Protein Family IF09708
Metagenome
Isolate
294
Members
264
Samples
69
Scaffolds
231.73
Avg Length
Representative Sequence
- ID
- 3300042649|Ga0466724_09605|Ga0466724_09605_4461_5291
- Length
- 276 aa
- Sequence
- MTHRAEPNRPAPGGPFCYYCRRNAIFILPPECVSGEAKAQKGDFMKRAVVVFSGGQDSTTCLIQALQQYDEVHCVTFDYGQRHRAEIEVAQALSVALGAKAHKVLDVTLLNELAVSSLTRDNIPVPAYDPNQKNALPSTFVPGRNILFLTLAAIYAYQVEAEAVITGVCETDFSGYPDCRDEFVKALNKAVTLGIARDIRFETPLMWLNKAETWALADYYHQLDRVRQDTLTCYNGIKGDGCGECAACNLRANGLTQYRANQAEVMAALKQKAGLA
Sample Types
Isolate
76.5%
Metagenome
23.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
32.3%
Drosophilidae
10.1%
Anthocoridae
8.5%
Muscidae
5.2%
Curculionidae
4.8%
Tenebrionidae
4.0%
Calliphoridae
3.6%
Culicidae
3.6%
Aphididae
2.8%
Elmidae
2.8%
Tephritidae
2.0%
Apidae
1.6%
Cerambycidae
1.6%
Termitidae
1.2%
Armadillidiidae
1.2%
Pteromalidae
1.2%
Palinuridae
1.2%
Talitridae
0.8%
Sarcophagidae
0.8%
Majidae
0.8%
Formicidae
0.8%
Pentatomidae
0.8%
Thripidae
0.4%
Anthomyiidae
0.4%
Artemiidae
0.4%
Scarabaeidae
0.4%
Ceratophyllidae
0.4%
Nephropidae
0.4%
Cicadellidae
0.4%
Siricidae
0.4%
Passalidae
0.4%
Crambidae
0.4%
Aphalaridae
0.4%
Psyllidae
0.4%
Aleyrodidae
0.4%
Daphniidae
0.4%
Reduviidae
0.4%
Rhopalidae
0.4%
Penaeidae
0.4%
Plutellidae
0.4%
Glossinidae
0.4%
Carabidae
0.4%
Taxonomy
Archaea
0
Bacteria
273
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 2 | 2032320009 | Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine | Metagenome | Curculionidae |
| 3 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 4 | 2571042430 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 5 | 2627854002 | Vibrio nigripulchritudo ENn2 | Isolate | Unclassified |
| 6 | 2711768158 | Vibrio coralliilyticus S2043 | Isolate | Unclassified |
| 7 | 2846861257 | Buchnera aphidicola LSU | Isolate | Aphididae |
| 8 | 2850895757 | Vibrio campbellii 170502 | Isolate | Unclassified |
| 9 | 2860776474 | Vibrio parahaemolyticus R14 | Isolate | Unclassified |
| 10 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 11 | 2872471378 | Vibrio owensii V180403 | Isolate | Unclassified |
| 12 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 13 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 14 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 15 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 16 | 2958255616 | Serratia marcescens TM | Isolate | |
| 17 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 18 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 19 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 20 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 21 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 22 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 23 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 24 | 8022439116 | Vibrio sp. ArtGut-C1 | Isolate | Artemiidae |
| 25 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 26 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 27 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 28 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 29 | 2511231129 | Vibrio sp. EJY3 | Isolate | Unclassified |
| 30 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 31 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 32 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 33 | 2565956518 | Vibrio pacinii DSM 19139 | Isolate | Unclassified |
| 34 | 2600255074 | Vibrio proteolyticus NBRC 13287 | Isolate | Unclassified |
| 35 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 36 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 37 | 2693429575 | Vibrio parahaemolyticus ISF-54-12 | Isolate | Unclassified |
| 38 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 39 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 40 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 41 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 42 | 2902451016 | Photobacterium leiognathi mandapamensis ajapo.4.1 | Isolate | Unclassified |
| 43 | 2908136803 | Vibrio owensii 1700302 | Isolate | Unclassified |
| 44 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 45 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 46 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 47 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 48 | 2997380424 | Vibrio parahaemolyticus MVP1 | Isolate | Unclassified |
| 49 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 50 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 51 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 52 | 3300010225 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1 | Metagenome | Aphididae |
| 53 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 54 | 640963010 | Vibrio harveyi HY01 | Isolate | Unclassified |
| 55 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 56 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 57 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 58 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 59 | 8022345672 | Vibrio sp. 070316B | Isolate | Unclassified |
| 60 | 8033364368 | Vibrio panuliri LBS 2 | Isolate | Nephropidae |
| 61 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 62 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 63 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 64 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 65 | 8116627632 | Vibrio penaeicida NBRC 15640 | Isolate | Unclassified |
| 66 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 67 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 68 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 69 | 2551306507 | Vibrio parahaemolyticus PCV08-7 | Isolate | Unclassified |
| 70 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 71 | 2648501856 | Candidatus Baumannia cicadellinicola BGSS | Isolate | Cicadellidae |
| 72 | 2667527887 | Vibrio harveyi LMG 4044 | Isolate | Unclassified |
| 73 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 74 | 2791355471 | Vibrio bivalvicida 605 | Isolate | Unclassified |
| 75 | 2791355473 | Vibrio barjaei 3062 | Isolate | Unclassified |
| 76 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 77 | 2843904799 | Shewanella khirikhana TH2012 | Isolate | Unclassified |
| 78 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 79 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 80 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 81 | 2873884416 | Photobacterium sanguinicancri Mj110 CAIM 1827 | Isolate | Majidae |
| 82 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 83 | 2898975184 | Erwinia dacicola IL | Isolate | Tephritidae |
| 84 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 85 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 86 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 87 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 88 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 89 | 3006225627 | Vibrio sp. Hep-1b-8 | Isolate | Unclassified |
| 90 | 3006242587 | Vibrio sp. RE86 | Isolate | Unclassified |
| 91 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 92 | 3300007078 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 4 gut | Metagenome | Drosophilidae |
| 93 | 3300007106 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut | Metagenome | Drosophilidae |
| 94 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 95 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 96 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 97 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 98 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 99 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 100 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 101 | 8048923410 | Photobacterium sanguinicancri CECT 7579 | Isolate | Unclassified |
| 102 | 8051534459 | Vibrio vulnificus Vv004 | Isolate | |
| 103 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 104 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 105 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 106 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 107 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 108 | 2648501820 | Vibrio nigripulchritudo BLFn1 | Isolate | Unclassified |
| 109 | 2667527830 | Vibrio parahaemolyticus ISF-29-3 | Isolate | Unclassified |
| 110 | 2700989396 | Vibrio parahaemolyticus ISF-77-01 | Isolate | Unclassified |
| 111 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 112 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 113 | 2785510762 | Vibrio parahaemolyticus VP14 | Isolate | Unclassified |
| 114 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 115 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 116 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 117 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 118 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 119 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 120 | 2902438364 | Photobacterium damselae Hep-2a-11 | Isolate | Unclassified |
| 121 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 122 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 123 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 124 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 125 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 126 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 127 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 128 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 129 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 130 | 3300009463 | Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov | Metagenome | |
| 131 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 132 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 133 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 134 | 8008122225 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 135 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 136 | 8042061949 | Vibrio harveyi Hep-2a-10 | Isolate | Unclassified |
| 137 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 138 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 139 | 2509601000 | Secondary endosymbiont of Ctenarytaina eucalypti Thao2000 | Isolate | Aphalaridae |
| 140 | 2512047046 | Secondary Endosymbiont of Heteropsylla cubana | Isolate | Psyllidae |
| 141 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 142 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 143 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 144 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 145 | 2609459958 | Vibrio nigripulchritudo Wn13 | Isolate | Unclassified |
| 146 | 2630968716 | Vibrio nigripulchritudo AM115 | Isolate | Unclassified |
| 147 | 2636415542 | Vibrio nigripulchritudo SFn135 | Isolate | Unclassified |
| 148 | 2654587515 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 149 | 2654587723 | Buchnera aphidicola (Aphis glycines) BAg | Isolate | Aphididae |
| 150 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 151 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 152 | 2844251356 | Photobacterium leiognathi mandapamensis ajapo.3.1 | Isolate | Unclassified |
| 153 | 2858407585 | Photobacterium swingsii DSM 24669 | Isolate | Unclassified |
| 154 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 155 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 156 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 157 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 158 | 2880115952 | Vibrio parahaemolyticus PB1937 | Isolate | Unclassified |
| 159 | 2900349738 | Photobacterium lucens CAIM 1938 | Isolate | Unclassified |
| 160 | 2912636047 | Vibrio crassostreae 9CS106 | Isolate | Unclassified |
| 161 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 162 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 163 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 164 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 165 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 166 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 167 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 168 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 169 | 8048928574 | Photobacterium swingsii CECT 7576 | Isolate | Unclassified |
| 170 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 171 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 172 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 173 | 2531839005 | Vibrio harveyi CAIM 1792 | Isolate | Unclassified |
| 174 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 175 | 2551306520 | Aliivibrio logei ATCC 35077 | Isolate | Majidae |
| 176 | 2554235022 | Vibrio parahaemolyticus v110 | Isolate | |
| 177 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 178 | 2648501158 | Vibrio hepatarius DSM 19134 | Isolate | Unclassified |
| 179 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 180 | 2663763317 | Vibrio parahaemolyticus ISF-94-1 | Isolate | Unclassified |
| 181 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 182 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 183 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 184 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 185 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 186 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 187 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 188 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 189 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 190 | 2912570088 | Vibrio parahaemolyticus CHN25 | Isolate | |
| 191 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 192 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 193 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 194 | 3300007103 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut | Metagenome | Drosophilidae |
| 195 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 196 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 197 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 198 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 199 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 200 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 201 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 202 | 8051551332 | Vibrio vulnificus Vv003 | Isolate | |
| 203 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 204 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 205 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 206 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 207 | 2609459925 | Vibrio nigripulchritudo SO65 | Isolate | Unclassified |
| 208 | 2627853677 | Vibrio nigripulchritudo FTn2 | Isolate | Unclassified |
| 209 | 2684622551 | Vibrio campbellii E1 | Isolate | Unclassified |
| 210 | 2731957638 | Vibrio harveyi NBRC 15634 | Isolate | Talitridae |
| 211 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 212 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 213 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 214 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 215 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 216 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 217 | 2875320051 | Vibrio parahaemolyticus 160807 | Isolate | Unclassified |
| 218 | 2877638525 | Vibrio campbellii 1114GL | Isolate | Penaeidae |
| 219 | 2877647439 | Vibrio parahaemolyticus R13 | Isolate | Unclassified |
| 220 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 221 | 2896925746 | Vibrio nigripulchritudo SFn27 | Isolate | Unclassified |
| 222 | 2901296437 | Erwinia dacicola Oroville | Isolate | Tephritidae |
| 223 | 2902469402 | Photobacterium lucens CAIM 1937 | Isolate | Unclassified |
| 224 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 225 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 226 | 2989793055 | Vibrio atypicus DSM 25292 | Isolate | Unclassified |
| 227 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 228 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 229 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 230 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 231 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 232 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 233 | 8022096067 | Vibrio sp. SALL6 | Isolate | Unclassified |
| 234 | 8022116796 | Vibrio sp. T3Y01 | Isolate | Unclassified |
| 235 | 8051461712 | Vibrio vulnificus Vv002 | Isolate | |
| 236 | 8060845732 | Vibrio vulnificus Vv006 | Isolate | |
| 237 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 238 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 239 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 240 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 241 | 2571042554 | Vibrio owensii CAIM 1854 | Isolate | Palinuridae |
| 242 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 243 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 244 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 245 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 246 | 2868883784 | Photobacterium leiognathi mandapamensis AJ-1a | Isolate | Unclassified |
| 247 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 248 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 249 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 250 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 251 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 252 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 253 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 254 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 255 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 256 | 8033368880 | Vibrio panuliri CAIM 1902 | Isolate | Palinuridae |
| 257 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 258 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 259 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 260 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 261 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 262 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 263 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 264 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562377_0001 | 3300056842 | Bacteria | 5082480 |
| 2 | Ga0160431_104204 | 3300012828 | Bacteria | 2702 |
| 3 | Ga0160443_104847 | 3300012848 | Bacteria | 1936 |
| 4 | Ga0160448_100009 | 3300012854 | Bacteria | 329039 |
| 5 | Ga0466713_018771 | 3300042602 | Bacteria | 3087 |
| 6 | FGTW_contig32789 | 2065487013 | Unclassified | 2126 |
| 7 | HBC_ctgsDRAFT_1002104 | 3300000333 | Bacteria | 4484 |
| 8 | Ga0466730_049283 | 3300042625 | Unclassified | 6233 |
| 9 | Ga0562377_0183 | 3300056842 | Bacteria | 165152 |
| 10 | Ga0562375_0007 | 3300056856 | Bacteria | 1880046 |
| 11 | Ga0562375_0296 | 3300056856 | Bacteria | 124767 |
| 12 | Ga0160433_100960 | 3300012846 | Bacteria | 9509 |
| 13 | FGTW_contig21701 | 2065487013 | Bacteria | 3122 |
| 14 | WW0001_100248 | 3300002732 | Bacteria | 167261 |
| 15 | Ga0104051_1017114 | 3300007078 | Unclassified | 1779 |
| 16 | Ga0104147_1064325 | 3300007224 | Bacteria | 6709 |
| 17 | Ga0466730_032807 | 3300042625 | Bacteria | 2885 |
| 18 | Ga0466724_03076 | 3300042649 | Bacteria | 9040 |
| 19 | Ga0562379_0007 | 3300056790 | Bacteria | 2440168 |
| 20 | Ga0466707_267652 | 3300042601 | Unclassified | 1292 |
| 21 | Ga0466713_014081 | 3300042602 | Bacteria | 234884 |
| 22 | Ga0466713_153410 | 3300042602 | Unclassified | 43603 |
| 23 | SPBB_contig11563 | 2044078006 | Bacteria | 39179 |
| 24 | Meta3P_1000098 | 3300002464 | Bacteria | 25031 |
| 25 | Ga0063521_1000712 | 3300003973 | Bacteria | 12601 |
| 26 | Ga0104041_1004758 | 3300007106 | Bacteria | 1932 |
| 27 | Ga0104019_1190130 | 3300007150 | Bacteria | 2779 |
| 28 | Ga0105005_1040250 | 3300007505 | Unclassified | 7230 |
| 29 | Ga0105553_1035600 | 3300007767 | Bacteria | 23452 |
| 30 | Ga0466730_004892 | 3300042625 | Unclassified | 17234 |
| 31 | Ga0466730_030202 | 3300042625 | Bacteria | 16321 |
| 32 | Ga0466724_53221 | 3300042649 | Unclassified | 21501 |
| 33 | 2227080769 | 2225789004 | Bacteria | 257506 |
| 34 | HBC_ctgsDRAFT_1007860 | 3300000333 | Bacteria | 2519 |
| 35 | Ga0063521_1000087 | 3300003973 | Bacteria | 77131 |
| 36 | Ga0127645_100025 | 3300009461 | Bacteria | 631301 |
| 37 | Ga0466730_087551 | 3300042625 | Bacteria | 89610 |
| 38 | Ga0530661_006833 | 3300056564 | Unclassified | 3258 |
| 39 | Ga0160430_100763 | 3300012852 | Unclassified | 15375 |
| 40 | Ga0316159_10926 | 3300030930 | Unclassified | 5888 |
| 41 | Ga0247289_0525 | 3300035363 | Unclassified | 5515 |
| 42 | DPO_contig07446 | 2032320009 | Bacteria | 27582 |
| 43 | CVPL010L_1006705 | 3300002932 | Unclassified | 1122 |
| 44 | Ga0104041_1001387 | 3300007106 | Bacteria | 3386 |
| 45 | Ga0160468_100565 | 3300012819 | Unclassified | 14154 |
| 46 | Ga0160436_1003957 | 3300012861 | Bacteria | 3580 |
| 47 | Ga0466701_036414 | 3300042598 | Bacteria | 85852 |
| 48 | DPOL_contig19778 | 2035918003 | Bacteria | 117523 |
| 49 | DPOL_contig20426 | 2035918003 | Unclassified | 48750 |
| 50 | Meta3P_1000619 | 3300002464 | Bacteria | 20742 |
| 51 | CVPL010L_1000261 | 3300002932 | Unclassified | 34084 |
| 52 | Ga0063521_1000013 | 3300003973 | Bacteria | 168262 |
| 53 | Ga0074188_1000654 | 3300005318 | Bacteria | 4487 |
| 54 | Ga0104049_1000726 | 3300007103 | Unclassified | 3375 |
| 55 | Ga0104049_1136159 | 3300007103 | Unclassified | 1114 |
| 56 | Ga0466730_058012 | 3300042625 | Unclassified | 3438 |
| 57 | Ga0466724_29726 | 3300042649 | Bacteria | 169575 |
| 58 | Ga0562379_0001 | 3300056790 | Bacteria | 4904077 |
| 59 | Ga0063521_1000156 | 3300003973 | Bacteria | 51654 |
| 60 | Ga0104040_1000881 | 3300007149 | Bacteria | 3982 |
| 61 | Ga0136160_1000044 | 3300010225 | Bacteria | 104555 |
| 62 | Ga0265387_1000066 | 3300024582 | Bacteria | 33108 |
| 63 | Ga0466707_284362 | 3300042601 | Bacteria | 185230 |
| 64 | SWWA_contig05314__length_3161___numreads_59 | 2100351016 | Unclassified | 3161 |
| 65 | Ga0063521_1000716 | 3300003973 | Unclassified | 12485 |
| 66 | Ga0104042_1001587 | 3300007130 | Bacteria | 6504 |
| 67 | Ga0127644_100036 | 3300009463 | Bacteria | 636219 |
| 68 | Ga0466730_058073 | 3300042625 | Bacteria | 2252 |
| 69 | Ga0466724_09605 | 3300042649 | Bacteria | 15306 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF06508 | QueC | Queuosine biosynthesis protein QueC | 47 | 258 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.