Protein Family IF10003
Metagenome
Isolate
327
Members
105
Samples
284
Scaffolds
451.38
Avg Length
Representative Sequence
- ID
- 3300042652|Ga0466708_385018|Ga0466708_385018_1885_3411
- Length
- 508 aa
- Sequence
- MRSVKDRIGRERVTMPLSGPEIRVLRAENGKEAERQATTGDEGVHRMAVTDYTTLDRKYSKITPEIRRLADLCVSNGQIEPELYGRYQVNSGLRDLNGNGVLTGLTEISEIKAFEFDGNGAKTPIDGELCFRGYNVEELVSGFIDEERAGFEETTYLLIFGELPNKEELEAFRKLLSKYRTLPTGFVRDIIMKAPSDDMMNTLARSVLTLHAYDGNANDISIPNVLRQSLLLIAVFPMLAVYGYQAYRHYFGGDDLFIHTPKPQLSTAENLLQMLRKNGKYSTLEAKILDLSLVLHAEHGGXXXXTFTTHVVSSSGTDTYSSVAASLGSLKGPKHGGANIRVVQMFDDMKANIKDWADDEQVERYLRDLLNKKAFDKAGLIYGMGHAVYSLSDPRANIFKGFVEKLSAEKGRNDEYALYSSVARLAPKVIGEERRIYKGVSANVDFYSGFVYSMLDLPSELYTPLFAIARISGWSAHRIEELINAGKIIRPAYRSVSDRRAYVPLQRR
Sample Types
Isolate
13.2%
Metagenome
86.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
27.5%
Unclassified
26.5%
Blattidae
13.7%
Kalotermitidae
13.7%
Rhinotermitidae
4.9%
Tenebrionidae
4.9%
Termopsidae
3.9%
Passalidae
2.0%
Scarabaeidae
1.0%
Hodotermitidae
1.0%
Drosophilidae
1.0%
Taxonomy
Archaea
2
Bacteria
311
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 2 | 2940292506 | Lachnoclostridium sp. PH5-23 | Isolate | Blattidae |
| 3 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 4 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 5 | 2820584674 | Unclassified Firmicutes Emb289P1bin98 | Isolate | Unclassified |
| 6 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 2940270707 | Lachnoclostridium sp. PF1-13 | Isolate | Blattidae |
| 18 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 19 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 20 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 21 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 22 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 23 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 2940277027 | Lachnospiraceae bacterium PF1-21 | Isolate | Blattidae |
| 26 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 27 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 28 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 29 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 30 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 31 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 32 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 36 | 2940286528 | Lachnospiraceae bacterium PFB1-21 | Isolate | Blattidae |
| 37 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 38 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 39 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 40 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 41 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 42 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 43 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 44 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 45 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 46 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 47 | 2940264388 | Lachnospiraceae bacterium PFB1-17 | Isolate | Blattidae |
| 48 | 2940267548 | Lachnospiraceae bacterium PFB1-22 | Isolate | Blattidae |
| 49 | 2940280053 | Lachnospiraceae bacterium PF1-22 | Isolate | Blattidae |
| 50 | 2944625312 | Dysgonomonas sp. PF1-3 | Isolate | Blattidae |
| 51 | 2228664002 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3a from Florida, USA | Metagenome | Termitidae |
| 52 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 53 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 54 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 55 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 56 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 57 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 58 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 59 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 60 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 61 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 62 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 63 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 64 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 65 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 66 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 67 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 68 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 69 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 70 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 71 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 72 | 2820657860 | Unclassified Firmicutes Co191P4bin15 | Isolate | Unclassified |
| 73 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 74 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 75 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 76 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 77 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 78 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 79 | 2940295490 | Lachnospiraceae bacterium PH1-22 | Isolate | Blattidae |
| 80 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 81 | 2820492969 | Unclassified Firmicutes Lab288P1bin6 | Isolate | Unclassified |
| 82 | 2820518089 | Unclassified Firmicutes Lab288P1bin27 | Isolate | Unclassified |
| 83 | 2820705605 | Unclassified Firmicutes Co191P1bin34 | Isolate | Unclassified |
| 84 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 85 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 86 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 87 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 88 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 89 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 90 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 91 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 92 | 2940273867 | Lachnoclostridium sp. PH1-16 | Isolate | Blattidae |
| 93 | 2940289514 | Lachnospiraceae bacterium PM6-15 | Isolate | Blattidae |
| 94 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 95 | 2820234266 | Unclassified Firmicutes Th196P3bin99 | Isolate | Unclassified |
| 96 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 97 | 2820412446 | Unclassified Firmicutes Lab288P4bin39 | Isolate | Unclassified |
| 98 | 2820474468 | Unclassified Firmicutes Lab288P1bin84 | Isolate | Unclassified |
| 99 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 100 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 101 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 102 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 103 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 104 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 105 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_106820 | 3300042616 | Bacteria | 3990 |
| 2 | Ga0466715_115809 | 3300042616 | Bacteria | 8639 |
| 3 | Ga0466715_463180 | 3300042616 | Bacteria | 3233 |
| 4 | Ga0466726_253312 | 3300042619 | Bacteria | 8468 |
| 5 | Ga0466728_110905 | 3300042620 | Bacteria | 5678 |
| 6 | Ga0466705_293431 | 3300042612 | Bacteria | 2174 |
| 7 | Ga0466705_382978 | 3300042612 | Bacteria | 7803 |
| 8 | Ga0466733_056495 | 3300042659 | Bacteria | 6530 |
| 9 | Ga0562378_0026 | 3300056814 | Bacteria | 575477 |
| 10 | Ga0466703_056037 | 3300042636 | Bacteria | 14881 |
| 11 | Ga0466703_339790 | 3300042636 | Bacteria | 11851 |
| 12 | Ga0466704_228116 | 3300042643 | Bacteria | 5498 |
| 13 | Ga0466708_135817 | 3300042652 | Bacteria | 4110 |
| 14 | Ga0466708_322806 | 3300042652 | Unclassified | 3010 |
| 15 | Ga0466727_258300 | 3300042655 | Unclassified | 2203 |
| 16 | Ga0466706_039838 | 3300042599 | Bacteria | 28309 |
| 17 | Ga0466706_107252 | 3300042599 | Bacteria | 1843 |
| 18 | Ga0466706_280382 | 3300042599 | Bacteria | 16803 |
| 19 | Ga0466707_026849 | 3300042601 | Bacteria | 29537 |
| 20 | Ga0466707_180221 | 3300042601 | Bacteria | 5937 |
| 21 | Ga0466720_025060 | 3300042607 | Bacteria | 2908 |
| 22 | Ga0466720_039585 | 3300042607 | Bacteria | 24073 |
| 23 | Ga0466720_112073 | 3300042607 | Unclassified | 5163 |
| 24 | Ga0415639_019265 | 3300038395 | Bacteria | 3207 |
| 25 | Ga0466691_129034 | 3300042593 | Bacteria | 3942 |
| 26 | Ga0466691_204620 | 3300042593 | Bacteria | 26117 |
| 27 | Ga0466694_064514 | 3300042594 | Bacteria | 49364 |
| 28 | 2227108589 | 2225789004 | Bacteria | 37551 |
| 29 | JGI24696J40584_12957055 | 3300002834 | Bacteria | 3334 |
| 30 | Ga0068305_10019061 | 3300005083 | Bacteria | 5223 |
| 31 | Ga0123355_10000129 | 3300009826 | Bacteria | 87734 |
| 32 | Ga0123355_10057067 | 3300009826 | Bacteria | 6319 |
| 33 | Ga0123355_10214256 | 3300009826 | Bacteria | 2783 |
| 34 | Ga0123356_10001861 | 3300010049 | Bacteria | 22845 |
| 35 | Ga0123356_10011236 | 3300010049 | Bacteria | 8739 |
| 36 | Ga0123356_10012905 | 3300010049 | Bacteria | 8088 |
| 37 | Ga0123356_10023353 | 3300010049 | Bacteria | 5821 |
| 38 | Ga0123353_10067402 | 3300010167 | Bacteria | 5747 |
| 39 | Ga0123353_10238374 | 3300010167 | Bacteria | 2828 |
| 40 | Ga0123353_10266199 | 3300010167 | Bacteria | 2644 |
| 41 | Ga0123353_10436830 | 3300010167 | Bacteria | 1933 |
| 42 | Ga0123354_10173720 | 3300010882 | Bacteria | 2494 |
| 43 | Ga0123354_10182961 | 3300010882 | Bacteria | 2383 |
| 44 | Ga0466712_208852 | 3300042614 | Bacteria | 6962 |
| 45 | Ga0466715_077393 | 3300042616 | Bacteria | 22122 |
| 46 | Ga0466715_394730 | 3300042616 | Bacteria | 51934 |
| 47 | Ga0466715_500738 | 3300042616 | Bacteria | 10856 |
| 48 | Ga0466728_245144 | 3300042620 | Bacteria | 1842 |
| 49 | Ga0466728_284873 | 3300042620 | Bacteria | 2837 |
| 50 | Ga0466733_185067 | 3300042659 | Bacteria | 39045 |
| 51 | Ga0466729_233441 | 3300042621 | Bacteria | 5162 |
| 52 | Ga0466703_028188 | 3300042636 | Bacteria | 5543 |
| 53 | Ga0466703_338636 | 3300042636 | Bacteria | 3529 |
| 54 | Ga0466704_045497 | 3300042643 | Bacteria | 37022 |
| 55 | Ga0466708_079466 | 3300042652 | Bacteria | 4076 |
| 56 | Ga0466708_100916 | 3300042652 | Bacteria | 2021 |
| 57 | Ga0466708_385018 | 3300042652 | Bacteria | 18187 |
| 58 | Ga0466706_184605 | 3300042599 | Bacteria | 32503 |
| 59 | Ga0466707_088136 | 3300042601 | Bacteria | 71225 |
| 60 | Ga0466707_207148 | 3300042601 | Bacteria | 55703 |
| 61 | Ga0466713_019517 | 3300042602 | Bacteria | 68401 |
| 62 | Ga0466719_313360 | 3300042606 | Bacteria | 15043 |
| 63 | Ga0466720_155926 | 3300042607 | Bacteria | 8087 |
| 64 | Ga0466722_064843 | 3300042609 | Bacteria | 5564 |
| 65 | Ga0466694_097391 | 3300042594 | Bacteria | 28972 |
| 66 | Ga0466694_184387 | 3300042594 | Bacteria | 2354 |
| 67 | Ga0466696_008318 | 3300042596 | Bacteria | 7020 |
| 68 | Ga0466699_134307 | 3300042597 | Bacteria | 1553 |
| 69 | 2227441929 | 2225789004 | Bacteria | 5476 |
| 70 | IMNBL1DRAFT_c0001499 | 3300000062 | Bacteria | 17401 |
| 71 | IMNBL1DRAFT_c0003870 | 3300000062 | Bacteria | 9312 |
| 72 | JGI24702J35022_10009651 | 3300002462 | Bacteria | 5412 |
| 73 | Ga0123355_10068501 | 3300009826 | Bacteria | 5708 |
| 74 | Ga0123356_10061410 | 3300010049 | Bacteria | 3510 |
| 75 | Ga0123356_10199430 | 3300010049 | Bacteria | 2039 |
| 76 | Ga0123353_10039889 | 3300010167 | Bacteria | 7400 |
| 77 | Ga0123353_10495774 | 3300010167 | Bacteria | 1781 |
| 78 | Ga0466711_031338 | 3300042615 | Unclassified | 1918 |
| 79 | Ga0466715_120477 | 3300042616 | Bacteria | 5927 |
| 80 | Ga0466718_022534 | 3300042617 | Bacteria | 17892 |
| 81 | Ga0466718_086476 | 3300042617 | Bacteria | 18485 |
| 82 | Ga0466723_053983 | 3300042618 | Bacteria | 2609 |
| 83 | Ga0466723_319690 | 3300042618 | Bacteria | 8383 |
| 84 | Ga0466726_173251 | 3300042619 | Bacteria | 3511 |
| 85 | Ga0466726_264199 | 3300042619 | Bacteria | 3876 |
| 86 | Ga0466726_306105 | 3300042619 | Bacteria | 4270 |
| 87 | Ga0466728_002159 | 3300042620 | Bacteria | 1579 |
| 88 | Ga0466705_170373 | 3300042612 | Bacteria | 2904 |
| 89 | Ga0466735_023367 | 3300042624 | Bacteria | 4700 |
| 90 | Ga0466735_221438 | 3300042624 | Bacteria | 7869 |
| 91 | Ga0466702_464025 | 3300042635 | Bacteria | 8383 |
| 92 | Ga0466703_380522 | 3300042636 | Bacteria | 8440 |
| 93 | Ga0466727_127156 | 3300042655 | Bacteria | 1368 |
| 94 | Ga0466727_194409 | 3300042655 | Bacteria | 2558 |
| 95 | Ga0466707_096470 | 3300042601 | Unclassified | 2810 |
| 96 | Ga0466707_133081 | 3300042601 | Bacteria | 26278 |
| 97 | Ga0466716_190459 | 3300042605 | Bacteria | 2093 |
| 98 | Ga0415639_013845 | 3300038395 | Bacteria | 10185 |
| 99 | Ga0415639_033856 | 3300038395 | Bacteria | 3480 |
| 100 | Ga0415639_079872 | 3300038395 | Bacteria | 4431 |
| 101 | Ga0466690_024512 | 3300042590 | Bacteria | 8742 |
| 102 | Ga0466693_160387 | 3300042592 | Bacteria | 14935 |
| 103 | Ga0466691_100981 | 3300042593 | Bacteria | 7051 |
| 104 | JGI24695J34938_10000266 | 3300002450 | Bacteria | 50844 |
| 105 | JGI24695J34938_10002609 | 3300002450 | Bacteria | 13563 |
| 106 | Ga0123357_10107083 | 3300009784 | Bacteria | 3581 |
| 107 | Ga0123356_10013999 | 3300010049 | Unclassified | 7719 |
| 108 | Ga0123356_10119250 | 3300010049 | Bacteria | 2563 |
| 109 | Ga0123353_10018307 | 3300010167 | Bacteria | 10352 |
| 110 | Ga0123353_10124904 | 3300010167 | Bacteria | 4135 |
| 111 | Ga0123353_10371481 | 3300010167 | Bacteria | 2144 |
| 112 | Ga0466715_470699 | 3300042616 | Unclassified | 34036 |
| 113 | Ga0466718_018747 | 3300042617 | Bacteria | 2331 |
| 114 | Ga0466718_040373 | 3300042617 | Bacteria | 43603 |
| 115 | Ga0466723_009449 | 3300042618 | Bacteria | 15129 |
| 116 | Ga0466728_368689 | 3300042620 | Bacteria | 30011 |
| 117 | Ga0466704_319473 | 3300042643 | Bacteria | 11206 |
| 118 | Ga0466709_285098 | 3300042648 | Bacteria | 15718 |
| 119 | Ga0466708_256469 | 3300042652 | Bacteria | 4430 |
| 120 | Ga0466708_296209 | 3300042652 | Bacteria | 7900 |
| 121 | Ga0466725_028237 | 3300042654 | Bacteria | 3656 |
| 122 | Ga0466706_063474 | 3300042599 | Bacteria | 28859 |
| 123 | Ga0466707_378319 | 3300042601 | Bacteria | 14257 |
| 124 | Ga0466707_421547 | 3300042601 | Bacteria | 3201 |
| 125 | Ga0466713_115343 | 3300042602 | Bacteria | 67413 |
| 126 | Ga0466714_058855 | 3300042603 | Bacteria | 12561 |
| 127 | Ga0466719_031138 | 3300042606 | Bacteria | 23168 |
| 128 | Ga0466719_094853 | 3300042606 | Archaea | 6224 |
| 129 | Ga0466719_233568 | 3300042606 | Bacteria | 2379 |
| 130 | Ga0466720_022959 | 3300042607 | Bacteria | 5242 |
| 131 | Ga0456237_0000349 | 3300041968 | Bacteria | 6862 |
| 132 | Ga0466690_103610 | 3300042590 | Bacteria | 1723 |
| 133 | Ga0466692_163004 | 3300042591 | Bacteria | 30267 |
| 134 | Ga0466691_044966 | 3300042593 | Bacteria | 7387 |
| 135 | Ga0466691_053970 | 3300042593 | Bacteria | 7206 |
| 136 | Ga0466694_144862 | 3300042594 | Bacteria | 1873 |
| 137 | Ga0466694_146969 | 3300042594 | Bacteria | 18139 |
| 138 | Ga0466696_277862 | 3300042596 | Bacteria | 17284 |
| 139 | Ga0466696_392895 | 3300042596 | Bacteria | 1891 |
| 140 | Ga0466699_152090 | 3300042597 | Bacteria | 7786 |
| 141 | 2227222481 | 2225789004 | Bacteria | 7459 |
| 142 | 2227462985 | 2225789004 | Bacteria | 5341 |
| 143 | JGI24695J34938_10001702 | 3300002450 | Bacteria | 18184 |
| 144 | JGI24695J34938_10006394 | 3300002450 | Bacteria | 7090 |
| 145 | JGI24695J34938_10022532 | 3300002450 | Bacteria | 3056 |
| 146 | JGI24703J35330_11734986 | 3300002501 | Bacteria | 2942 |
| 147 | Ga0123357_10083375 | 3300009784 | Bacteria | 4196 |
| 148 | Ga0123355_10070373 | 3300009826 | Bacteria | 5619 |
| 149 | Ga0123354_10023756 | 3300010882 | Unclassified | 9666 |
| 150 | Ga0466715_299750 | 3300042616 | Bacteria | 22858 |
| 151 | Ga0466726_370220 | 3300042619 | Bacteria | 1855 |
| 152 | Ga0466728_164251 | 3300042620 | Bacteria | 1930 |
| 153 | Ga0466728_324055 | 3300042620 | Bacteria | 4362 |
| 154 | Ga0466733_053336 | 3300042659 | Bacteria | 3578 |
| 155 | Ga0562376_0132 | 3300056857 | Bacteria | 164128 |
| 156 | Ga0466703_092486 | 3300042636 | Bacteria | 10400 |
| 157 | Ga0466703_153135 | 3300042636 | Bacteria | 16646 |
| 158 | Ga0466709_231290 | 3300042648 | Bacteria | 6542 |
| 159 | Ga0466727_088522 | 3300042655 | Bacteria | 3344 |
| 160 | Ga0466727_236701 | 3300042655 | Bacteria | 3747 |
| 161 | Ga0466727_294122 | 3300042655 | Bacteria | 3177 |
| 162 | Ga0466701_100201 | 3300042598 | Bacteria | 2617 |
| 163 | Ga0466706_255228 | 3300042599 | Bacteria | 19969 |
| 164 | Ga0466707_292522 | 3300042601 | Bacteria | 7547 |
| 165 | Ga0466707_423057 | 3300042601 | Bacteria | 2346 |
| 166 | Ga0466713_001291 | 3300042602 | Bacteria | 1651 |
| 167 | Ga0466716_080590 | 3300042605 | Bacteria | 12076 |
| 168 | Ga0466719_192266 | 3300042606 | Bacteria | 6231 |
| 169 | Ga0466719_273816 | 3300042606 | Bacteria | 2439 |
| 170 | Ga0466720_233106 | 3300042607 | Bacteria | 42880 |
| 171 | Ga0466722_079896 | 3300042609 | Bacteria | 3877 |
| 172 | Ga0466722_122638 | 3300042609 | Bacteria | 30963 |
| 173 | Ga0466692_059189 | 3300042591 | Bacteria | 10724 |
| 174 | Ga0466699_250291 | 3300042597 | Bacteria | 49857 |
| 175 | 2230941936 | 2228664002 | Bacteria | 3619 |
| 176 | JGI24702J35022_10027450 | 3300002462 | Bacteria | 3063 |
| 177 | JGI24703J35330_11748494 | 3300002501 | Bacteria | 17618 |
| 178 | Ga0072940_1014610 | 3300005200 | Bacteria | 4008 |
| 179 | Ga0123353_10009235 | 3300010167 | Bacteria | 13574 |
| 180 | Ga0123353_10012407 | 3300010167 | Bacteria | 12110 |
| 181 | Ga0466712_092272 | 3300042614 | Bacteria | 2853 |
| 182 | Ga0466711_359789 | 3300042615 | Bacteria | 24829 |
| 183 | Ga0466715_001017 | 3300042616 | Bacteria | 12101 |
| 184 | Ga0466723_035382 | 3300042618 | Bacteria | 14861 |
| 185 | Ga0466723_046495 | 3300042618 | Bacteria | 25534 |
| 186 | Ga0466723_368534 | 3300042618 | Bacteria | 4668 |
| 187 | Ga0466726_058990 | 3300042619 | Bacteria | 1397 |
| 188 | Ga0466726_108283 | 3300042619 | Bacteria | 13947 |
| 189 | Ga0466726_203141 | 3300042619 | Bacteria | 7802 |
| 190 | Ga0466726_268275 | 3300042619 | Bacteria | 1809 |
| 191 | Ga0466726_416926 | 3300042619 | Bacteria | 2177 |
| 192 | Ga0466729_080852 | 3300042621 | Bacteria | 4881 |
| 193 | Ga0466732_152032 | 3300042656 | Bacteria | 16830 |
| 194 | Ga0562379_0437 | 3300056790 | Bacteria | 88272 |
| 195 | Ga0562374_0034 | 3300057007 | Bacteria | 713140 |
| 196 | Ga0466731_297262 | 3300042622 | Bacteria | 16938 |
| 197 | Ga0466704_152104 | 3300042643 | Bacteria | 10375 |
| 198 | Ga0466709_233970 | 3300042648 | Bacteria | 334556 |
| 199 | Ga0466727_339950 | 3300042655 | Bacteria | 1796 |
| 200 | Ga0466706_019956 | 3300042599 | Bacteria | 28693 |
| 201 | Ga0466707_087017 | 3300042601 | Bacteria | 7197 |
| 202 | Ga0466707_123662 | 3300042601 | Bacteria | 22376 |
| 203 | Ga0466707_253202 | 3300042601 | Bacteria | 3924 |
| 204 | Ga0466707_331152 | 3300042601 | Bacteria | 2875 |
| 205 | Ga0466713_079865 | 3300042602 | Bacteria | 2441 |
| 206 | Ga0466713_100538 | 3300042602 | Bacteria | 188125 |
| 207 | Ga0466716_219621 | 3300042605 | Bacteria | 13242 |
| 208 | Ga0466716_417809 | 3300042605 | Bacteria | 1824 |
| 209 | Ga0466719_085997 | 3300042606 | Bacteria | 10550 |
| 210 | Ga0466719_150934 | 3300042606 | Bacteria | 9151 |
| 211 | Ga0466722_150172 | 3300042609 | Bacteria | 3376 |
| 212 | Ga0466722_208307 | 3300042609 | Bacteria | 3130 |
| 213 | Ga0415639_022679 | 3300038395 | Bacteria | 17210 |
| 214 | Ga0466690_045929 | 3300042590 | Bacteria | 2433 |
| 215 | Ga0466692_173925 | 3300042591 | Bacteria | 105430 |
| 216 | Ga0466696_440074 | 3300042596 | Bacteria | 4817 |
| 217 | Ga0466699_124796 | 3300042597 | Bacteria | 11856 |
| 218 | Ga0466699_363908 | 3300042597 | Bacteria | 2973 |
| 219 | 2227080784 | 2225789004 | Bacteria | 153522 |
| 220 | AustNasuHG_c1000778 | 3300000089 | Bacteria | 11371 |
| 221 | AustNasuHG_c1002070 | 3300000089 | Unclassified | 7244 |
| 222 | JGI24695J34938_10000175 | 3300002450 | Bacteria | 59525 |
| 223 | JGI24700J35501_10930892 | 3300002508 | Bacteria | 34773 |
| 224 | Ga0123357_10021508 | 3300009784 | Bacteria | 8638 |
| 225 | Ga0123355_10005065 | 3300009826 | Bacteria | 19197 |
| 226 | Ga0123353_10094545 | 3300010167 | Bacteria | 4815 |
| 227 | Ga0466705_388418 | 3300042612 | Bacteria | 5857 |
| 228 | Ga0466712_066093 | 3300042614 | Bacteria | 8090 |
| 229 | Ga0466712_171486 | 3300042614 | Bacteria | 13450 |
| 230 | Ga0466723_248372 | 3300042618 | Unclassified | 4605 |
| 231 | Ga0466705_074632 | 3300042612 | Bacteria | 22401 |
| 232 | Ga0466705_242651 | 3300042612 | Bacteria | 11633 |
| 233 | Ga0466705_319279 | 3300042612 | Bacteria | 4244 |
| 234 | Ga0466732_202234 | 3300042656 | Unclassified | 2382 |
| 235 | Ga0466732_225559 | 3300042656 | Bacteria | 17786 |
| 236 | Ga0466709_002586 | 3300042648 | Bacteria | 6850 |
| 237 | Ga0466709_231548 | 3300042648 | Bacteria | 1669 |
| 238 | Ga0466708_257511 | 3300042652 | Bacteria | 1877 |
| 239 | Ga0466708_295183 | 3300042652 | Bacteria | 30268 |
| 240 | Ga0466707_144106 | 3300042601 | Bacteria | 3503 |
| 241 | Ga0466707_371141 | 3300042601 | Bacteria | 6145 |
| 242 | Ga0466713_109902 | 3300042602 | Bacteria | 3340 |
| 243 | Ga0466713_137087 | 3300042602 | Bacteria | 38406 |
| 244 | Ga0466719_320136 | 3300042606 | Bacteria | 1986 |
| 245 | Ga0466720_112082 | 3300042607 | Bacteria | 2326 |
| 246 | Ga0466690_129590 | 3300042590 | Unclassified | 3755 |
| 247 | Ga0466692_204916 | 3300042591 | Bacteria | 20051 |
| 248 | Ga0466694_033240 | 3300042594 | Bacteria | 9312 |
| 249 | Ga0466699_035535 | 3300042597 | Bacteria | 5497 |
| 250 | Ga0466699_089968 | 3300042597 | Bacteria | 2262 |
| 251 | Ga0466699_236215 | 3300042597 | Bacteria | 1700 |
| 252 | AustNasuHG_c1009917 | 3300000089 | Bacteria | 3329 |
| 253 | AustNasuHG_c1020345 | 3300000089 | Unclassified | 2163 |
| 254 | JGI24695J34938_10006714 | 3300002450 | Bacteria | 6853 |
| 255 | JGI24696J40584_12958620 | 3300002834 | Bacteria | 4274 |
| 256 | Ga0123353_10014465 | 3300010167 | Bacteria | 11379 |
| 257 | Ga0123354_10064205 | 3300010882 | Archaea | 5387 |
| 258 | Ga0466715_257012 | 3300042616 | Bacteria | 4234 |
| 259 | Ga0466715_442109 | 3300042616 | Bacteria | 8897 |
| 260 | Ga0466715_542720 | 3300042616 | Bacteria | 2044 |
| 261 | Ga0466723_151419 | 3300042618 | Unclassified | 4985 |
| 262 | Ga0466723_291519 | 3300042618 | Bacteria | 4850 |
| 263 | Ga0466726_088534 | 3300042619 | Bacteria | 6975 |
| 264 | Ga0466732_207623 | 3300042656 | Bacteria | 13905 |
| 265 | Ga0562375_3045 | 3300056856 | Bacteria | 16842 |
| 266 | Ga0466706_116168 | 3300042599 | Bacteria | 38789 |
| 267 | Ga0466706_148775 | 3300042599 | Bacteria | 10907 |
| 268 | Ga0466706_195903 | 3300042599 | Bacteria | 15097 |
| 269 | Ga0466713_020133 | 3300042602 | Bacteria | 4573 |
| 270 | Ga0466719_083216 | 3300042606 | Bacteria | 6822 |
| 271 | Ga0466719_435910 | 3300042606 | Bacteria | 19989 |
| 272 | Ga0466722_000121 | 3300042609 | Bacteria | 2032 |
| 273 | Ga0466722_083792 | 3300042609 | Bacteria | 2957 |
| 274 | Ga0264413_104061 | 3300024493 | Bacteria | 24138 |
| 275 | Ga0466691_083553 | 3300042593 | Bacteria | 11632 |
| 276 | Ga0466696_306479 | 3300042596 | Bacteria | 21703 |
| 277 | 2230929947 | 2228664001 | Bacteria | 8707 |
| 278 | AustNasuHG_c1002174 | 3300000089 | Bacteria | 7087 |
| 279 | Ga0068302_10064973 | 3300005071 | Bacteria | 14097 |
| 280 | Ga0123357_10185528 | 3300009784 | Bacteria | 2414 |
| 281 | Ga0123355_10042732 | 3300009826 | Bacteria | 7376 |
| 282 | Ga0123355_10416170 | 3300009826 | Bacteria | 1721 |
| 283 | Ga0123353_10004100 | 3300010167 | Bacteria | 18666 |
| 284 | Ga0123353_10124010 | 3300010167 | Bacteria | 4152 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00285 | Citrate_synt | Citrate synthase, C-terminal domain | 99 | 492 | 0.92 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00285 | GO:0046912 | acyltransferase activity, acyl groups converted into alkyl on transfer | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.