0466722_122638 3300042609 Bacteria 30963
173 Ga0466692_059189 3300042591 Bacteria 10724
174 Ga0466699_250291 3300042597 Bacteria 49857
175 2230941936 2228664002 Bacteria 3619
176 JGI24702J35022_10027450 3300002462 Bacteria 3063
177 JGI24703J35330_11748494 3300002501 Bacteria 17618
178 Ga0072940_1014610 3300005200 Bacteria 4008
179 Ga0123353_10009235 3300010167 Bacteria 13574
180 Ga0123353_10012407 3300010167 Bacteria 12110
181 Ga0466712_092272 3300042614 Bacteria 2853
182 Ga0466711_359789 3300042615 Bacteria 24829
183 Ga0466715_001017 3300042616 Bacteria 12101
184 Ga0466723_035382 3300042618 Bacteria 14861
185 Ga0466723_046495 3300042618 Bacteria 25534
186 Ga0466723_368534 3300042618 Bacteria 4668
187 Ga0466726_058990 3300042619 Bacteria 1397
188 Ga0466726_108283 3300042619 Bacteria 13947
189 Ga0466726_203141 3300042619 Bacteria 7802
190 Ga0466726_268275 3300042619 Bacteria 1809
191 Ga0466726_416926 3300042619 Bacteria 2177
192 Ga0466729_080852 3300042621 Bacteria 4881
193 Ga0466732_152032 3300042656 Bacteria 16830
194 Ga0562379_0437 3300056790 Bacteria 88272
195 Ga0562374_0034 3300057007 Bacteria 713140
196 Ga0466731_297262 3300042622 Bacteria 16938
197 Ga0466704_152104 3300042643 Bacteria 10375
198 Ga0466709_233970 3300042648 Bacteria 334556
199 Ga0466727_339950 3300042655 Bacteria 1796
200 Ga0466706_019956 3300042599 Bacteria 28693
201 Ga0466707_087017 3300042601 Bacteria 7197
202 Ga0466707_123662 3300042601 Bacteria 22376
203 Ga0466707_253202 3300042601 Bacteria 3924
204 Ga0466707_331152 3300042601 Bacteria 2875
205 Ga0466713_079865 3300042602 Bacteria 2441
206 Ga0466713_100538 3300042602 Bacteria 188125
207 Ga0466716_219621 3300042605 Bacteria 13242
208 Ga0466716_417809 3300042605 Bacteria 1824
209 Ga0466719_085997 3300042606 Bacteria 10550
210 Ga0466719_150934 3300042606 Bacteria 9151
211 Ga0466722_150172 3300042609 Bacteria 3376
212 Ga0466722_208307 3300042609 Bacteria 3130
213 Ga0415639_022679 3300038395 Bacteria 17210
214 Ga0466690_045929 3300042590 Bacteria 2433
215 Ga0466692_173925 3300042591 Bacteria 105430
216 Ga0466696_440074 3300042596 Bacteria 4817
217 Ga0466699_124796 3300042597 Bacteria 11856
218 Ga0466699_363908 3300042597 Bacteria 2973
219 2227080784 2225789004 Bacteria 153522
220 AustNasuHG_c1000778 3300000089 Bacteria 11371
221 AustNasuHG_c1002070 3300000089 Unclassified 7244
222 JGI24695J34938_10000175 3300002450 Bacteria 59525
223 JGI24700J35501_10930892 3300002508 Bacteria 34773
224 Ga0123357_10021508 3300009784 Bacteria 8638
225 Ga0123355_10005065 3300009826 Bacteria 19197
226 Ga0123353_10094545 3300010167 Bacteria 4815
227 Ga0466705_388418 3300042612 Bacteria 5857
228 Ga0466712_066093 3300042614 Bacteria 8090
229 Ga0466712_171486 3300042614 Bacteria 13450
230 Ga0466723_248372 3300042618 Unclassified 4605
231 Ga0466705_074632 3300042612 Bacteria 22401
232 Ga0466705_242651 3300042612 Bacteria 11633
233 Ga0466705_319279 3300042612 Bacteria 4244
234 Ga0466732_202234 3300042656 Unclassified 2382
235 Ga0466732_225559 3300042656 Bacteria 17786
236 Ga0466709_002586 3300042648 Bacteria 6850
237 Ga0466709_231548 3300042648 Bacteria 1669
238 Ga0466708_257511 3300042652 Bacteria 1877
239 Ga0466708_295183 3300042652 Bacteria 30268
240 Ga0466707_144106 3300042601 Bacteria 3503
241 Ga0466707_371141 3300042601 Bacteria 6145
242 Ga0466713_109902 3300042602 Bacteria 3340
243 Ga0466713_137087 3300042602 Bacteria 38406
244 Ga0466719_320136 3300042606 Bacteria 1986
245 Ga0466720_112082 3300042607 Bacteria 2326
246 Ga0466690_129590 3300042590 Unclassified 3755
247 Ga0466692_204916 3300042591 Bacteria 20051
248 Ga0466694_033240 3300042594 Bacteria 9312
249 Ga0466699_035535 3300042597 Bacteria 5497
250 Ga0466699_089968 3300042597 Bacteria 2262
251 Ga0466699_236215 3300042597 Bacteria 1700
252 AustNasuHG_c1009917 3300000089 Bacteria 3329
253 AustNasuHG_c1020345 3300000089 Unclassified 2163
254 JGI24695J34938_10006714 3300002450 Bacteria 6853
255 JGI24696J40584_12958620 3300002834 Bacteria 4274
256 Ga0123353_10014465 3300010167 Bacteria 11379
257 Ga0123354_10064205 3300010882 Archaea 5387
258 Ga0466715_257012 3300042616 Bacteria 4234
259 Ga0466715_442109 3300042616 Bacteria 8897
260 Ga0466715_542720 3300042616 Bacteria 2044
261 Ga0466723_151419 3300042618 Unclassified 4985
262 Ga0466723_291519 3300042618 Bacteria 4850
263 Ga0466726_088534 3300042619 Bacteria 6975
264 Ga0466732_207623 3300042656 Bacteria 13905
265 Ga0562375_3045 3300056856 Bacteria 16842
266 Ga0466706_116168 3300042599 Bacteria 38789
267 Ga0466706_148775 3300042599 Bacteria 10907
268 Ga0466706_195903 3300042599 Bacteria 15097
269 Ga0466713_020133 3300042602 Bacteria 4573
270 Ga0466719_083216 3300042606 Bacteria 6822
271 Ga0466719_435910 3300042606 Bacteria 19989
272 Ga0466722_000121 3300042609 Bacteria 2032
273 Ga0466722_083792 3300042609 Bacteria 2957
274 Ga0264413_104061 3300024493 Bacteria 24138
275 Ga0466691_083553 3300042593 Bacteria 11632
276 Ga0466696_306479 3300042596 Bacteria 21703
277 2230929947 2228664001 Bacteria 8707
278 AustNasuHG_c1002174 3300000089 Bacteria 7087
279 Ga0068302_10064973 3300005071 Bacteria 14097
280 Ga0123357_10185528 3300009784 Bacteria 2414
281 Ga0123355_10042732 3300009826 Bacteria 7376
282 Ga0123355_10416170 3300009826 Bacteria 1721
283 Ga0123353_10004100 3300010167 Bacteria 18666
284 Ga0123353_10124010 3300010167 Bacteria 4152

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00285 Citrate_synt Citrate synthase, C-terminal domain 99 492 0.92

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00285 GO:0046912 acyltransferase activity, acyl groups converted into alkyl on transfer MF

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.