Protein Family IF09673
Metagenome
Isolate
149
Members
62
Samples
135
Scaffolds
535.3
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_372748|Ga0466709_372748_18219_19940
- Length
- 573 aa
- Sequence
- LKNSTGNGKQTAGKLRLSGFISEWIPIRKGTVVLMQLTLKEVQEHPSAFAQAGYQLPAFDYETVRRQTLAAPAWIHFGAGNIFRAFQANAVQKLLNSGAYGTGLIAAEGYDYEIIEKMYLPHDNLSILVTLKPDRSMEKTIVGSVLEALILDREQEAHFRRLNEIFSSPSLQMSSFTITEKGYALTDSEGKLLPGIELDFANGPEKASGYLGKVVSLLYGRYRSGRLPIAMVSMDNCSRNGDKLAAAVTAFASAWCGAGLAESGFLAYVKDPGRVSFPWSMIDKITPRPDAAVEEMLAQSGIEGLEPVVTSKNTYIAPFVNAEECEYLVIEDQFPNGRPPLEQAGILFADRETVDKVEKMKVCTCLNPLHTALAVYGCLLGYTLISEEMKNPLLKKMAETIGYLEGLPVVVHPGIIDPQKFIDEVVSSRIPNPFLPDTPQRIATDTSQKLSIRFGETIKAYGKRGGNAAAESLTGIPLVFAGWLRYLMGTDDGGQTFPLSSDPLLDTVVPYVAGFELTEAPKDLSGLDPLLRNEKIFGVDLFQAGLAERVKEYFRELSAGKGAVARTLGKYFG
Sample Types
Isolate
9.4%
Metagenome
90.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.7%
Unclassified
26.7%
Kalotermitidae
20.0%
Rhinotermitidae
5.0%
Passalidae
3.3%
Hodotermitidae
1.7%
Hydrophilidae
1.7%
Taxonomy
Archaea
0
Bacteria
146
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 9 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 14 | 2820431532 | Unclassified Firmicutes Lab288P3bin230 | Isolate | Unclassified |
| 15 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 16 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 22 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 2820512088 | Unclassified Firmicutes Lab288P1bin4 | Isolate | Unclassified |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 27 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 30 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 31 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 32 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 33 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 34 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 35 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 36 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 37 | 2873595552 | Erysipelothrix sp. HDW6C | Isolate | Hydrophilidae |
| 38 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 39 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 44 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 45 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 48 | 2820303403 | Unclassified Firmicutes Th196P1bin2 | Isolate | Unclassified |
| 49 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 50 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 51 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 52 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 53 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 54 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 55 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 56 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 57 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 58 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 59 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 60 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 61 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 62 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0456237_0002667 | 3300041968 | Unclassified | 2879 |
| 2 | Ga0466709_200717 | 3300042648 | Bacteria | 7959 |
| 3 | Ga0466709_211856 | 3300042648 | Bacteria | 5829 |
| 4 | Ga0466709_372748 | 3300042648 | Bacteria | 71914 |
| 5 | Ga0466712_182815 | 3300042614 | Bacteria | 1965 |
| 6 | Ga0466715_119856 | 3300042616 | Bacteria | 27149 |
| 7 | Ga0466718_060053 | 3300042617 | Bacteria | 16600 |
| 8 | Ga0466714_067816 | 3300042603 | Bacteria | 3574 |
| 9 | Ga0123356_10059828 | 3300010049 | Bacteria | 3554 |
| 10 | IMNBL1DRAFT_c0000628 | 3300000062 | Bacteria | 28179 |
| 11 | JGI24698J34947_10024201 | 3300002449 | Bacteria | 3243 |
| 12 | JGI24695J34938_10008871 | 3300002450 | Bacteria | 5681 |
| 13 | JGI24695J34938_10027506 | 3300002450 | Bacteria | 2687 |
| 14 | Ga0072941_1001761 | 3300005201 | Bacteria | 7572 |
| 15 | Ga0466733_150790 | 3300042659 | Bacteria | 9283 |
| 16 | Ga0264413_112665 | 3300024493 | Bacteria | 3630 |
| 17 | Ga0456237_0000350 | 3300041968 | Bacteria | 6854 |
| 18 | Ga0466690_070083 | 3300042590 | Bacteria | 1871 |
| 19 | Ga0466699_283554 | 3300042597 | Bacteria | 2526 |
| 20 | Ga0466731_052474 | 3300042622 | Bacteria | 1606 |
| 21 | Ga0466712_237745 | 3300042614 | Bacteria | 17404 |
| 22 | Ga0466718_022159 | 3300042617 | Bacteria | 13693 |
| 23 | Ga0466718_024057 | 3300042617 | Bacteria | 2832 |
| 24 | Ga0466723_072843 | 3300042618 | Bacteria | 31540 |
| 25 | Ga0466713_153396 | 3300042602 | Bacteria | 11222 |
| 26 | Ga0466722_132800 | 3300042609 | Bacteria | 3833 |
| 27 | Ga0466698_215730 | 3300042610 | Bacteria | 24389 |
| 28 | Ga0123356_10001400 | 3300010049 | Bacteria | 26708 |
| 29 | Ga0123356_10077119 | 3300010049 | Bacteria | 3142 |
| 30 | IMNBL1DRAFT_c0002648 | 3300000062 | Bacteria | 12258 |
| 31 | IMNBL1DRAFT_c0004339 | 3300000062 | Bacteria | 8570 |
| 32 | JGI24695J34938_10007548 | 3300002450 | Bacteria | 6346 |
| 33 | JGI24695J34938_10039984 | 3300002450 | Bacteria | 2115 |
| 34 | Ga0466733_073512 | 3300042659 | Bacteria | 4492 |
| 35 | Ga0415639_055595 | 3300038395 | Bacteria | 4115 |
| 36 | Ga0466690_348676 | 3300042590 | Bacteria | 2783 |
| 37 | Ga0466702_037390 | 3300042635 | Bacteria | 11627 |
| 38 | Ga0466704_264505 | 3300042643 | Bacteria | 12373 |
| 39 | Ga0466724_10183 | 3300042649 | Bacteria | 3265 |
| 40 | Ga0466712_027275 | 3300042614 | Bacteria | 35623 |
| 41 | Ga0466718_025894 | 3300042617 | Bacteria | 2259 |
| 42 | Ga0466723_071252 | 3300042618 | Bacteria | 58514 |
| 43 | Ga0466713_071195 | 3300042602 | Bacteria | 4244 |
| 44 | Ga0123356_10000612 | 3300010049 | Bacteria | 39404 |
| 45 | AustNasuHG_c1005107 | 3300000089 | Bacteria | 4692 |
| 46 | JGI24698J34947_10011928 | 3300002449 | Bacteria | 4772 |
| 47 | Ga0466690_201727 | 3300042590 | Bacteria | 7166 |
| 48 | Ga0466696_018814 | 3300042596 | Bacteria | 10656 |
| 49 | Ga0466712_062986 | 3300042614 | Bacteria | 38341 |
| 50 | Ga0466711_038740 | 3300042615 | Bacteria | 7401 |
| 51 | Ga0466718_015773 | 3300042617 | Bacteria | 16307 |
| 52 | Ga0466713_065312 | 3300042602 | Bacteria | 73523 |
| 53 | Ga0466717_075596 | 3300042604 | Bacteria | 1899 |
| 54 | Ga0466720_078286 | 3300042607 | Bacteria | 6031 |
| 55 | Ga0123355_10202122 | 3300009826 | Bacteria | 2899 |
| 56 | Ga0123356_10000010 | 3300010049 | Bacteria | 220063 |
| 57 | Ga0123356_10007744 | 3300010049 | Bacteria | 10696 |
| 58 | AustNasuHG_c1002532 | 3300000089 | Bacteria | 6607 |
| 59 | JGI24698J34947_10007911 | 3300002449 | Bacteria | 5839 |
| 60 | JGI24695J34938_10000004 | 3300002450 | Bacteria | 163071 |
| 61 | Ga0466732_098331 | 3300042656 | Bacteria | 3259 |
| 62 | Ga0466695_091046 | 3300042595 | Bacteria | 29831 |
| 63 | Ga0466699_268323 | 3300042597 | Bacteria | 30824 |
| 64 | Ga0466712_013036 | 3300042614 | Bacteria | 41630 |
| 65 | Ga0466712_069673 | 3300042614 | Bacteria | 20471 |
| 66 | Ga0466723_352688 | 3300042618 | Bacteria | 8345 |
| 67 | Ga0466728_417430 | 3300042620 | Bacteria | 9499 |
| 68 | Ga0466729_094922 | 3300042621 | Bacteria | 21461 |
| 69 | Ga0466706_206567 | 3300042599 | Bacteria | 30363 |
| 70 | Ga0466722_061628 | 3300042609 | Bacteria | 14264 |
| 71 | 2227466306 | 2225789004 | Bacteria | 24511 |
| 72 | AustNasuHG_c1000882 | 3300000089 | Bacteria | 10805 |
| 73 | AustNasuHG_c1005673 | 3300000089 | Bacteria | 4466 |
| 74 | JGI24698J34947_10001466 | 3300002449 | Bacteria | 12429 |
| 75 | JGI24695J34938_10001536 | 3300002450 | Bacteria | 19468 |
| 76 | Ga0072941_1015656 | 3300005201 | Bacteria | 6284 |
| 77 | Ga0466705_163521 | 3300042612 | Bacteria | 8623 |
| 78 | Ga0466691_097944 | 3300042593 | Bacteria | 5063 |
| 79 | Ga0466694_009216 | 3300042594 | Bacteria | 16208 |
| 80 | Ga0466696_413559 | 3300042596 | Bacteria | 27260 |
| 81 | Ga0466712_199919 | 3300042614 | Bacteria | 8418 |
| 82 | Ga0466723_095828 | 3300042618 | Bacteria | 7612 |
| 83 | Ga0466728_199764 | 3300042620 | Bacteria | 3639 |
| 84 | Ga0123355_10184468 | 3300009826 | Bacteria | 3089 |
| 85 | Ga0123356_10000651 | 3300010049 | Bacteria | 38307 |
| 86 | Ga0123356_10028607 | 3300010049 | Bacteria | 5221 |
| 87 | Ga0123353_10089800 | 3300010167 | Bacteria | 4948 |
| 88 | Ga0123354_10130153 | 3300010882 | Bacteria | 3184 |
| 89 | JGI24698J34947_10000492 | 3300002449 | Bacteria | 18562 |
| 90 | Ga0466693_135525 | 3300042592 | Bacteria | 26238 |
| 91 | Ga0466711_219369 | 3300042615 | Bacteria | 6144 |
| 92 | Ga0466711_351895 | 3300042615 | Bacteria | 12352 |
| 93 | Ga0466719_187902 | 3300042606 | Bacteria | 3793 |
| 94 | Ga0466720_006450 | 3300042607 | Bacteria | 22815 |
| 95 | Ga0123355_10004850 | 3300009826 | Bacteria | 19580 |
| 96 | Ga0123356_10016633 | 3300010049 | Bacteria | 7016 |
| 97 | Ga0123356_10026789 | 3300010049 | Bacteria | 5408 |
| 98 | Ga0123356_10037289 | 3300010049 | Bacteria | 4536 |
| 99 | Ga0123356_10048604 | 3300010049 | Bacteria | 3948 |
| 100 | Ga0123356_10089582 | 3300010049 | Bacteria | 2927 |
| 101 | Ga0123353_10048746 | 3300010167 | Bacteria | 6746 |
| 102 | JGI24698J34947_10001105 | 3300002449 | Bacteria | 13901 |
| 103 | JGI24698J34947_10001127 | 3300002449 | Bacteria | 13825 |
| 104 | JGI24695J34938_10000008 | 3300002450 | Bacteria | 136681 |
| 105 | JGI24695J34938_10001031 | 3300002450 | Bacteria | 25228 |
| 106 | JGI24695J34938_10004551 | 3300002450 | Bacteria | 9040 |
| 107 | JGI24695J34938_10007083 | 3300002450 | Bacteria | 6629 |
| 108 | JGI24695J34938_10018505 | 3300002450 | Bacteria | 3477 |
| 109 | JGI24695J34938_10026447 | 3300002450 | Bacteria | 2757 |
| 110 | Ga0072940_1020119 | 3300005200 | Bacteria | 5802 |
| 111 | Ga0466732_080996 | 3300042656 | Bacteria | 15116 |
| 112 | Ga0264413_119960 | 3300024493 | Bacteria | 11644 |
| 113 | Ga0264413_124401 | 3300024493 | Bacteria | 15449 |
| 114 | Ga0415639_018949 | 3300038395 | Bacteria | 37088 |
| 115 | Ga0466690_321011 | 3300042590 | Bacteria | 2986 |
| 116 | Ga0466699_128513 | 3300042597 | Bacteria | 3590 |
| 117 | Ga0466708_027263 | 3300042652 | Bacteria | 15744 |
| 118 | Ga0466712_139946 | 3300042614 | Bacteria | 3727 |
| 119 | Ga0466712_269434 | 3300042614 | Bacteria | 17480 |
| 120 | Ga0466718_110803 | 3300042617 | Bacteria | 5442 |
| 121 | Ga0466707_187727 | 3300042601 | Bacteria | 1672 |
| 122 | Ga0466720_113854 | 3300042607 | Bacteria | 8150 |
| 123 | Ga0466722_153642 | 3300042609 | Bacteria | 9464 |
| 124 | Ga0123355_10219229 | 3300009826 | Bacteria | 2740 |
| 125 | Ga0123356_10004159 | 3300010049 | Bacteria | 15019 |
| 126 | Ga0123356_10104508 | 3300010049 | Bacteria | 2723 |
| 127 | 2227510469 | 2225789004 | Bacteria | 3573 |
| 128 | IMNBL1DRAFT_c0002759 | 3300000062 | Bacteria | 11940 |
| 129 | AustNasuHG_c1002769 | 3300000089 | Bacteria | 6325 |
| 130 | JGI24698J34947_10002959 | 3300002449 | Bacteria | 9212 |
| 131 | JGI24698J34947_10004418 | 3300002449 | Bacteria | 7653 |
| 132 | JGI24695J34938_10000239 | 3300002450 | Bacteria | 52549 |
| 133 | JGI24700J35501_10929850 | 3300002508 | Bacteria | 10387 |
| 134 | Ga0068305_10043708 | 3300005083 | Unclassified | 12185 |
| 135 | Ga0072941_1003982 | 3300005201 | Unclassified | 31079 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08125 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.