Protein Family IF09566
Metagenome
Isolate
136
Members
59
Samples
128
Scaffolds
127.24
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_040085|Ga0466709_040085_9747_10193
- Length
- 148 aa
- Sequence
- LSRYFNEKNCTFANYLLNFKANKMAKRIIHTDNAPKAIGPYSQAIEANGMLFISGQIPVNPATGTIPEGIEAQTQQVMKNIEAILKEAGYSFKDVIKSTCLLSDIANFKAMNEVYAQYYKEDCPARAAFAVKDLPMGVLVEIETIAAK
Sample Types
Isolate
5.9%
Metagenome
94.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.4%
Kalotermitidae
21.1%
Unclassified
12.3%
Termopsidae
5.3%
Rhinotermitidae
3.5%
Passalidae
3.5%
Blattidae
1.8%
Scarabaeidae
1.8%
Hodotermitidae
1.8%
Dytiscidae
1.8%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2920168565 | Paludibacter sp. 221 | Isolate | Blattidae |
| 12 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 23 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 24 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 25 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 28 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 29 | 2820770630 | Unclassified Bacteroidetes Lab288P3bin130 | Isolate | Unclassified |
| 30 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 31 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 35 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 38 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 39 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 40 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 41 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 42 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 45 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 46 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 47 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 48 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 49 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 50 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 51 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 52 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 59 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_337241 | 3300042656 | Unclassified | 5457 |
| 2 | Ga0264413_114630 | 3300024493 | Bacteria | 1127 |
| 3 | Ga0415639_133925 | 3300038395 | Bacteria | 1751 |
| 4 | Ga0466657_325354 | 3300042582 | Unclassified | 1858 |
| 5 | Ga0072941_1042826 | 3300005201 | Bacteria | 9110 |
| 6 | Ga0123356_10092230 | 3300010049 | Bacteria | 2888 |
| 7 | Ga0123356_10968013 | 3300010049 | Bacteria | 1021 |
| 8 | Ga0123353_10000282 | 3300010167 | Bacteria | 62813 |
| 9 | Ga0123353_11180029 | 3300010167 | Bacteria | 1007 |
| 10 | Ga0123353_12057894 | 3300010167 | Bacteria | 697 |
| 11 | Ga0123353_12777297 | 3300010167 | Bacteria | 574 |
| 12 | Ga0123354_10152270 | 3300010882 | Bacteria | 2795 |
| 13 | Ga0123354_10231724 | 3300010882 | Bacteria | 1928 |
| 14 | Ga0466706_081305 | 3300042599 | Bacteria | 76596 |
| 15 | Ga0466707_316178 | 3300042601 | Bacteria | 19055 |
| 16 | Ga0466713_003823 | 3300042602 | Bacteria | 59189 |
| 17 | Ga0466714_119079 | 3300042603 | Bacteria | 1011 |
| 18 | Ga0466705_117212 | 3300042612 | Bacteria | 3565 |
| 19 | Ga0466703_031978 | 3300042636 | Bacteria | 6988 |
| 20 | Ga0466710_298345 | 3300042613 | Bacteria | 3201 |
| 21 | Ga0466656_027094 | 3300042550 | Unclassified | 34565 |
| 22 | Ga0123356_10110098 | 3300010049 | Bacteria | 2659 |
| 23 | Ga0123356_11492922 | 3300010049 | Bacteria | 834 |
| 24 | Ga0123353_10322631 | 3300010167 | Bacteria | 2343 |
| 25 | Ga0123353_10432652 | 3300010167 | Bacteria | 1945 |
| 26 | Ga0466714_050661 | 3300042603 | Bacteria | 1728 |
| 27 | Ga0466709_221860 | 3300042648 | Bacteria | 264751 |
| 28 | Ga0466710_165020 | 3300042613 | Unclassified | 2929 |
| 29 | Ga0466728_295468 | 3300042620 | Bacteria | 1148 |
| 30 | Ga0466729_175669 | 3300042621 | Bacteria | 6111 |
| 31 | Ga0466733_174799 | 3300042659 | Bacteria | 3017 |
| 32 | Ga0466693_075411 | 3300042592 | Bacteria | 1161 |
| 33 | JGI24695J34938_10059709 | 3300002450 | Unclassified | 1630 |
| 34 | JGI24705J35276_11603687 | 3300002504 | Bacteria | 593 |
| 35 | JGI24705J35276_12190305 | 3300002504 | Bacteria | 1461 |
| 36 | Ga0123355_10000041 | 3300009826 | Bacteria | 126587 |
| 37 | Ga0123356_11000932 | 3300010049 | Bacteria | 1006 |
| 38 | Ga0123353_10413080 | 3300010167 | Unclassified | 2003 |
| 39 | Ga0123353_13080292 | 3300010167 | Bacteria | 538 |
| 40 | Ga0466707_324337 | 3300042601 | Bacteria | 1007 |
| 41 | Ga0466713_043221 | 3300042602 | Bacteria | 51284 |
| 42 | Ga0466714_054551 | 3300042603 | Bacteria | 1082 |
| 43 | Ga0466698_266585 | 3300042610 | Bacteria | 1427 |
| 44 | Ga0466726_139474 | 3300042619 | Bacteria | 4387 |
| 45 | Ga0466696_345739 | 3300042596 | Bacteria | 9366 |
| 46 | IMNBL1DRAFT_c0028268 | 3300000062 | Bacteria | 2095 |
| 47 | Ga0123355_10000859 | 3300009826 | Bacteria | 41957 |
| 48 | Ga0123356_11321746 | 3300010049 | Bacteria | 884 |
| 49 | Ga0123353_10697780 | 3300010167 | Bacteria | 1425 |
| 50 | Ga0123354_10183522 | 3300010882 | Unclassified | 2377 |
| 51 | Ga0123354_10680535 | 3300010882 | Unclassified | 725 |
| 52 | Ga0123354_10757246 | 3300010882 | Unclassified | 664 |
| 53 | Ga0123354_11036686 | 3300010882 | Bacteria | 525 |
| 54 | Ga0466706_144722 | 3300042599 | Bacteria | 12198 |
| 55 | Ga0466700_026773 | 3300042600 | Bacteria | 20029 |
| 56 | Ga0466713_140603 | 3300042602 | Bacteria | 12551 |
| 57 | Ga0466710_328844 | 3300042613 | Bacteria | 3644 |
| 58 | Ga0466715_052344 | 3300042616 | Bacteria | 3499 |
| 59 | Ga0466715_505860 | 3300042616 | Unclassified | 4315 |
| 60 | Ga0466733_147869 | 3300042659 | Bacteria | 7860 |
| 61 | Ga0466693_442600 | 3300042592 | Bacteria | 2991 |
| 62 | Ga0466691_135252 | 3300042593 | Bacteria | 37025 |
| 63 | Ga0123355_11269459 | 3300009826 | Unclassified | 743 |
| 64 | Ga0123356_10459775 | 3300010049 | Bacteria | 1422 |
| 65 | Ga0123356_10521910 | 3300010049 | Bacteria | 1346 |
| 66 | Ga0123353_10180902 | 3300010167 | Bacteria | 3338 |
| 67 | Ga0123353_10356380 | 3300010167 | Bacteria | 2201 |
| 68 | Ga0123353_11153355 | 3300010167 | Bacteria | 1023 |
| 69 | Ga0123353_11826907 | 3300010167 | Bacteria | 754 |
| 70 | Ga0123353_12329525 | 3300010167 | Bacteria | 643 |
| 71 | Ga0123354_10397361 | 3300010882 | Unclassified | 1171 |
| 72 | Ga0466717_044754 | 3300042604 | Bacteria | 4821 |
| 73 | Ga0466719_427451 | 3300042606 | Bacteria | 18774 |
| 74 | Ga0466720_047876 | 3300042607 | Bacteria | 1640 |
| 75 | Ga0466722_246648 | 3300042609 | Bacteria | 6001 |
| 76 | Ga0466697_018318 | 3300042611 | Bacteria | 3074 |
| 77 | Ga0466731_311255 | 3300042622 | Bacteria | 2224 |
| 78 | Ga0466734_123996 | 3300042623 | Bacteria | 4174 |
| 79 | Ga0466704_249651 | 3300042643 | Unclassified | 23741 |
| 80 | Ga0466709_040085 | 3300042648 | Bacteria | 30054 |
| 81 | Ga0466709_094187 | 3300042648 | Bacteria | 75625 |
| 82 | Ga0466724_41994 | 3300042649 | Bacteria | 7813 |
| 83 | Ga0466727_185849 | 3300042655 | Bacteria | 27378 |
| 84 | 2227507946 | 2225789004 | Bacteria | 72002 |
| 85 | JGI24702J35022_10003912 | 3300002462 | Bacteria | 8942 |
| 86 | JGI24702J35022_10023413 | 3300002462 | Bacteria | 3340 |
| 87 | Ga0072941_1463900 | 3300005201 | Bacteria | 667 |
| 88 | Ga0123356_12064388 | 3300010049 | Bacteria | 711 |
| 89 | Ga0123354_11005321 | 3300010882 | Bacteria | 536 |
| 90 | Ga0466716_127749 | 3300042605 | Bacteria | 5626 |
| 91 | Ga0466709_420440 | 3300042648 | Bacteria | 59570 |
| 92 | Ga0466710_392138 | 3300042613 | Bacteria | 1751 |
| 93 | Ga0466728_352573 | 3300042620 | Bacteria | 2386 |
| 94 | Ga0466733_080326 | 3300042659 | Bacteria | 3714 |
| 95 | Ga0466733_116190 | 3300042659 | Bacteria | 4278 |
| 96 | Ga0415639_139549 | 3300038395 | Bacteria | 4021 |
| 97 | Ga0466694_031805 | 3300042594 | Unclassified | 1033 |
| 98 | Ga0466699_424605 | 3300042597 | Bacteria | 1637 |
| 99 | IMNBL1DRAFT_c0005603 | 3300000062 | Bacteria | 7125 |
| 100 | Ga0072940_1210327 | 3300005200 | Bacteria | 2067 |
| 101 | Ga0123356_12234754 | 3300010049 | Bacteria | 684 |
| 102 | Ga0123353_10157505 | 3300010167 | Bacteria | 3618 |
| 103 | Ga0123353_11411796 | 3300010167 | Bacteria | 894 |
| 104 | Ga0466707_362351 | 3300042601 | Bacteria | 47572 |
| 105 | Ga0466713_080378 | 3300042602 | Bacteria | 107053 |
| 106 | Ga0466698_121227 | 3300042610 | Bacteria | 1718 |
| 107 | Ga0466735_048702 | 3300042624 | Bacteria | 2142 |
| 108 | Ga0466735_049667 | 3300042624 | Bacteria | 3068 |
| 109 | Ga0466715_133644 | 3300042616 | Unclassified | 2508 |
| 110 | Ga0466657_090323 | 3300042582 | Unclassified | 10490 |
| 111 | Ga0466690_209074 | 3300042590 | Unclassified | 3718 |
| 112 | Ga0466691_214142 | 3300042593 | Bacteria | 16450 |
| 113 | Ga0466696_002012 | 3300042596 | Bacteria | 1496 |
| 114 | Ga0466701_001632 | 3300042598 | Bacteria | 1142 |
| 115 | JGI24702J35022_10811171 | 3300002462 | Bacteria | 583 |
| 116 | Ga0123356_11974329 | 3300010049 | Bacteria | 727 |
| 117 | Ga0123356_12081778 | 3300010049 | Bacteria | 708 |
| 118 | Ga0123356_12704492 | 3300010049 | Bacteria | 621 |
| 119 | Ga0123353_10101593 | 3300010167 | Bacteria | 4636 |
| 120 | Ga0123353_10715550 | 3300010167 | Bacteria | 1402 |
| 121 | Ga0123353_11943857 | 3300010167 | Bacteria | 723 |
| 122 | Ga0123354_11073030 | 3300010882 | Bacteria | 513 |
| 123 | Ga0466700_266636 | 3300042600 | Bacteria | 2330 |
| 124 | Ga0466717_052149 | 3300042604 | Bacteria | 1567 |
| 125 | Ga0466698_072872 | 3300042610 | Bacteria | 1363 |
| 126 | Ga0466705_156124 | 3300042612 | Bacteria | 9397 |
| 127 | Ga0466710_190460 | 3300042613 | Bacteria | 1390 |
| 128 | Ga0466723_172300 | 3300042618 | Bacteria | 6520 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042613 | Ga0466710_328844 | Ga0466710_328844_2163_2534 | 123 |
| 2 | 3300010167 | Ga0123353_10715550 | Ga0123353_107155502 | 124 |
| 3 | 3300010167 | Ga0123353_13080292 | Ga0123353_130802922 | 124 |
| 4 | 3300024493 | Ga0264413_114630 | Ga0264413_1146302 | 124 |
| 5 | 3300038395 | Ga0415639_139549 | Ga0415639_139549_3231_3605 | 124 |
| 6 | 3300042603 | Ga0466714_054551 | Ga0466714_054551_461_835 | 124 |
| 7 | 3300042613 | Ga0466710_392138 | Ga0466710_392138_109_483 | 124 |
| 8 | 3300042623 | Ga0466734_123996 | Ga0466734_123996_2965_3339 | 124 |
| 9 | 3300042648 | Ga0466709_094187 | Ga0466709_094187_64735_65109 | 124 |
| 10 | 3300042648 | Ga0466709_221860 | Ga0466709_221860_174101_174475 | 124 |
| 11 | 3300010882 | Ga0123354_10152270 | Ga0123354_101522702 | 125 |
| 12 | 3300042550 | Ga0466656_027094 | Ga0466656_027094_33815_34192 | 125 |
| 13 | 3300042582 | Ga0466657_090323 | Ga0466657_090323_6683_7060 | 125 |
| 14 | 3300042582 | Ga0466657_325354 | Ga0466657_325354_702_1079 | 125 |
| 15 | 3300042590 | Ga0466690_209074 | Ga0466690_209074_1195_1572 | 125 |
| 16 | 3300042592 | Ga0466693_075411 | Ga0466693_075411_603_980 | 125 |
| 17 | 3300042592 | Ga0466693_442600 | Ga0466693_442600_1818_2195 | 125 |
| 18 | 3300042593 | Ga0466691_135252 | Ga0466691_135252_196_573 | 125 |
| 19 | 3300042593 | Ga0466691_214142 | Ga0466691_214142_1577_1954 | 125 |
| 20 | 3300042594 | Ga0466694_031805 | Ga0466694_031805_501_878 | 125 |
| 21 | 3300042596 | Ga0466696_002012 | Ga0466696_002012_816_1193 | 125 |
| 22 | 3300042597 | Ga0466699_424605 | Ga0466699_424605_1232_1609 | 125 |
| 23 | 3300042598 | Ga0466701_001632 | Ga0466701_001632_609_986 | 125 |
| 24 | 3300042600 | Ga0466700_026773 | Ga0466700_026773_5288_5665 | 125 |
| 25 | 3300042603 | Ga0466714_050661 | Ga0466714_050661_1244_1621 | 125 |
| 26 | 3300042603 | Ga0466714_119079 | Ga0466714_119079_513_890 | 125 |
| 27 | 3300042604 | Ga0466717_052149 | Ga0466717_052149_639_1016 | 125 |
| 28 | 3300042605 | Ga0466716_127749 | Ga0466716_127749_3629_4006 | 125 |
| 29 | 3300042607 | Ga0466720_047876 | Ga0466720_047876_724_1101 | 125 |
| 30 | 3300042610 | Ga0466698_121227 | Ga0466698_121227_92_469 | 125 |
| 31 | 3300042612 | Ga0466705_117212 | Ga0466705_117212_1442_1819 | 125 |
| 32 | 3300042613 | Ga0466710_165020 | Ga0466710_165020_479_856 | 125 |
| 33 | 3300042613 | Ga0466710_190460 | Ga0466710_190460_349_726 | 125 |
| 34 | 3300042613 | Ga0466710_298345 | Ga0466710_298345_2780_3157 | 125 |
| 35 | 3300042616 | Ga0466715_133644 | Ga0466715_133644_587_964 | 125 |
| 36 | 3300042616 | Ga0466715_505860 | Ga0466715_505860_2992_3369 | 125 |
| 37 | 3300042620 | Ga0466728_295468 | Ga0466728_295468_486_863 | 125 |
| 38 | 3300042620 | Ga0466728_352573 | Ga0466728_352573_1832_2209 | 125 |
| 39 | 3300042636 | Ga0466703_031978 | Ga0466703_031978_5041_5418 | 125 |
| 40 | 3300042643 | Ga0466704_249651 | Ga0466704_249651_7965_8342 | 125 |
| 41 | 3300042656 | Ga0466732_337241 | Ga0466732_337241_5058_5435 | 125 |
| 42 | 3300042659 | Ga0466733_080326 | Ga0466733_080326_3102_3479 | 125 |
| 43 | 3300042659 | Ga0466733_174799 | Ga0466733_174799_1566_1943 | 125 |
| 44 | iso_pr_bacteria | 2820746860 | 2820748522 | 125 |
| 45 | iso_pr_bacteria | 2820770630 | 2820771511 | 125 |
| 46 | iso_pr_bacteria | 2820785563 | 2820785625 | 125 |
| 47 | iso_pr_bacteria | 2820788205 | 2820789089 | 125 |
| 48 | iso_pr_bacteria | 2873584433 | 2873585931 | 125 |
| 49 | 2225789004 | 2227507946 | 2227997917 | 126 |
| 50 | 3300000062 | IMNBL1DRAFT_c0005603 | IMNBL1DRAFT_00056034 | 126 |
| 51 | 3300002450 | JGI24695J34938_10059709 | JGI24695J34938_100597092 | 126 |
| 52 | 3300002462 | JGI24702J35022_10003912 | JGI24702J35022_100039121 | 126 |
| 53 | 3300002462 | JGI24702J35022_10023413 | JGI24702J35022_100234134 | 126 |
| 54 | 3300002462 | JGI24702J35022_10811171 | JGI24702J35022_108111711 | 126 |
| 55 | 3300002504 | JGI24705J35276_11603687 | JGI24705J35276_116036871 | 126 |
| 56 | 3300005200 | Ga0072940_1210327 | Ga0072940_12103272 | 126 |
| 57 | 3300005201 | Ga0072941_1042826 | Ga0072941_104282610 | 126 |
| 58 | 3300005201 | Ga0072941_1463900 | Ga0072941_14639001 | 126 |
| 59 | 3300009826 | Ga0123355_10000041 | Ga0123355_1000004163 | 126 |
| 60 | 3300009826 | Ga0123355_10000859 | Ga0123355_100008593 | 126 |
| 61 | 3300009826 | Ga0123355_11269459 | Ga0123355_112694591 | 126 |
| 62 | 3300010049 | Ga0123356_10110098 | Ga0123356_101100985 | 126 |
| 63 | 3300010049 | Ga0123356_10968013 | Ga0123356_109680132 | 126 |
| 64 | 3300010049 | Ga0123356_11000932 | Ga0123356_110009321 | 126 |
| 65 | 3300010049 | Ga0123356_11321746 | Ga0123356_113217462 | 126 |
| 66 | 3300010049 | Ga0123356_12081778 | Ga0123356_120817782 | 126 |
| 67 | 3300010049 | Ga0123356_12234754 | Ga0123356_122347542 | 126 |
| 68 | 3300010167 | Ga0123353_10000282 | Ga0123353_1000028217 | 126 |
| 69 | 3300010167 | Ga0123353_10101593 | Ga0123353_101015931 | 126 |
| 70 | 3300010167 | Ga0123353_10322631 | Ga0123353_103226313 | 126 |
| 71 | 3300010167 | Ga0123353_10413080 | Ga0123353_104130802 | 126 |
| 72 | 3300010167 | Ga0123353_10432652 | Ga0123353_104326524 | 126 |
| 73 | 3300010167 | Ga0123353_11411796 | Ga0123353_114117962 | 126 |
| 74 | 3300010167 | Ga0123353_11826907 | Ga0123353_118269071 | 126 |
| 75 | 3300010167 | Ga0123353_12777297 | Ga0123353_127772971 | 126 |
| 76 | 3300010882 | Ga0123354_10183522 | Ga0123354_101835222 | 126 |
| 77 | 3300010882 | Ga0123354_10397361 | Ga0123354_103973612 | 126 |
| 78 | 3300010882 | Ga0123354_10757246 | Ga0123354_107572461 | 126 |
| 79 | 3300010882 | Ga0123354_11005321 | Ga0123354_110053211 | 126 |
| 80 | 3300010882 | Ga0123354_11036686 | Ga0123354_110366861 | 126 |
| 81 | 3300010882 | Ga0123354_11073030 | Ga0123354_110730301 | 126 |
| 82 | 3300042604 | Ga0466717_044754 | Ga0466717_044754_1171_1551 | 126 |
| 83 | 3300042606 | Ga0466719_427451 | Ga0466719_427451_18171_18551 | 126 |
| 84 | 3300042610 | Ga0466698_072872 | Ga0466698_072872_106_486 | 126 |
| 85 | 3300042612 | Ga0466705_156124 | Ga0466705_156124_5987_6367 | 126 |
| 86 | 3300042624 | Ga0466735_048702 | Ga0466735_048702_566_946 | 126 |
| 87 | 3300042624 | Ga0466735_049667 | Ga0466735_049667_346_726 | 126 |
| 88 | 3300042648 | Ga0466709_420440 | Ga0466709_420440_24094_24474 | 126 |
| 89 | 3300042659 | Ga0466733_116190 | Ga0466733_116190_2150_2530 | 126 |
| 90 | 3300042659 | Ga0466733_147869 | Ga0466733_147869_3402_3782 | 126 |
| 91 | iso_pr_bacteria | 2820547636 | 2820547774 | 126 |
| 92 | iso_pr_bacteria | 2920168565 | 2920169308 | 126 |
| 93 | iso_pr_bacteria | 8002299145 | 8002302170 | 126 |
| 94 | 3300000062 | IMNBL1DRAFT_c0028268 | IMNBL1DRAFT_00282682 | 127 |
| 95 | 3300002504 | JGI24705J35276_12190305 | JGI24705J35276_121903052 | 127 |
| 96 | 3300010049 | Ga0123356_11974329 | Ga0123356_119743292 | 127 |
| 97 | 3300010049 | Ga0123356_12704492 | Ga0123356_127044922 | 127 |
| 98 | 3300010167 | Ga0123353_10157505 | Ga0123353_101575052 | 127 |
| 99 | 3300010167 | Ga0123353_10180902 | Ga0123353_101809024 | 127 |
| 100 | 3300010167 | Ga0123353_10697780 | Ga0123353_106977803 | 127 |
| 101 | 3300010167 | Ga0123353_11153355 | Ga0123353_111533551 | 127 |
| 102 | 3300010167 | Ga0123353_11180029 | Ga0123353_111800292 | 127 |
| 103 | 3300010167 | Ga0123353_11943857 | Ga0123353_119438572 | 127 |
| 104 | 3300010167 | Ga0123353_12057894 | Ga0123353_120578941 | 127 |
| 105 | 3300010167 | Ga0123353_12329525 | Ga0123353_123295252 | 127 |
| 106 | 3300010882 | Ga0123354_10680535 | Ga0123354_106805351 | 127 |
| 107 | 3300042599 | Ga0466706_081305 | Ga0466706_081305_55416_55799 | 127 |
| 108 | 3300042599 | Ga0466706_144722 | Ga0466706_144722_6199_6582 | 127 |
| 109 | 3300042602 | Ga0466713_080378 | Ga0466713_080378_62865_63248 | 127 |
| 110 | 3300042609 | Ga0466722_246648 | Ga0466722_246648_1629_2012 | 127 |
| 111 | 3300042610 | Ga0466698_266585 | Ga0466698_266585_148_531 | 127 |
| 112 | 3300042611 | Ga0466697_018318 | Ga0466697_018318_2244_2627 | 127 |
| 113 | 3300042621 | Ga0466729_175669 | Ga0466729_175669_2260_2643 | 127 |
| 114 | 3300042601 | Ga0466707_316178 | Ga0466707_316178_18459_18845 | 128 |
| 115 | 3300042602 | Ga0466713_003823 | Ga0466713_003823_38908_39294 | 128 |
| 116 | 3300042618 | Ga0466723_172300 | Ga0466723_172300_4619_5005 | 128 |
| 117 | 3300010049 | Ga0123356_10459775 | Ga0123356_104597752 | 129 |
| 118 | 3300010049 | Ga0123356_12064388 | Ga0123356_120643881 | 129 |
| 119 | 3300010882 | Ga0123354_10231724 | Ga0123354_102317242 | 129 |
| 120 | 3300042622 | Ga0466731_311255 | Ga0466731_311255_1672_2061 | 129 |
| 121 | 3300010167 | Ga0123353_10356380 | Ga0123353_103563805 | 130 |
| 122 | 3300042601 | Ga0466707_324337 | Ga0466707_324337_478_873 | 131 |
| 123 | 3300042655 | Ga0466727_185849 | Ga0466727_185849_23251_23646 | 131 |
| 124 | 3300010049 | Ga0123356_11492922 | Ga0123356_114929222 | 132 |
| 125 | 3300042602 | Ga0466713_140603 | Ga0466713_140603_660_1058 | 132 |
| 126 | 3300042600 | Ga0466700_266636 | Ga0466700_266636_1676_2077 | 133 |
| 127 | 3300042649 | Ga0466724_41994 | Ga0466724_41994_2212_2616 | 134 |
| 128 | 3300010049 | Ga0123356_10521910 | Ga0123356_105219102 | 135 |
| 129 | 3300038395 | Ga0415639_133925 | Ga0415639_133925_461_877 | 138 |
| 130 | 3300042601 | Ga0466707_362351 | Ga0466707_362351_31567_31983 | 138 |
| 131 | 3300010049 | Ga0123356_10092230 | Ga0123356_100922301 | 139 |
| 132 | 3300042602 | Ga0466713_043221 | Ga0466713_043221_36036_36455 | 139 |
| 133 | 3300042619 | Ga0466726_139474 | Ga0466726_139474_1239_1667 | 142 |
| 134 | 3300042616 | Ga0466715_052344 | Ga0466715_052344_463_906 | 147 |
| 135 | 3300042648 | Ga0466709_040085 | Ga0466709_040085_9747_10193 | 148 |
| 136 | 3300042596 | Ga0466696_345739 | Ga0466696_345739_2322_2792 | 156 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01042 | Ribonuc_L-PSP | Endoribonuclease L-PSP | 32 | 147 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.83 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.